Advanced Search (OLGA)

Gene: Pou4f2 (POU class 4 homeobox 2) Rattus norvegicus

Analyze

Symbol:

Pou4f2

Name:

POU class 4 homeobox 2

RGD ID:

620075

Description:

Predicted to enable several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; p53 binding activity; and promoter-specific chromatin binding activity. Involved in several processes, including cellular response to oxygen levels; positive regulation of cardiac muscle cell apoptotic process; and spermatogenesis. Predicted to be located in cytoplasm; euchromatin; and nuclear speck. Predicted to be part of transcription regulator complex. Orthologous to human POU4F2 (POU class 4 homeobox 2); PARTICIPATES IN p53 signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

brain-3B; brain-specific homeobox/POU domain protein 3B; Brn-3.2; Brn-3B; Brn3b; POU domain, class 4, transcription factor 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POU4F2 (POU class 4 homeobox 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Pou4f2 (POU domain, class 4, transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pou4f2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POU4F2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	POU4F2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pou4f2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	POU4F2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	POU4F2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pou4f2 (POU class 4 homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SCEL (sciellin)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	POU4F2 (POU class 4 homeobox 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pou4f2 (POU domain, class 4, transcription factor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pou4f2 (POU class 4 homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-86	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-86	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	acj6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	acj6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pou4f2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	46,390,958 - 46,394,599 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	46,390,958 - 46,394,599 (+)	Ensembl				GRCr8
mRatBN7.2	19	29,486,686 - 29,490,327 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	29,486,686 - 29,490,327 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	36,334,714 - 36,338,345 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	36,988,601 - 36,992,232 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	39,237,705 - 39,241,336 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	33,160,180 - 33,163,821 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	33,160,180 - 33,163,821 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	44,051,763 - 44,055,404 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	31,388,907 - 31,392,548 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	28,985,198 - 28,988,839 (+)	NCBI		Celera
RGSC_v3.1	19	31,395,364 - 31,395,583 (+)	NCBI
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

methylmalonic acidemia cblA type (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antimycin A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

CGP 52608 (ISO)

choline (ISO)

copper atom (EXP)

copper(0) (EXP)

daidzein (ISO)

deguelin (ISO)

diazinon (ISO)

entinostat (ISO)

folic acid (ISO)

fonofos (ISO)

genistein (ISO)

glycitein (ISO)

L-methionine (ISO)

lead diacetate (EXP,ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

parathion (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

pyrimidifen (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (EXP,ISO)

tebufenpyrad (ISO)

terbufos (ISO)

thifluzamide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

valproic acid (ISO)

vorinostat (ISO)

zinc sulfate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

axon extension (IEA,ISO)

axon guidance (IEA,ISO)

axonogenesis (IEA,ISO)

cell differentiation (IEA)

cellular response to cytokine stimulus (IEA,ISO,ISS)

cellular response to estradiol stimulus (ISO,ISS)

cellular response to insulin stimulus (IEA,ISO)

cellular response to oxygen levels (IMP)

dorsal root ganglion development (IEA,ISO,ISS)

estrogen receptor signaling pathway (ISO)

heart development (IEA,ISO)

intrinsic apoptotic signaling pathway by p53 class mediator (ISO,ISS)

MAPK cascade (ISO)

negative regulation of adipose tissue development (IEA,ISO)

negative regulation of amacrine cell differentiation (IEA,ISO,ISS)

negative regulation of cell differentiation (IEA,ISO,ISS)

negative regulation of DNA-binding transcription factor activity (ISO,ISS)

negative regulation of transcription by RNA polymerase II (IEA,ISO)

neuromuscular process controlling balance (IEA,ISO)

neuron differentiation (IEA,ISO)

positive regulation of axon extension (IEA,ISO,ISS)

positive regulation of cardiac muscle cell apoptotic process (IMP)

positive regulation of cell differentiation (IEA,ISO,ISS)

positive regulation of D-glucose import (IEA,ISO)

positive regulation of osteoclast differentiation (IEA,ISO,ISS)

positive regulation of programmed cell death (ISO,ISS)

positive regulation of transcription by RNA polymerase II (IEA,ISO,ISS)

regulation of DNA-binding transcription factor activity (ISO,ISS)

regulation of DNA-templated transcription (IEA)

regulation of gene expression (IMP)

regulation of retinal ganglion cell axon guidance (IEA,ISO,ISS)

regulation of transcription by RNA polymerase II (IBA)

retina development in camera-type eye (IEA,ISO)

retinal ganglion cell axon guidance (IEA,ISO)

sensory perception of sound (IEA,ISO)

spermatogenesis (IEA,IEP)

Cellular Component

cytoplasm (IEA,ISO,ISS)

euchromatin (IEA,ISO)

nuclear speck (IEA,ISO,ISS)

nucleus (IEA,ISO,ISS)

transcription regulator complex (ISO)

Molecular Function

chromatin binding (IEA,ISO)

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO,ISS)

DNA-binding transcription factor activity (IEA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA,ISO,ISS)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO)

p53 binding (IEA,ISO)

promoter-specific chromatin binding (IEA,ISO,ISS)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IEA,ISO)

sequence-specific DNA binding (IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

p53 signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Transcriptional regulation by p53.	Beckerman R and Prives C, Cold Spring Harb Perspect Biol. 2010 Aug;2(8):a000935. doi: 10.1101/cshperspect.a000935. Epub 2010 Apr 28.
2.	Co-expression of POU4F2/Brn-3b with p53 may be important for controlling expression of pro-apoptotic genes in cardiomyocytes following ischaemic/hypoxic insults.	Budhram-Mahadeo V, etal., Cell Death Dis. 2014 Oct 30;5:e1503. doi: 10.1038/cddis.2014.452.
3.	The closely related POU family transcription factors Brn-3a and Brn-3b are expressed in distinct cell types in the testis.	Budhram-Mahadeo V, etal., Int J Biochem Cell Biol. 2001 Oct;33(10):1027-39.
4.	The BRN-3A transcription factor protects sensory but not sympathetic neurons from programmed cell death/apoptosis.	Ensor E, etal., J Biol Chem 2001 Feb 16;276(7):5204-12.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:7623109	PMID:7691107	PMID:7904822	PMID:7935408	PMID:8290353	PMID:8537352	PMID:8637595	PMID:8670054	PMID:9448000	PMID:9630743	PMID:9735355	PMID:10357904
PMID:11163266	PMID:11807038	PMID:12609742	PMID:17145718	PMID:17637757	PMID:17668438	PMID:17855369	PMID:18367606	PMID:18368538	PMID:18434421	PMID:19266028	PMID:19389377
PMID:20609388	PMID:20826655	PMID:21241485	PMID:21875655	PMID:23805044	PMID:24643061	PMID:25587060	PMID:25775587	PMID:25786379	PMID:26670484	PMID:28594399	PMID:31413277

Genomics

Comparative Map Data

Pou4f2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	46,390,958 - 46,394,599 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	46,390,958 - 46,394,599 (+)	Ensembl				GRCr8
mRatBN7.2	19	29,486,686 - 29,490,327 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	29,486,686 - 29,490,327 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	36,334,714 - 36,338,345 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	36,988,601 - 36,992,232 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	39,237,705 - 39,241,336 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	33,160,180 - 33,163,821 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	33,160,180 - 33,163,821 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	44,051,763 - 44,055,404 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	31,388,907 - 31,392,548 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	28,985,198 - 28,988,839 (+)	NCBI		Celera
RGSC_v3.1	19	31,395,364 - 31,395,583 (+)	NCBI
Cytogenetic Map	19	q11	NCBI

POU4F2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	146,638,893 - 146,642,474 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	146,638,893 - 146,642,474 (+)	Ensembl			hg38	GRCh38
GRCh37	4	147,560,045 - 147,563,626 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	147,779,495 - 147,783,073 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	4	147,917,692 - 147,921,228	NCBI
Celera	4	144,880,585 - 144,884,163 (+)	NCBI		Celera
Cytogenetic Map	4	q31.22	NCBI
HuRef	4	143,287,267 - 143,290,856 (+)	NCBI		HuRef
CHM1_1	4	147,537,342 - 147,540,923 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	149,962,609 - 149,966,195 (+)	NCBI		T2T-CHM13v2.0

Pou4f2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	79,159,638 - 79,163,276 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	79,159,639 - 79,163,274 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	78,433,009 - 78,436,647 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	78,433,010 - 78,436,645 (-)	Ensembl			mm10	GRCm38
MGSCv37	8	80,956,908 - 80,960,551 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	81,329,081 - 81,332,724 (-)	NCBI		MGSCv36	mm8
Celera	8	82,709,269 - 82,712,912 (-)	NCBI		Celera
Cytogenetic Map	8	C1	NCBI
cM Map	8	36.99	NCBI

Pou4f2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955428	2,324,834 - 2,329,205 (+)	Ensembl
ChiLan1.0	NW_004955428	2,325,775 - 2,329,122 (+)	NCBI	ChiLan1.0	ChiLan1.0

POU4F2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	144,502,661 - 144,505,603 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	144,868,893 - 144,871,835 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	138,969,157 - 138,972,730 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	150,626,392 - 150,629,961 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	150,626,392 - 150,629,961 (+)	Ensembl			panPan2	panpan1.1

POU4F2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	45,030,818 - 45,034,446 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	45,031,094 - 45,032,784 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	45,426,310 - 45,427,991 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	45,704,140 - 45,705,824 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	45,704,140 - 45,705,824 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	44,976,012 - 44,977,696 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	45,068,621 - 45,070,311 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	45,333,613 - 45,335,300 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pou4f2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	45,265,697 - 45,274,468 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936535	2,705,162 - 2,711,813 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936535	2,705,184 - 2,711,785 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

POU4F2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	82,043,643 - 82,047,675 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	82,044,443 - 82,046,377 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	87,200,440 - 87,201,609 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POU4F2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	93,150,105 - 93,160,977 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	93,150,186 - 93,151,857 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	72,832,429 - 72,836,291 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pou4f2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624853	5,446,694 - 5,448,637 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624853	5,446,575 - 5,448,704 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Pou4f2
34 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	234
Count of miRNA genes:	141
Interacting mature miRNAs:	192
Transcripts:	ENSRNOT00000016422
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	19220689	64220689	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	7997750	52997750	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	46226778	74246245	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	44385134	74246245	Rat
61328	Eae8	Experimental allergic encephalomyelitis QTL 8	4		nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	19	41720609	49971820	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	31287532	51431640	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	7997750	52997750	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	41722546	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat
1354633	Bw28	Body weight QTL 28	6.04		body mass (VT:0001259)	body weight (CMO:0000012)	19	40727092	54856850	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	30099383	47207961	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	7997750	52997750	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	5748064	50748064	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	7997750	52997750	Rat
1354607	Gmadr1	Adrenal mass QTL 1	5.83		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	19	40727092	54856850	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
1354600	Salc2	Saline consumption QTL 2	9.91	0.001	drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	19	40727092	54856850	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat

Markers in Region

Pou4f2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	29,487,715 - 29,487,806 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	33,161,210 - 33,161,300	NCBI	Rnor6.0
Rnor_5.0	19	44,052,793 - 44,052,883	UniSTS	Rnor5.0
Celera	19	28,986,228 - 28,986,318	UniSTS
Cytogenetic Map	19	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
5	1	7	81	16	16	8	5	8	5	34	16	75	5	19	8	8	8

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_134355	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF390076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016422 ⟹ ENSRNOP00000016422

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	46,390,958 - 46,394,599 (+)	Ensembl
mRatBN7.2 Ensembl	19	29,486,686 - 29,490,327 (+)	Ensembl
Rnor_6.0 Ensembl	19	33,160,180 - 33,163,821 (+)	Ensembl

RefSeq Acc Id:

NM_134355 ⟹ NP_599182

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	46,390,958 - 46,394,599 (+)	NCBI
mRatBN7.2	19	29,486,686 - 29,490,327 (+)	NCBI
Rnor_6.0	19	33,160,180 - 33,163,821 (+)	NCBI
Rnor_5.0	19	44,051,763 - 44,055,404 (+)	NCBI
RGSC_v3.4	19	31,388,907 - 31,392,548 (+)	RGD
Celera	19	28,985,198 - 28,988,839 (+)	RGD

Sequence:

show sequence

GGGGCACTTTGGGGCGCTGAGGTCTGAAGCCAGCGCCACCCGGAGCAGGGCAACAGCTTGAGCA
GACCCAGCAGGCGACACAGAAGCGGAGCCAGACTGGGAGAGCCGAGCCTGGAAGCGGTGGCCGC
TGAGCACAACTTTGCCGTGTTGTTCCCTCTGCTGCTCCCGCCGGGTACTTCTCCGGAGGGTCGG
TAGCTGGGACCAGAGTGAGCCAGCGACGAGCGCGCCGCGCAAGGAAAGATGATGATGATGTCCC
TGAATAGCAAGCAGGCGTTCAGCATGCCTCATGCCGGCAGCCTGCATGTGGAGCCCAAGTACTC
GGCGCTGCACAGTGCCTCCCCGGGTTCCTCTGCGCCCGCGGCGCCCTCGGCCAGTTCCCCTAGC
AGCTCCAGCAACGCTGGCAGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGTGGTGGCGGAGGCC
GGAGCAGCAGTTCCAGCAGCAGTGGCAGCGGCGGCGGCGGCGGCGGGGGCTCGGAGGCGATGCG
GAGAGCTTGTCTTCCAACCCCACCGAGCAATATATTCGGCGGTCTGGATGAGAGTCTGCTGGCC
CGTGCCGAGGCTCTGGCCGCCGTGGACATCGTCTCCCAGAGTAAGAGCCACCACCACCATCCGC
CCCACCACAGCCCCTTCAAGCCGGACGCCACTTACCACACCATGAACACCATCCCGTGCACGTC
TGCCGCTTCCTCTTCATCCGTGCCCATCTCGCACCCGTCCGCTCTGGCTGGCACCCACCACCAT
CACCACCACCACCATCACCACCACCACCAGCCACATCAGGCTCTGGAGGGCGAGCTGCTGGAGC
ACCTGAGCCCCGGGCTGGCCCTGGGAGCCATGGCGGGCCCCGACGGCACGGTGGTGTCCACTCC
GGCTCACGCACCGCACATGGCCACCATGAACCCCATGCACCAAGCAGCCCTGAGCATGGCCCAC
GCGCACGGTCTGCCCTCGCACATGGGCTGCATGAGCGACGTGGATGCAGACCCGCGGGACCTGG
AGGCGTTCGCCGAGCGCTTCAAGCAGCGACGCATCAAGCTGGGAGTGACCCAGGCGGATGTGGG
TTCGGCGCTGGCCAACCTCAAGATACCGGGCGTAGGCTCGCTCAGCCAGAGCACCATCTGCAGG
TTTGAGTCCCTCACGCTGTCGCACAACAACATGATCGCGCTCAAGCCCATCCTGCAGGCGTGGC
TGGAGGAAGCAGAGAAATCCCACCGCGAGAAGCTCACCAAGCCCGAGCTCTTCAATGGCGCGGA
GAAGAAGCGCAAGCGCACGTCCATCGCGGCGCCCGAGAAGCGCTCACTGGAAGCCTACTTCGCC
ATCCAGCCAAGGCCCTCCTCGGAGAAGATCGCGGCCATCGCCGAGAAGCTGGATCTCAAGAAAA
ACGTAGTGCGCGTCTGGTTCTGCAACCAGAGGCAGAAACAGAAGAGAATGAAATACTCAGCCGG
CATTTAGGGACCCTTCTCCAGGGATGGCCCTTTCCCTTCGCCCTCTCTTTTCTAACCCCCCTCT
TGTCTCTCCTGCCTCTTTTCTTTCTACTTTGGCTATCAGAAACAATTCCGGTAAATGTGAACCC
AGACCAAGTCAGGAGCAAAGAAACAAGCAGCTGAGCCCAAATCAGAAAGATTGTGAATTGATTT
CGCAAAGTGAAGAAAAAACAAAATCACAAACACACCACAAAAGGAATTTGTCACGTTGTAACAG
AGCTGTCCCTTTTAAGCGCACCTCGACTGCTCAGCTTCATCAGAGGAAGTGTGGAGCTGGTTGT
CAACAGGAAGACAGAGGGACAAGCTTCTGAAAACCCCGCAAGAATGAGCAAGTAAGATTTGTTT
TTATTCTTACAGACGTCACCTTGTTCACGTTTAAAAGTACACTTTGCAGCTATTTTTCAGAAAT
AGAAATTGATTCAGGACTGAAACTCGAAGCTAGAGTTGATGCTTAATGTGACACGATAGAGACG
CCTCTAAAGTATTTTGAATTAAAAAAAGATGGCAGATTTTCTGCATTTACACTGTATATTATAT
ATATATTTTTATTGTGGTTCTTATCGCTTTCTTCCTTCTCTAAAGTGTTAATACTTACGAAGGA
GTTGCGCCTGCTGTGTTCACTGATCTTGACAACTATTATTAGATTATTGCCGTACAACCTTCTG
TAAATTATTAATTTATCTCTCTGGCAACTTAATTTTGTGCACATCCTAACTAACTAAACTTCTT
TAGTCTGAAAAATAAAACCGGCGGATACATATAGGTAGTGATGCTCAAATGTTCTTTTTTCTTT
TTCCGTCTGATGAGTTCCCTGGAGTTTCACAGCTTTCCCGCTTAGACTGTGTTCTCTTCGGCCT
AGTTGTATATTCTCACTTTGAATGAAGATTGTTTCCTCCCTTTGTTTTTAACTGGTAGCGTTCT
AATTTGTGAGCTGACACTTGATAATGGATGTCTTAATCGTGTAGATCTGATTCACTGTCCGAAG
TCTTGTTTACTTCCTTCCATATTTAATGGGGATTCCCACATTGTCCCCCGCAGCACACGTGCTC
TCTCACTCACTTTACAAGCCTACACACAGACACACAGTACACGTCTCTAACAGAAGAGAAGGGG
CAGTTGGAGGTACGACTGATAACCAGTGTATCCTTTTCCAGCCTAGGTGCGTTCTCCACTTGGT
GCTTACTCTGCTGGACTCAAAGATTTCACCCAGGTATTTCAATCTCCCAGCTTTTAGTTGCTTT
GTGGCTACATTTGACCTTTATAGGATCCTTCAGTTTTTCCTTTTAGGATGTTTGTTTGTAGGGG
AAAATTTTGGAACTATAAGAAAGACAGTGCACTGCCTGTAAATTCACAGTGTTTGGTAGAATCC
TTTTGGAGCACACACACAAGAATAGGTACACAGCGACTGGTACCTTCTCTATTGTAAATATTTC
ATTCAAAATGATGCACATATAAATATATTCTTACAGAATTTGCTGTAATTGTTGATCCATTTGA
GGCTCTCCAAAGTTCTGAGTTCTGTATATGACCTCGTTCCTTGTTTTTGTTAATGAATTATTTA
CTATAGTAATGTATTAAGTTATTTTGGGTGTTGTTTCATTGTCTTTCATCGAAGAGATGATTTT
AATGTTTTATTGGCAAAGTATGCTACTTTTTTCATTAAAATATGCTATTAATATTAAATGACTT
TTAAAACGTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_599182	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK70503	(Get FASTA)	NCBI Sequence Viewer
	EDL92324	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016422
	ENSRNOP00000016422.3
GenBank Protein	G3V7L5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_599182 ⟸ NM_134355

- UniProtKB:

G3V7L5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MMMMSLNSKQAFSMPHAGSLHVEPKYSALHSASPGSSAPAAPSASSPSSSSNAGSGGGGGGGGG
GGGGGRSSSSSSSGSGGGGGGGSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIVSQSKS
HHHHPPHHSPFKPDATYHTMNTIPCTSAASSSSVPISHPSALAGTHHHHHHHHHHHHQPHQALE
GELLEHLSPGLALGAMAGPDGTVVSTPAHAPHMATMNPMHQAALSMAHAHGLPSHMGCMSDVDA
DPRDLEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKP
ILQAWLEEAEKSHREKLTKPELFNGAEKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEK
LDLKKNVVRVWFCNQRQKQKRMKYSAGI

hide sequence

Ensembl Acc Id:

ENSRNOP00000016422 ⟸ ENSRNOT00000016422

Protein Domains

POU-specific

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V7L5-F1-model_v2	AlphaFold	G3V7L5	1-412	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620075	AgrOrtholog
BioCyc Gene	G2FUF-5927	BioCyc
Ensembl Genes	ENSRNOG00000012167	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000016422	ENTREZGENE
	ENSRNOT00000016422.6	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.260.40	UniProtKB/Swiss-Prot
	Homeodomain-like	UniProtKB/Swiss-Prot
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot
	Homeobox_CS	UniProtKB/Swiss-Prot
	Homeobox_dom	UniProtKB/Swiss-Prot
	Lambda_DNA-bd_dom_sf	UniProtKB/Swiss-Prot
	POU	UniProtKB/Swiss-Prot
	POU_dom	UniProtKB/Swiss-Prot
	POU_domain_TF	UniProtKB/Swiss-Prot
KEGG Report	rno:171355	UniProtKB/Swiss-Prot
NCBI Gene	171355	ENTREZGENE
PANTHER	POU DOMAIN	UniProtKB/Swiss-Prot
	POU DOMAIN, CLASS 4, TRANSCRIPTION FACTOR 2	UniProtKB/Swiss-Prot
Pfam	Homeodomain	UniProtKB/Swiss-Prot
	Pou	UniProtKB/Swiss-Prot
PhenoGen	Pou4f2	PhenoGen
PRINTS	POUDOMAIN	UniProtKB/Swiss-Prot
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot
	HOMEOBOX_2	UniProtKB/Swiss-Prot
	POU_1	UniProtKB/Swiss-Prot
	POU_2	UniProtKB/Swiss-Prot
	POU_3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000012167	RatGTEx
SMART	HOX	UniProtKB/Swiss-Prot
	POU	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot
	SSF47413	UniProtKB/Swiss-Prot
UniProt	G3V7L5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Pou4f2	POU domain, class 4, transcription factor 2			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Pou4f2	POU domain, class 4, transcription factor 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_process	enhances the survival of nerve growth factor-dependent sensory but not sympathetic neurons	724643

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations