Pou4f2 (POU domain, class 4, transcription factor 2)

Gene: Pou4f2 (POU domain, class 4, transcription factor 2) Mus musculus

Analyze

Symbol:

Pou4f2

Name:

POU domain, class 4, transcription factor 2

RGD ID:

1552160

MGI Page

MGI

Description:

Enables several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; p53 binding activity; and promoter-specific chromatin binding activity. Involved in several processes, including cellular response to estradiol stimulus; regulation of neuron projection development; and regulation of transcription by RNA polymerase II. Acts upstream of or within several processes, including axonogenesis; neuromuscular process controlling balance; and sensory perception of sound. Located in cytoplasm and nucleus. Part of euchromatin. Is expressed in several structures, including glomerular tuft; nervous system; placenta; sensory organ; and somite. Orthologous to human POU4F2 (POU class 4 homeobox 2).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

brain-3B; brain-specific homeobox/POU domain protein 3B; Brn; Brn-; Brn-3; Brn-3.2; Brn-3b; Brn3b; mBrn3; mBrn3-3R; POU domain, class 4, transcription factor, related sequence 1; Pou4f; Pou4f-rs1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POU4F2 (POU class 4 homeobox 2)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Pou4f2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pou4f2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POU4F2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	POU4F2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pou4f2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	POU4F2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	POU4F2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pou4f2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Pou4f2 (POU class 4 homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	POU4F2 (POU class 4 homeobox 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pou4f2 (POU class 4 homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Caenorhabditis elegans (roundworm):	unc-86	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	acj6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pou4f2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	79,159,638 - 79,163,276 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	79,159,639 - 79,163,274 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	78,433,009 - 78,436,647 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	78,433,010 - 78,436,645 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	80,956,908 - 80,960,551 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	81,329,081 - 81,332,724 (-)	NCBI		MGSCv36	mm8
Celera	8	82,709,269 - 82,712,912 (-)	NCBI		Celera
Cytogenetic Map	8	C1	NCBI
cM Map	8	36.99	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

methylmalonic acidemia cblA type (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP)

ammonium chloride (ISO)

antimycin A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

choline (EXP)

copper atom (ISO)

copper(0) (ISO)

daidzein (ISO)

deguelin (ISO)

diazinon (ISO)

entinostat (ISO)

folic acid (EXP)

fonofos (ISO)

genistein (ISO)

glycitein (ISO)

L-methionine (EXP)

lead diacetate (EXP,ISO)

lead(0) (ISO)

lipopolysaccharide (EXP,ISO)

methoxychlor (ISO)

methylmercury chloride (EXP)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

parathion (ISO)

picoxystrobin (ISO)

pirinixic acid (EXP)

pyrimidifen (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

tebufenpyrad (ISO)

terbufos (ISO)

thifluzamide (ISO)

trichloroethene (ISO)

valproic acid (ISO)

vorinostat (ISO)

zinc sulfate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

axon extension (IGI)

axon guidance (IMP)

axonogenesis (IMP)

cell differentiation (IEA)

cellular response to cytokine stimulus (IDA)

cellular response to estradiol stimulus (IDA)

cellular response to insulin stimulus (IMP)

cellular response to oxygen levels (ISO)

dorsal root ganglion development (IMP)

heart development (IGI)

intracellular estrogen receptor signaling pathway (ISO)

intrinsic apoptotic signaling pathway by p53 class mediator (IMP)

MAPK cascade (ISO)

negative regulation of adipose tissue development (IMP)

negative regulation of amacrine cell differentiation (IMP)

negative regulation of cell differentiation (IMP)

negative regulation of transcription by RNA polymerase II (IDA,IMP,ISO)

neuromuscular process controlling balance (IGI)

neuron differentiation (IGI,IMP)

positive regulation of axon extension (IMP)

positive regulation of cardiac muscle cell apoptotic process (ISO)

positive regulation of cell differentiation (IMP)

positive regulation of glucose import (IMP)

positive regulation of osteoclast differentiation (IMP)

positive regulation of programmed cell death (IMP)

positive regulation of transcription by RNA polymerase II (IDA,IGI,IMP,ISO)

regulation of DNA-templated transcription (IEA)

regulation of gene expression (ISO)

regulation of retinal ganglion cell axon guidance (IMP)

regulation of transcription by RNA polymerase II (IBA)

retina development in camera-type eye (IMP)

retinal ganglion cell axon guidance (IGI,IMP)

sensory perception of sound (IGI)

spermatogenesis (ISO)

Cellular Component

cytoplasm (IDA)

euchromatin (IDA)

nuclear speck (ISO)

nucleus (IDA,ISO)

transcription regulator complex (ISO)

Molecular Function

chromatin binding (IDA)

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IDA,IMP,ISO)

DNA-binding transcription factor activity (ISS,TAS)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IMP,ISO)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IDA)

p53 binding (IPI)

promoter-specific chromatin binding (IDA)

protein binding (IPI)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IDA)

sequence-specific DNA binding (IDA,IMP)

Molecular Pathway Annotations Click to see Annotation Detail View

p53 signaling pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal circadian behavior period (IAGP)

abnormal circardian behavior entrainment (IAGP)

abnormal eye electrophysiology (IAGP)

abnormal eye physiology (IAGP)

abnormal innervation (IAGP)

abnormal lateral geniculate nucleus morphology (IAGP)

abnormal Muller cell morphology (IAGP)

abnormal neuron physiology (IAGP)

abnormal olivary pretectal nucleus morphology (IAGP)

abnormal optic disk morphology (IAGP)

abnormal optic nerve innervation (IAGP)

abnormal optic nerve morphology (IAGP)

abnormal optic tract morphology (IAGP)

abnormal retina ganglion cell morphology (IAGP)

abnormal retina morphology (IAGP)

abnormal retina nerve fiber layer morphology (IAGP)

abnormal retina rod bipolar cell morphology (IAGP)

abnormal sensory neuron innervation pattern (IAGP)

abnormal superior colliculus morphology (IAGP)

abnormal suprachiasmatic nucleus morphology (IAGP)

abnormal vestibular system physiology (IAGP)

abnormal vision (IAGP)

abnormal visual pursuit (IAGP)

deafness (IAGP)

decreased amacrine cell number (IAGP)

decreased retina ganglion cell number (IAGP)

decreased total retina thickness (IAGP)

gliosis (IAGP)

impaired pupillary reflex (IAGP)

increased amacrine cell number (IAGP)

increased retina apoptosis (IAGP)

no abnormal phenotype detected (IAGP)

optic nerve atrophy (IAGP)

optic nerve degeneration (IAGP)

optic nerve hypoplasia (IAGP)

retina ganglion cell degeneration (IAGP)

retina hypoplasia (IAGP)

shortened circadian behavior period (IAGP)

thin retina ganglion layer (IAGP)

thin retina inner nuclear layer (IAGP)

thin retina outer nuclear layer (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Transcriptional regulation by p53.	Beckerman R and Prives C, Cold Spring Harb Perspect Biol. 2010 Aug;2(8):a000935. doi: 10.1101/cshperspect.a000935. Epub 2010 Apr 28.
2.	MGDs mouse GO annotations	MGD data from the GO Consortium
3.	MGD IEA	MGD IEA
4.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
5.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1967980	PMID:2739723	PMID:7623109	PMID:7904822	PMID:7935408	PMID:8162704	PMID:8166682	PMID:8276396	PMID:8290353	PMID:8537352	PMID:8632990	PMID:8637595
PMID:8662774	PMID:8670054	PMID:8876243	PMID:8955272	PMID:9256502	PMID:9448000	PMID:9582431	PMID:9598366	PMID:9630743	PMID:9735355	PMID:9918694	PMID:10341242
PMID:10349636	PMID:10357904	PMID:10414983	PMID:10924257	PMID:11042159	PMID:11069887	PMID:11076861	PMID:11156601	PMID:11163266	PMID:11217851	PMID:11493560	PMID:11493566
PMID:11807023	PMID:11807038	PMID:11889045	PMID:12019323	PMID:12040030	PMID:12051827	PMID:12195432	PMID:12223402	PMID:12609742	PMID:12642482	PMID:12654290	PMID:12724837
PMID:12756174	PMID:14559155	PMID:14623245	PMID:14625556	PMID:14744875	PMID:14973295	PMID:15094508	PMID:15151987	PMID:15233918	PMID:15312647	PMID:15459106	PMID:15509772
PMID:15537545	PMID:15604100	PMID:15618518	PMID:15647317	PMID:15716344	PMID:15733064	PMID:15733660	PMID:15797020	PMID:15976303	PMID:16026391	PMID:16038893	PMID:16141072
PMID:16141073	PMID:16182275	PMID:16202707	PMID:16236765	PMID:16267237	PMID:16343477	PMID:16354917	PMID:16651659	PMID:16672052	PMID:16690048	PMID:16702404	PMID:16959241
PMID:17075007	PMID:17092954	PMID:17145718	PMID:17166916	PMID:17444492	PMID:17480014	PMID:17559664	PMID:17638910	PMID:17661397	PMID:17668438	PMID:17898204	PMID:17919464
PMID:18077589	PMID:18086710	PMID:18094249	PMID:18287559	PMID:18321480	PMID:18356247	PMID:18367606	PMID:18368538	PMID:18417110	PMID:18434421	PMID:18460603	PMID:18562598
PMID:18625210	PMID:18626943	PMID:18787067	PMID:18940586	PMID:18987029	PMID:19081073	PMID:19088125	PMID:19109949	PMID:19323995	PMID:19339595	PMID:19389377	PMID:19404406
PMID:19409494	PMID:19416500	PMID:19459208	PMID:19553286	PMID:19596361	PMID:19692620	PMID:19828801	PMID:19877281	PMID:19924248	PMID:19945391	PMID:20053908	PMID:20059953
PMID:20130285	PMID:20150232	PMID:20151282	PMID:20211142	PMID:20231872	PMID:20394734	PMID:20463215	PMID:20533399	PMID:20696379	PMID:20713727	PMID:20826176	PMID:20826655
PMID:20949055	PMID:20969844	PMID:21087508	PMID:21138975	PMID:21267068	PMID:21273545	PMID:21451052	PMID:21541283	PMID:21622702	PMID:21765429	PMID:21771810	PMID:21830221
PMID:21857657	PMID:21873635	PMID:21875655	PMID:21935940	PMID:22063212	PMID:22128334	PMID:22258620	PMID:22262898	PMID:22323600	PMID:22326227	PMID:22411557	PMID:22445509
PMID:22609278	PMID:22836101	PMID:22907756	PMID:22973003	PMID:23028343	PMID:23170059	PMID:23172916	PMID:23197712	PMID:23223288	PMID:23293286	PMID:23426374	PMID:23481413
PMID:23649630	PMID:23652001	PMID:23678105	PMID:23714736	PMID:23720040	PMID:23805044	PMID:23926259	PMID:24116103	PMID:24146773	PMID:24392091	PMID:24559672	PMID:24608965
PMID:24643061	PMID:24709358	PMID:24736625	PMID:24753163	PMID:24799426	PMID:24799694	PMID:24838392	PMID:24853938	PMID:24952961	PMID:25179941	PMID:25216639	PMID:25228773
PMID:25253855	PMID:25356872	PMID:25757744	PMID:25775587	PMID:25794677	PMID:25959730	PMID:25966682	PMID:25989023	PMID:25990804	PMID:25995483	PMID:26356988	PMID:26439398
PMID:26545349	PMID:26628093	PMID:26670484	PMID:26861874	PMID:26876175	PMID:26949938	PMID:26962139	PMID:27151576	PMID:27210758	PMID:27224017	PMID:27385012	PMID:27390513
PMID:27391320	PMID:27402841	PMID:27532212	PMID:27697904	PMID:28009286	PMID:28011038	PMID:28356311	PMID:28384713	PMID:28402857	PMID:28579317	PMID:28594399	PMID:28676569
PMID:29114051	PMID:29137925	PMID:29218725	PMID:29249622	PMID:29559301	PMID:29665410	PMID:29770538	PMID:29888785	PMID:29922981	PMID:29950673	PMID:29959210	PMID:30127719
PMID:30173913	PMID:30297418	PMID:30333037	PMID:30470704	PMID:30485816	PMID:30866042	PMID:30995485	PMID:31002540	PMID:31197108	PMID:31286854	PMID:31333190	PMID:31399471
PMID:31413277	PMID:31609468	PMID:31626642	PMID:31915380	PMID:32150249	PMID:32741043	PMID:32878923	PMID:32986815	PMID:33096050	PMID:33135183	PMID:33208470	PMID:33238113
PMID:33674582	PMID:33712461	PMID:33742727	PMID:33795534	PMID:34327778	PMID:34677125	PMID:34847148	PMID:36715342	PMID:36737666	PMID:37073980	PMID:37126314	PMID:37522516
PMID:37590135	PMID:37733805	PMID:37983249	PMID:38007517	PMID:38089586

Genomics

Comparative Map Data

Pou4f2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	79,159,638 - 79,163,276 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	79,159,639 - 79,163,274 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	78,433,009 - 78,436,647 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	78,433,010 - 78,436,645 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	80,956,908 - 80,960,551 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	81,329,081 - 81,332,724 (-)	NCBI		MGSCv36	mm8
Celera	8	82,709,269 - 82,712,912 (-)	NCBI		Celera
Cytogenetic Map	8	C1	NCBI
cM Map	8	36.99	NCBI

POU4F2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	146,638,893 - 146,642,474 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	146,638,893 - 146,642,474 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	147,560,045 - 147,563,626 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	147,779,495 - 147,783,073 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	147,917,692 - 147,921,228	NCBI
Celera	4	144,880,585 - 144,884,163 (+)	NCBI		Celera
Cytogenetic Map	4	q31.22	NCBI
HuRef	4	143,287,267 - 143,290,856 (+)	NCBI		HuRef
CHM1_1	4	147,537,342 - 147,540,923 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	149,962,609 - 149,966,195 (+)	NCBI		T2T-CHM13v2.0

Pou4f2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	46,390,958 - 46,394,599 (+)	NCBI		GRCr8
mRatBN7.2	19	29,486,686 - 29,490,327 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	29,486,686 - 29,490,327 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	36,334,714 - 36,338,345 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	36,988,601 - 36,992,232 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	39,237,705 - 39,241,336 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	33,160,180 - 33,163,821 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	33,160,180 - 33,163,821 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	44,051,763 - 44,055,404 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	31,388,907 - 31,392,548 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	31,395,364 - 31,395,583 (+)	NCBI
Celera	19	28,985,198 - 28,988,839 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

Pou4f2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955428	2,324,834 - 2,329,205 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955428	2,325,775 - 2,329,122 (+)	NCBI	ChiLan1.0	ChiLan1.0

POU4F2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	144,502,661 - 144,505,603 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	144,868,893 - 144,871,835 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	138,969,157 - 138,972,730 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	150,626,392 - 150,629,961 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	150,626,392 - 150,629,961 (+)	Ensembl	panpan1.1		panPan2

POU4F2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	45,030,818 - 45,034,446 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	45,031,094 - 45,032,784 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	45,426,310 - 45,427,991 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	45,704,140 - 45,705,824 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	45,704,140 - 45,705,824 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	44,976,012 - 44,977,696 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	45,068,621 - 45,070,311 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	45,333,613 - 45,335,300 (+)	NCBI		UU_Cfam_GSD_1.0

Pou4f2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	45,265,697 - 45,274,468 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936535	2,705,162 - 2,711,813 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936535	2,705,184 - 2,711,785 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

POU4F2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	82,043,643 - 82,047,675 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	82,044,443 - 82,046,377 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	87,200,440 - 87,201,609 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POU4F2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	93,150,105 - 93,160,977 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	93,150,186 - 93,151,857 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	72,832,429 - 72,836,291 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pou4f2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624853	5,446,694 - 5,448,637 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624853	5,446,575 - 5,448,704 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pou4f2
163 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	821
Count of miRNA genes:	415
Interacting mature miRNAs:	574
Transcripts:	ENSMUST00000034115
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4140967	Bmd39_m	bone mineral density 39 (mouse)			Not determined		8	32506572	117965439	Mouse
1558875	Eae31_m	experimental allergic encephalomyelitis susceptibility 31 (mouse)			Not determined		8	35109930	115563747	Mouse
1301013	Capsq4_m	capsaicin sensitivity related QTL 4 (mouse)			Not determined		8	36630154	93455280	Mouse
27226754	Femd6_m	femur midshaft diameter 6, 10 week (mouse)					8	37867154	110326632	Mouse
12904744	Carcdq1_m	cardiac collagen deposition QTL 1 (mouse)					8	40162297	95416226	Mouse
10766453	Char11_m	P. chabaudi malaria resistance QTL 11 (mouse)					8	48090064	82090180	Mouse
1301717	Adip4_m	adiposity 4 (mouse)			Not determined		8	48090064	82090180	Mouse
1301441	Skull11_m	skull morphology 11 (mouse)			Not determined		8	48190168	82190288	Mouse
1357715	Alaa3_m	alopecia areata 3 (mouse)			Not determined		8	49245591	83245673	Mouse
14746987	Manh64_m	mandible shape 64 (mouse)					8	50505958	84505958	Mouse
14747005	Mancz7_m	mandible centroid size 7 (mouse)					8	50505958	84505958	Mouse
14700686	Civq3_m	cerebral infarct volume QTL 3 (mouse)					8	52334843	86334843	Mouse
1301506	Aevm1_m	autoimmune extremity vasculitis in MRL mice 1 (mouse)			Not determined		8	54740461	88740637	Mouse
1301952	Im3_m	immunoregulatory 3 (mouse)			Not determined		8	55159258	89159407	Mouse
10412287	Carg3_m	Candida albicans resistance gene 3 (mouse)			Not determined		8	56298872	90298872	Mouse
11353828	Gf7_m	gonadal fat pad weight 7 (mouse)					8	58928107	92928107	Mouse
10043975	Obq31_m	obesity QTL 31 (mouse)			Not determined		8	59136404	93136404	Mouse
1301688	Orch6_m	autoimmune orchitis resistance 6 (mouse)			Not determined		8	61513479	95513605	Mouse
4141285	Tgq18_m	triglyceride QTL 18 (mouse)			Not determined			64186736	98186736	Mouse
4141797	Skmw16_m	skeletal muscle weight 16 (mouse)			Not determined		8	64666176	98666325	Mouse
1357787	Vtbt5_m	vertebral trabecular bone trait 5 (mouse)			Not determined		8	66084397	100084549	Mouse
10043992	Hbnr11_m	Heligmosomoides bakeri nematode resistance 11 (mouse)			Not determined		8	66326836	100326976	Mouse
10766466	Char12_m	P. chabaudi malaria resistance QTL 12 (mouse)					8	68722479	83326976	Mouse
4142283	Imraq2_m	immune response to AAV2 QTL 2 (mouse)			Not determined		8	71032003	105032123	Mouse
1301767	Fcsa2_m	femoral cross-sectional area 2 (mouse)			Not determined		8	71032003	105032123	Mouse
4141395	Char2a_m	P. chabaudi malaria resistance QTL 2a (mouse)			Not determined			71589427	90929226	Mouse
1357708	Orq1_m	ovulation rate QTL 1 (mouse)			Not determined		8	71740461	124622354	Mouse
4142023	W3q5_m	weight 3 weeks QTL 5 (mouse)			Not determined			71740461	124622354	Mouse
1558780	Idd22_m	insulin dependent diabetes susceptibility 22 (mouse)			Not determined		8	71829531	105829637	Mouse
1301872	Cd4ts3_m	CD4 T cell subset 3 (mouse)			Not determined		8	72122809	106123021	Mouse
1300920	Pitm3_m	prion incubation time 3 (mouse)			Not determined		8	73929123	107929226	Mouse
27095912	Pglq14_m	pelvic girdle length QTL 14, 16 week (mouse)					8	74126628	126826739	Mouse
1558890	Lith18_m	lithogenic gene 18 (mouse)			Not determined		8	76402145	110402251	Mouse
1357470	Obq16_m	obesity QTL 16 (mouse)			Not determined		8	76411976	110412125	Mouse
10412234	Nhdlq14_m	non-HDL QTL 14 (mouse)			Not determined		8	76411976	110412125	Mouse
1301874	Hdlq16_m	HDL QTL 16 (mouse)			Not determined		8	76411976	110412125	Mouse

Markers in Region

PMC125354P2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	78,435,378 - 78,435,677	UniSTS	GRCm38
MGSCv37	8	80,959,277 - 80,959,576	UniSTS	GRCm37
Celera	8	82,711,638 - 82,711,937	UniSTS

Pou4f2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	78,435,527 - 78,435,617	UniSTS	GRCm38
MGSCv37	8	80,958,947 - 80,959,612	UniSTS	GRCm37
MGSCv37	8	80,959,176 - 80,959,294	UniSTS	GRCm37
Celera	8	82,711,787 - 82,711,877	UniSTS
cM Map	X		UniSTS
cM Map	X		UniSTS
cM Map	X		UniSTS
cM Map	8		UniSTS

PMC97568P2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	78,434,553 - 78,434,890	UniSTS	GRCm38
MGSCv37	8	80,958,452 - 80,958,789	UniSTS	GRCm37
Celera	8	82,710,813 - 82,711,150	UniSTS

Pou4f2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	78,435,048 - 78,435,713	UniSTS	GRCm38
MGSCv37	8	80,958,947 - 80,959,612	UniSTS	GRCm37
Celera	8	82,711,308 - 82,711,973	UniSTS

Pou4f2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	78,435,277 - 78,435,395	UniSTS	GRCm38
MGSCv37	8	80,959,176 - 80,959,294	UniSTS	GRCm37
Celera	8	82,711,537 - 82,711,655	UniSTS
cM Map	X		UniSTS

Pou4f2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
cM Map	X		UniSTS

Pou4f2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
cM Map	8		UniSTS
cM Map	X		UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138944	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC133181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK084240	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK087546	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S68377	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S69351	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Z29629	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSMUST00000034115 ⟹ ENSMUSP00000034115

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	79,159,639 - 79,163,274 (-)	Ensembl
GRCm38.p6 Ensembl	8	78,433,010 - 78,436,645 (-)	Ensembl

RefSeq Acc Id:

NM_138944 ⟹ NP_620394

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	79,159,638 - 79,163,276 (-)	NCBI
GRCm38	8	78,433,009 - 78,436,647 (-)	NCBI
MGSCv37	8	80,956,908 - 80,960,551 (-)	RGD
Celera	8	82,709,269 - 82,712,912 (-)	RGD
cM Map	8		ENTREZGENE

Sequence:

show sequence

ACTTTGGGGTGCTGAGGTCTGAAGCCAGAGCCACCCGGAGCAGGGCAACCTCTCGGGCAGACCT
AGCGGGAGACACAGGAGCGGAGCTAGCGGCCACACTGGGAGAACCGGGCCTGGAAGCAGTGGCG
GCTGAGCACAACTTTGCAGTGTTGTTCCCTCTGCTGCTCCGGCCGGGTACTTCTCCGGAGGGTC
GGGTAGCTGGGACCGGAGTGCGCCAGCGACGAGCGCGCCGCGCAAGGAAAGATGATGATGATGT
CCCTGAACAGCAAGCAGGCGTTCAGCATGCCTCACGCAGGCAGCCTGCACGTGGAGCCCAAGTA
CTCGGCGCTACACAGTGCCTCCCCGGGCTCCTCTGCGCCCGCGGCGCCCTCGGCCAGTTCCCCT
AGCAGCTCCAGCAACGCTGGCGGCGGCGGCGGTGGCGGCGGAGGCGGAGGCGGCGGCGGCCGGA
GCAGCAGTTCCAGCAGCAGTGGCAGCGGCGGCAGCGGCGGCGGCGGGGGCTCGGAGGCGATGCG
GAGAGCTTGTCTTCCAACCCCACCGAGCAATATATTCGGCGGGCTGGATGAGAGTCTGCTGGCC
CGTGCCGAGGCTCTGGCCGCCGTGGACATCGTCTCCCAGAGTAAGAGCCACCACCACCATCCGC
CCCACCACAGCCCCTTCAAGCCGGACGCCACTTACCACACCATGAACACCATCCCGTGCACGTC
GGCAGCCTCCTCTTCTTCTGTGCCCATCTCGCACCCGTCCGCTCTGGCTGGCACCCATCACCAC
CACCACCACCACCATCACCACCATCACCAGCCGCACCAGGCGCTGGAGGGCGAGCTGCTTGAGC
ACCTAAGCCCCGGGCTGGCCCTGGGAGCTATGGCGGGCCCCGACGGCACGGTGGTGTCCACTCC
GGCTCACGCACCACACATGGCCACCATGAACCCCATGCACCAAGCAGCCCTGAGCATGGCCCAC
GCACATGGGCTGCCCTCGCACATGGGCTGCATGAGCGACGTGGATGCAGACCCGCGGGACCTGG
AGGCGTTCGCCGAGCGTTTCAAGCAGCGACGCATCAAGCTGGGAGTGACCCAGGCAGATGTGGG
CTCGGCGCTGGCCAACCTCAAGATCCCGGGCGTGGGCTCGCTCAGCCAGAGCACCATCTGCAGG
TTTGAGTCTCTCACGCTGTCACACAACAACATGATCGCGCTCAAGCCCATCCTGCAGGCGTGGC
TGGAGGAAGCTGAGAAATCCCACCGCGAGAAGCTCACTAAGCCGGAGCTCTTCAATGGCGCGGA
GAAGAAGCGCAAGCGCACGTCCATCGCGGCGCCGGAGAAGCGCTCTCTGGAAGCCTACTTCGCC
ATCCAGCCAAGGCCCTCCTCGGAGAAGATCGCGGCCATCGCCGAAAAGCTGGATCTCAAGAAAA
ATGTGGTGCGCGTCTGGTTCTGCAACCAGAGGCAGAAACAGAAGAGAATGAAATACTCTGCCGG
CATTTAGGGACCCTTCTCCAGGGATGGCCCTTTCCCTTCGCCCTCTTTTTTTCTAACCCCCTTC
TTGTCTCTTCTGCCTCTTTCCTTTCTACTTTGGCTATCAGAAAACAATTCCGGTAAATGTGAAC
CCAGACCAAGCCAGGAGCAAAGAAGCAAGCAGCTGAGCCCAAATCAGAGAGATTGTGAACCGGT
TTCGCAGTGAAGAAAAACCAAAACCACAAACAACACAACACGAAAAGGAATTTGTCAAGTTGTA
GCAGAGCTGTCCCCTTTAACTGCACCTGGGCTGCTCGGCTTCATCAGAGAAAGCGAGGAGCTGA
CTGTCAACAGGAAGGTAGAGGGACAAGCTTTTGAAAACCCTGCAAGAATGAGCAAGTAAGATTT
GTTTTTGTTCTTACAGACGTCACCTTGTTCATGTTTAAAAGTACACTTTGCAGCTATTTTTCAG
AAATAGAAATTGATTCAGGACTGAAACTCGAAGCTAGAGTTGATGCTTAATGTGATATGATAGA
GACATCTCTAAAGTATTTTGAATTAAAAAAAGATGGCAGATTTTCTGCATTTACACTGTATATT
ATATATATATTTTTACTGTGGTTCTTATCGCTTTCTTCCTTCTCTGAAGTGTTAACACTTATGG
AAGGAGTTGCGCCTGCTGTGTTCACTGATCTTGACAGCTATTATTAGATTATTGCCGTACAACC
CTCTGTAAATTATTAATTTATCTCTCTGGCAACTTAATTTTGTGCACATCCTAATTAATTAAAC
TTCTTTAGTCTGAAAAATAAAACCGGCGGATACGTATAGCTAGTGATGCTCAAAACATTTTTCT
TTTTTTCTTTTTGGTCCTGGATTTTTACAGCTTCCCACTTAGACTGTGTTCGCTTTGGCCTAGT
TGTATATTCTCACTTTGAATGAAGATTGTTTCTTCCCTTTGTTTTTGACTGGTAGTGATCTAAT
TTGTGAGCTGACACTTTATAATTGATGTCTTAACCGTGTAGACCAGATTCACTGTCCGAAGTCT
TGTTTACTTCCTTACATATTTAATGGGGATTCCCATATTGTCCCCGCGGCACACGTGCTCTCTC
ACTCACCTTACATGCCTACACACAAACACACATACACATCTCTAACAGAAGAGAAGAAGCAGCT
GGAGGTACCAACGATGAGCAGTGTATACTTTCCCAGCCTTAGGTGCAGTCTCCACTTGGTGCTT
ACTCTGCTGGATTCTAAGATTTCACCAAGGTATTTCCATCTCCCAGTTTTCGATTGCTTTGTTG
CTACATTTTGACCTTTATAGGGGTCCTTCATTTTTTCCTTTTAGGAGGTTTGTTTGTAGGGGGA
AAAATTTGGAACTATAAGAAAGACAGTGCACTGCTTGTAAATTCACAGTGTTTGGTAGAATCCT
TTTGGAGCACACACACAAATAGGTACAAAGTGACTGGTACCTTATCTATTGTAAATATTTCATT
CAAAATGATGCACATATGAATATATTCTTACAGAATTTGCTGTAATTGCTGATCCATTTGAGGC
TCTCCAAAGTTCTGAGTTCTGTATATGACCTCGTTTCTTGTTTTTGTTAATGGGTTATTTACTA
TAGTAATGTATTAAGTTATTTTGAGTGTTGTTTCATTGTCTTTCATTGAAGAGATGATTTTAAT
GTTTTACTGGCAAAGTATGCTGCTTTTTTCATTAAAATATGCTATTAATATTAAATGACTTTTA
AAACGTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_620394	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB30578	(Get FASTA)	NCBI Sequence Viewer
	AAC60672	(Get FASTA)	NCBI Sequence Viewer
	BAC39921	(Get FASTA)	NCBI Sequence Viewer
	CAA82736	(Get FASTA)	NCBI Sequence Viewer
	EDL10857	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000034115
	ENSMUSP00000034115.3
GenBank Protein	Q63934	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_620394 ⟸ NM_138944

- UniProtKB:

Q63954 (UniProtKB/Swiss-Prot), Q63934 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MMMMSLNSKQAFSMPHAGSLHVEPKYSALHSASPGSSAPAAPSASSPSSSSNAGGGGGGGGGGG
GGGRSSSSSSSGSGGSGGGGGSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIVSQSKSH
HHHPPHHSPFKPDATYHTMNTIPCTSAASSSSVPISHPSALAGTHHHHHHHHHHHHQPHQALEG
ELLEHLSPGLALGAMAGPDGTVVSTPAHAPHMATMNPMHQAALSMAHAHGLPSHMGCMSDVDAD
PRDLEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPI
LQAWLEEAEKSHREKLTKPELFNGAEKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKL
DLKKNVVRVWFCNQRQKQKRMKYSAGI

hide sequence

RefSeq Acc Id:

ENSMUSP00000034115 ⟸ ENSMUST00000034115

Protein Domains

POU-specific

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63934-F1-model_v2	AlphaFold	Q63934	1-411	view protein structure

Promoters

RGD ID:

8667537

Promoter ID:

EPDNEW_M11797

Type:

single initiation site

Name:

Pou4f2_1

Description:

Mus musculus POU domain, class 4, transcription factor 2 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	8	78,436,647 - 78,436,707	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:102524	AgrOrtholog
Ensembl Genes	ENSMUSG00000031688	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000034115	ENTREZGENE
	ENSMUST00000034115.5	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.260.40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot
	Homeobox_CS	UniProtKB/Swiss-Prot
	Homeobox_dom	UniProtKB/Swiss-Prot
	Lambda_DNA-bd_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:18997	UniProtKB/Swiss-Prot
MGD	MGI:102524	ENTREZGENE
NCBI Gene	18997	ENTREZGENE
PANTHER	POU DOMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU DOMAIN, CLASS 4, TRANSCRIPTION FACTOR 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Homeodomain	UniProtKB/Swiss-Prot
	Pou	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pou4f2	PhenoGen
PRINTS	POUDOMAIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot
	HOMEOBOX_2	UniProtKB/Swiss-Prot
	POU_1	UniProtKB/Swiss-Prot
	POU_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POU_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	HOX	UniProtKB/Swiss-Prot
	POU	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot
	SSF47413	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	PO4F2_MOUSE	UniProtKB/Swiss-Prot
	Q62091_MOUSE	UniProtKB/TrEMBL
	Q63934	ENTREZGENE
	Q63954	ENTREZGENE
UniProt Secondary	Q63954	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Mammalian Phenotype