Symbol:
Sh3gl3
Name:
SH3-domain GRB2-like 3
RGD ID:
1551861
MGI Page
MGI
Description:
Predicted to enable identical protein binding activity. Predicted to be involved in negative regulation of clathrin-dependent endocytosis and positive regulation of neuron differentiation. Located in cytoplasm. Is expressed in several structures, including adrenal gland; central nervous system; dorsal aorta; peripheral nervous system; and testis. Orthologous to human SH3GL3 (SH3 domain containing GRB2 like 3, endophilin A3).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
EEN-B; EEN-B2; endophilin III; endophilin-3; endophilin-A3; MGC118269; SH3 domain protein 2 C2; SH3 domain protein 2C; SH3 domain-containing GRB2-like protein 3; Sh3d2; Sh3d2c; Sh3d2c2; SH3P; SH3P13
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SH3GL3 (SH3 domain containing GRB2 like 3, endophilin A3) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Sh3gl3 (SH3 domain containing GRB2 like 3, endophilin A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sh3gl3 (SH3 domain containing GRB2 like 3, endophilin A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SH3GL3 (SH3 domain containing GRB2 like 3, endophilin A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SH3GL3 (SH3 domain containing GRB2 like 3, endophilin A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sh3gl3 (SH3 domain containing GRB2 like 3, endophilin A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SH3GL3 (SH3 domain containing GRB2 like 3, endophilin A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SH3GL3 (SH3 domain containing GRB2 like 3, endophilin A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sh3gl3 (SH3 domain containing GRB2 like 3, endophilin A3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Sh3gl3 (SH3 domain containing GRB2 like 3, endophilin A3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SH3GL3 (SH3 domain containing GRB2 like 3, endophilin A3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sh3gl3b (SH3-domain GRB2-like 3b)
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB|ZFIN)
Danio rerio (zebrafish):
sh3gl3a (SH3-domain GRB2-like 3a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
EndoA
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
unc-57
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
sh3gl3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Sh3d2c-ps1
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 81,824,581 - 81,956,618 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 81,823,588 - 81,956,627 (+) Ensembl GRCm39 Ensembl GRCm38 7 82,173,808 - 82,307,420 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 82,173,840 - 82,307,419 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 89,408,638 - 89,455,929 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 82,136,564 - 82,183,595 (+) NCBI MGSCv36 mm8 Celera 7 79,583,452 - 79,715,386 (+) NCBI Celera Cytogenetic Map 7 D3 NCBI cM Map 7 47.15 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sh3gl3 Mouse (+)-schisandrin B multiple interactions ISO Sh3gl3 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SH3GL3 mRNA] CTD PMID:31150632 Sh3gl3 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of SH3GL3 mRNA] CTD PMID:22206623 Sh3gl3 Mouse 17beta-estradiol multiple interactions ISO SH3GL3 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of SH3GL3 mRNA CTD PMID:30165855 Sh3gl3 Mouse 17beta-estradiol increases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Estradiol results in increased expression of SH3GL3 mRNA CTD PMID:32145629 Sh3gl3 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SH3GL3 mRNA CTD PMID:21215274 Sh3gl3 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SH3GL3 mRNA CTD PMID:32109520 Sh3gl3 Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Sh3gl3 Mouse 2,6-dinitrotoluene affects expression ISO Sh3gl3 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of SH3GL3 mRNA CTD PMID:21346803 Sh3gl3 Mouse 3H-1,2-dithiole-3-thione decreases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 1 and 2-dithiol-3-thione results in decreased expression of SH3GL3 mRNA CTD PMID:19162173 Sh3gl3 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO Sh3gl3 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SH3GL3 mRNA CTD PMID:36041667 Sh3gl3 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of SH3GL3 mRNA CTD PMID:28973697 Sh3gl3 Mouse 6-propyl-2-thiouracil increases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of SH3GL3 mRNA CTD PMID:24780913 and PMID:30047161 Sh3gl3 Mouse acetamide decreases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 acetamide results in decreased expression of SH3GL3 mRNA CTD PMID:31881176 Sh3gl3 Mouse all-trans-retinoic acid increases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Tretinoin results in increased expression of SH3GL3 mRNA CTD PMID:20488242 Sh3gl3 Mouse amiodarone affects expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Amiodarone affects the expression of SH3GL3 mRNA CTD PMID:18355885 Sh3gl3 Mouse amitriptyline affects expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Amitriptyline affects the expression of SH3GL3 mRNA CTD PMID:18355885 Sh3gl3 Mouse amitrole increases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Amitrole results in increased expression of SH3GL3 mRNA CTD PMID:30047161 Sh3gl3 Mouse ammonium chloride affects expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of SH3GL3 mRNA CTD PMID:16483693 Sh3gl3 Mouse aristolochic acid A decreases expression ISO SH3GL3 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SH3GL3 mRNA CTD PMID:33212167 Sh3gl3 Mouse arsane multiple interactions ISO SH3GL3 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of SH3GL3 mRNA CTD PMID:32525701 Sh3gl3 Mouse arsenic atom multiple interactions ISO SH3GL3 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of SH3GL3 mRNA CTD PMID:32525701 Sh3gl3 Mouse arsenite(3-) increases expression EXP 6480464 arsenite results in increased expression of SH3GL3 mRNA CTD PMID:18929588 Sh3gl3 Mouse arsenite(3-) multiple interactions ISO SH3GL3 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to SH3GL3 mRNA] CTD PMID:32406909 Sh3gl3 Mouse benzo[a]pyrene decreases methylation ISO SH3GL3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SH3GL3 promoter CTD PMID:27901495 Sh3gl3 Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO Sh3gl3 (Rattus norvegicus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of SH3GL3 mRNA CTD PMID:31199487 Sh3gl3 Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of SH3GL3 mRNA and Diethylhexyl Phthalate results in decreased expression of SH3GL3 protein CTD PMID:36356568 Sh3gl3 Mouse bisphenol A decreases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of SH3GL3 mRNA CTD PMID:25181051 more ... Sh3gl3 Mouse bisphenol A multiple interactions ISO Sh3gl3 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SH3GL3 mRNA CTD PMID:36041667 Sh3gl3 Mouse bisphenol A decreases methylation ISO SH3GL3 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of SH3GL3 gene CTD PMID:31601247 Sh3gl3 Mouse bisphenol A increases methylation ISO Sh3gl3 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of SH3GL3 gene CTD PMID:28505145 Sh3gl3 Mouse bisphenol F multiple interactions ISO Sh3gl3 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SH3GL3 mRNA CTD PMID:36041667 Sh3gl3 Mouse butanal increases expression ISO SH3GL3 (Homo sapiens) 6480464 butyraldehyde results in increased expression of SH3GL3 mRNA CTD PMID:26079696 Sh3gl3 Mouse Butylbenzyl phthalate multiple interactions ISO Sh3gl3 (Rattus norvegicus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of SH3GL3 mRNA CTD PMID:31199487 Sh3gl3 Mouse C60 fullerene decreases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 fullerene C60 results in decreased expression of SH3GL3 mRNA CTD PMID:19167457 Sh3gl3 Mouse cadmium atom decreases expression ISO SH3GL3 (Homo sapiens) 6480464 Cadmium results in decreased expression of SH3GL3 mRNA CTD PMID:24376830 Sh3gl3 Mouse cadmium dichloride decreases expression ISO SH3GL3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SH3GL3 mRNA CTD PMID:38382870 Sh3gl3 Mouse calcitriol increases expression ISO SH3GL3 (Homo sapiens) 6480464 Calcitriol results in increased expression of SH3GL3 mRNA CTD PMID:16002434 Sh3gl3 Mouse clofibrate multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of SH3GL3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of SH3GL3 mRNA] CTD PMID:17585979 Sh3gl3 Mouse clomipramine affects expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Clomipramine affects the expression of SH3GL3 mRNA CTD PMID:18355885 Sh3gl3 Mouse dibenz[a,h]anthracene increases expression EXP 6480464 1 more ... CTD PMID:26377693 Sh3gl3 Mouse dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SH3GL3 mRNA CTD PMID:21266533 Sh3gl3 Mouse dibutyl phthalate multiple interactions ISO Sh3gl3 (Rattus norvegicus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of SH3GL3 mRNA CTD PMID:31199487 Sh3gl3 Mouse dibutyl phthalate decreases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of SH3GL3 mRNA CTD PMID:21266533 Sh3gl3 Mouse diethyl phthalate multiple interactions ISO Sh3gl3 (Rattus norvegicus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of SH3GL3 mRNA CTD PMID:31199487 Sh3gl3 Mouse diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of SH3GL3 mRNA CTD PMID:16636312 Sh3gl3 Mouse diisobutyl phthalate multiple interactions ISO Sh3gl3 (Rattus norvegicus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of SH3GL3 mRNA CTD PMID:31199487 Sh3gl3 Mouse diisononyl phthalate multiple interactions ISO Sh3gl3 (Rattus norvegicus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of SH3GL3 mRNA CTD PMID:31199487 Sh3gl3 Mouse dorsomorphin multiple interactions ISO SH3GL3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SH3GL3 mRNA CTD PMID:27188386 Sh3gl3 Mouse endosulfan affects expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Endosulfan affects the expression of SH3GL3 mRNA CTD PMID:29391264 Sh3gl3 Mouse entinostat increases expression ISO SH3GL3 (Homo sapiens) 6480464 entinostat results in increased expression of SH3GL3 mRNA CTD PMID:27188386 Sh3gl3 Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of SH3GL3 mRNA CTD PMID:30319688 Sh3gl3 Mouse flutamide increases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Flutamide results in increased expression of SH3GL3 mRNA CTD PMID:24793618 Sh3gl3 Mouse folic acid multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of SH3GL3 mRNA] CTD PMID:22206623 Sh3gl3 Mouse formaldehyde increases expression ISO SH3GL3 (Homo sapiens) 6480464 Formaldehyde results in increased expression of SH3GL3 mRNA CTD PMID:23649840 Sh3gl3 Mouse glyphosate affects methylation ISO Sh3gl3 (Rattus norvegicus) 6480464 Glyphosate affects the methylation of SH3GL3 gene CTD PMID:35440735 Sh3gl3 Mouse imipramine affects expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Imipramine affects the expression of SH3GL3 mRNA CTD PMID:18355885 Sh3gl3 Mouse ketoconazole affects expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Ketoconazole affects the expression of SH3GL3 mRNA CTD PMID:18355885 Sh3gl3 Mouse lead(0) affects expression ISO SH3GL3 (Homo sapiens) 6480464 Lead affects the expression of SH3GL3 mRNA CTD PMID:28903495 Sh3gl3 Mouse methimazole increases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Methimazole results in increased expression of SH3GL3 mRNA CTD PMID:30047161 Sh3gl3 Mouse methoxychlor affects methylation ISO Sh3gl3 (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of SH3GL3 gene CTD PMID:35440735 Sh3gl3 Mouse N,N-diethyl-m-toluamide multiple interactions ISO Sh3gl3 (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of SH3GL3 gene CTD PMID:33148267 Sh3gl3 Mouse paracetamol multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of SH3GL3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of SH3GL3 mRNA] CTD PMID:17585979 Sh3gl3 Mouse paracetamol increases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of SH3GL3 mRNA CTD PMID:33387578 Sh3gl3 Mouse perfluorooctanoic acid decreases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 perfluorooctanoic acid results in decreased expression of SH3GL3 mRNA CTD PMID:19162173 Sh3gl3 Mouse permethrin multiple interactions ISO Sh3gl3 (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of SH3GL3 gene CTD PMID:33148267 Sh3gl3 Mouse phenobarbital decreases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Phenobarbital results in decreased expression of SH3GL3 mRNA CTD PMID:19162173 Sh3gl3 Mouse SB 431542 multiple interactions ISO SH3GL3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SH3GL3 mRNA CTD PMID:27188386 Sh3gl3 Mouse sodium arsenate multiple interactions ISO SH3GL3 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of SH3GL3 mRNA CTD PMID:32525701 Sh3gl3 Mouse sulfadimethoxine increases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of SH3GL3 mRNA CTD PMID:30047161 Sh3gl3 Mouse sunitinib decreases expression ISO SH3GL3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of SH3GL3 mRNA CTD PMID:31533062 Sh3gl3 Mouse temozolomide increases expression ISO SH3GL3 (Homo sapiens) 6480464 Temozolomide results in increased expression of SH3GL3 mRNA CTD PMID:31758290 Sh3gl3 Mouse tetrachloromethane decreases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of SH3GL3 mRNA CTD PMID:31150632 Sh3gl3 Mouse tetrachloromethane multiple interactions ISO Sh3gl3 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SH3GL3 mRNA] CTD PMID:31150632 Sh3gl3 Mouse thioacetamide decreases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of SH3GL3 mRNA CTD PMID:23411599 Sh3gl3 Mouse trichostatin A increases expression ISO SH3GL3 (Homo sapiens) 6480464 trichostatin A results in increased expression of SH3GL3 mRNA CTD PMID:24935251 Sh3gl3 Mouse trimellitic anhydride decreases expression EXP 6480464 trimellitic anhydride results in decreased expression of SH3GL3 mRNA CTD PMID:19042947 Sh3gl3 Mouse valproic acid affects expression ISO SH3GL3 (Homo sapiens) 6480464 Valproic Acid affects the expression of SH3GL3 mRNA CTD PMID:25979313 Sh3gl3 Mouse valproic acid multiple interactions ISO SH3GL3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SH3GL3 mRNA CTD PMID:27188386 Sh3gl3 Mouse valproic acid increases expression ISO SH3GL3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SH3GL3 mRNA CTD PMID:23179753 more ... Sh3gl3 Mouse vinclozolin decreases expression ISO Sh3gl3 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of SH3GL3 mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
(+)-schisandrin B (ISO) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,6-dinitrotoluene (ISO) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (EXP) 6-propyl-2-thiouracil (ISO) acetamide (ISO) all-trans-retinoic acid (ISO) amiodarone (ISO) amitriptyline (ISO) amitrole (ISO) ammonium chloride (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (EXP,ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (ISO) bisphenol F (ISO) butanal (ISO) Butylbenzyl phthalate (ISO) C60 fullerene (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) clofibrate (EXP) clomipramine (ISO) dibenz[a,h]anthracene (EXP) dibutyl phthalate (EXP,ISO) diethyl phthalate (ISO) diethylstilbestrol (EXP) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dorsomorphin (ISO) endosulfan (ISO) entinostat (ISO) ethanol (EXP) flutamide (ISO) folic acid (EXP) formaldehyde (ISO) glyphosate (ISO) imipramine (ISO) ketoconazole (ISO) lead(0) (ISO) methimazole (ISO) methoxychlor (ISO) N,N-diethyl-m-toluamide (ISO) paracetamol (EXP,ISO) perfluorooctanoic acid (ISO) permethrin (ISO) phenobarbital (ISO) SB 431542 (ISO) sodium arsenate (ISO) sulfadimethoxine (ISO) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (ISO) thioacetamide (ISO) trichostatin A (ISO) trimellitic anhydride (EXP) valproic acid (ISO) vinclozolin (ISO)
Sh3gl3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 81,824,581 - 81,956,618 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 81,823,588 - 81,956,627 (+) Ensembl GRCm39 Ensembl GRCm38 7 82,173,808 - 82,307,420 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 82,173,840 - 82,307,419 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 89,408,638 - 89,455,929 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 82,136,564 - 82,183,595 (+) NCBI MGSCv36 mm8 Celera 7 79,583,452 - 79,715,386 (+) NCBI Celera Cytogenetic Map 7 D3 NCBI cM Map 7 47.15 NCBI
SH3GL3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 83,447,341 - 83,633,820 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 83,447,228 - 83,618,743 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 84,116,093 - 84,287,495 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 81,907,287 - 82,078,495 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 81,907,286 - 82,078,495 NCBI Celera 15 60,298,989 - 60,470,347 (-) NCBI Celera Cytogenetic Map 15 q25.2 NCBI HuRef 15 60,379,941 - 60,551,319 (+) NCBI HuRef CHM1_1 15 83,857,704 - 84,029,128 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 81,315,250 - 81,486,674 (+) NCBI T2T-CHM13v2.0
Sh3gl3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 145,533,728 - 145,664,881 (+) NCBI GRCr8 mRatBN7.2 1 136,124,500 - 136,255,669 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 136,124,499 - 136,255,584 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 144,040,009 - 144,171,713 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 151,209,246 - 151,340,967 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 144,123,239 - 144,253,823 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 144,069,641 - 144,200,402 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 144,069,638 - 144,200,397 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 145,001,327 - 145,131,961 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 138,398,336 - 138,529,056 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 138,476,741 - 138,607,462 (+) NCBI Celera 1 128,174,057 - 128,303,475 (+) NCBI Celera Cytogenetic Map 1 q31 NCBI
Sh3gl3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 13,150,021 - 13,297,878 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 13,151,288 - 13,297,878 (-) NCBI ChiLan1.0 ChiLan1.0
SH3GL3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 72,275,820 - 72,440,698 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 76,435,092 - 76,599,937 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 61,988,584 - 62,153,543 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 81,337,223 - 81,502,229 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 81,337,529 - 81,501,770 (+) Ensembl panpan1.1 panPan2
SH3GL3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 55,287,460 - 55,340,736 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 55,287,460 - 55,340,571 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 57,849,401 - 57,991,318 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 55,633,727 - 55,769,378 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 55,633,124 - 56,121,658 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 55,141,227 - 55,277,053 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 55,351,137 - 55,486,712 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 55,688,264 - 55,825,678 (+) NCBI UU_Cfam_GSD_1.0
Sh3gl3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 128,158,006 - 128,283,492 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936483 18,050,899 - 18,176,519 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936483 18,051,023 - 18,176,514 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SH3GL3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 51,381,097 - 51,514,225 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 51,381,091 - 51,514,253 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 56,871,306 - 57,006,768 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SH3GL3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 2,009,833 - 2,177,843 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 2,009,776 - 2,177,747 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 44,935,678 - 45,104,239 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sh3gl3
.
Predicted Target Of
Count of predictions: 1780 Count of miRNA genes: 578 Interacting mature miRNAs: 724 Transcripts: ENSMUST00000032874, ENSMUST00000177883, ENSMUST00000177895, ENSMUST00000178526, ENSMUST00000179150, ENSMUST00000179318, ENSMUST00000179800, ENSMUST00000180183, ENSMUST00000180243 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
25314307 Mlh1fc2_m MLH1 foci count 2 (mouse) 7 6502999 133501729 Mouse 27226781 Tibl3_m tibia length 3, 5 week (mouse) 7 74849748 122199223 Mouse 25314305 Vmm6_m variable multisystem mineralization 6, eye (mouse) 7 61849748 102749207 Mouse 27226778 Femd11_m femur midshaft diameter 11, 16 week (mouse) 7 56949748 134001729 Mouse 26884381 Bzwq2_m bi-zygomatic width QTL 2, 5 week (mouse) 7 65249748 96949207 Mouse 1301784 Ses2_m salmonella enteritidis susceptibility 2 (mouse) Not determined 7 67290094 101290240 Mouse 1301663 Skull9_m skull morphology 9 (mouse) Not determined 7 57326121 91326352 Mouse 14746989 Manh62_m mandible shape 62 (mouse) 7 75742528 109742528 Mouse 10043926 Bw1n_m body weight 1 in NSY (mouse) Not determined 7 45161966 118693530 Mouse 27226765 Tibl18_m tibia length 18, 16 week (mouse) 7 81849748 126499172 Mouse 1301383 Aem2_m anti-erythrocyte autoantibody modifier 2 (mouse) Not determined 7 64135424 98135653 Mouse 1301514 Rigs1_m radiation induced gastroschisis 1 (mouse) Not determined 7 36280015 92394346 Mouse 4142500 Morq1_m modifier of Rs1 QTL 1 (mouse) Not determined 80551681 114551791 Mouse 27095937 Ulnl7_m ulna length 7, 10 week (mouse) 7 66449748 98349207 Mouse 11565101 Tsve1_m variable short tail (Tsv) enhancer 1 (mouse) 7 55889508 87142720 Mouse 1300620 Pgia21_m proteoglycan induced arthritis 21 (mouse) Not determined 7 67290094 101290240 Mouse 13208555 Lgth10_m body length 10 (mouse) 7 51649748 125599172 Mouse 26884408 Bzwq13_m bi-zygomatic width QTL 13, 16 week (mouse) 7 61749748 121399223 Mouse 1300791 Abbp3_m A/J and C57BL/6 blood pressure 3 (mouse) Not determined 7 39673887 103510010 Mouse 10054064 Bwq11_m body weight QTL 11 (mouse) Not determined 7 51124954 85125093 Mouse 1357752 Tabw_m tally ho asscoiated body weight (mouse) Not determined 7 49193278 83193390 Mouse 10053685 Eae43_m experimental allergic encephalomyelitis susceptibility 43 (mouse) Not determined 7 51124954 85125093 Mouse 1301566 Adip3_m adiposity 3 (mouse) Not determined 7 75394215 109394346 Mouse 26884404 Huml1_m humerus length 1, 5 week (mouse) 7 30199425 108999207 Mouse 1301155 Bpq7_m blood pressure QTL 7 (mouse) Not determined 7 70143137 104143379 Mouse 26884398 Humsd6_m humerus midshaft diameter 6, 16 week (mouse) 7 78649748 136901729 Mouse 1301158 Eae4_m susceptibility to experimental allergic encephalomyelitis 4 (mouse) Not determined 7 19147398 141919804 Mouse 10412199 Sst2_m susceptibility to tuberculosis 2 (mouse) Not determined 7 18728794 119485380 Mouse 4142212 Png1_m Postnatal growth 1 (mouse) Not determined 74326121 92394346 Mouse 1300654 Bomd1_m bone mineral density 1 (mouse) Not determined 7 68365595 102365702 Mouse 26884440 Sklq4_m skull length QTL 4, 5 week (mouse) 7 65249748 126499172 Mouse 27095903 Scvln10_m sacral vertebrae length 2, 10 week (mouse) 7 81449748 126499172 Mouse 27226715 Metcl3_m metatarsal-calcaneal length 3, 5 week (mouse) 7 67849748 119499223 Mouse 26884444 Sklq8_m skull length QTL 8, 10 week (mouse) 7 67849748 124199223 Mouse 25823170 Hrsq7_m host response to SARS QTL 7, log titer (mouse) 7 54819589 116822815 Mouse 1301082 Bbaa16_m B.burgdorferi-associated arthritis 16 (mouse) Not determined 7 36280015 116416877 Mouse 1301465 Egrm3_m early growth rate (mouse) Not determined 7 57326121 91326352 Mouse 1300952 Hcs1_m hepatocarcinogenesis susceptibility 1 (mouse) Not determined 7 57326121 91326352 Mouse 4142319 Powg_m post-ovarectomy weight gain (mouse) Not determined 72857105 92582163 Mouse 10412110 Cctq1_m central corneal thickness QTL 1 (mouse) Not determined 7 80551681 114551791 Mouse 12792978 Fbmd3_m femoral bone mineral density 3, females only (mouse) 7 7050288 142367832 Mouse 1301826 Pgia3_m proteoglycan induced arthritis 3 (mouse) Not determined 7 67290094 101290240 Mouse 26884418 Bzwq7_m bi-zygomatic width QTL 7, 10 week (mouse) 7 67849748 105449207 Mouse 10043973 Obq29_m obesity QTL 29 (mouse) Not determined 7 72263372 106263372 Mouse 27226751 Femd5_m femur midshaft diameter 5, 10 week (mouse) 7 53249748 143153737 Mouse 27095933 Ulnl3_m ulna length 3, 5 week (mouse) 7 73149748 143153737 Mouse 1300722 Sle3_m systemic lupus erythmatosus susceptibility 3 (mouse) Not determined 7 3511728 87142720 Mouse 12880418 V125Dq6_m vitamin D active form serum level QTL 6 (mouse) 7 52149748 86149748 Mouse 27226745 Metcl9_m metatarsal-calcaneal length 9, 10 week (mouse) 7 74849748 122199223 Mouse 27095930 Ulnl10_m ulna length 10, 16 week (mouse) 7 80849748 126699172 Mouse 11532741 Tbrs5_m tuberculosis resistance 5 (mouse) 7 49159227 83235415 Mouse 1302141 Fcsa6_m femoral cross-sectional area 6 (mouse) Not determined 7 48384461 82384607 Mouse 27095923 Pglq3_m pelvic girdle length QTL 3, 5 week (mouse) 7 81249748 124199223 Mouse 27095916 Scvln15_m sacral vertebrae length 2, 16 week (mouse) 7 61749748 123699223 Mouse 12801463 Rta1_m retinal aging 1 (mouse) 7 67168027 89089989 Mouse 11553865 Stmm1c_m skin tumor modifier of MSM 1c (mouse) 7 65788986 99788986 Mouse 26884451 Sklq14_m skull length QTL 14, 16 week (mouse) 7 67849748 124999172 Mouse 11553866 Stmm1d_m skin tumor modifier of MSM 1d (mouse) 7 65788986 99788986 Mouse 27095910 Pglq13_m pelvic girdle length QTL 13, 16 week (mouse) 7 73049748 125699172 Mouse 25314303 Vmm4_m variable multisystem mineralization 4, kidney (mouse) 7 37299425 87049208 Mouse 11553869 Stmm2b_m skin tumor modifier of MSM 2a (mouse) 7 73725965 107725965 Mouse 27095907 Scvln4_m sacral vertebrae length 2, 5 week (mouse) 7 69949748 120499223 Mouse
U58887
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 7 82,307,272 - 82,307,392 UniSTS GRCm38 MGSCv37 7 89,455,782 - 89,455,902 UniSTS GRCm37 Celera 7 79,715,239 - 79,715,359 UniSTS Cytogenetic Map 7 D2-3 UniSTS Whitehead/MRC_RH 7 904.38 UniSTS
Sh3d2c2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 7 82,307,060 - 82,307,393 UniSTS GRCm38 MGSCv37 7 89,455,570 - 89,455,903 UniSTS GRCm37 Celera 7 79,715,027 - 79,715,360 UniSTS Cytogenetic Map 7 D2-3 UniSTS cM Map 7 41.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000032874 ⟹ ENSMUSP00000032874
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 81,824,544 - 81,956,627 (+) Ensembl GRCm38.p6 Ensembl 7 82,174,796 - 82,307,419 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000177883 ⟹ ENSMUSP00000137207
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 81,824,604 - 81,956,627 (+) Ensembl GRCm38.p6 Ensembl 7 82,174,856 - 82,307,419 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000177895 ⟹ ENSMUSP00000137570
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 81,824,698 - 81,956,627 (+) Ensembl GRCm38.p6 Ensembl 7 82,174,950 - 82,307,419 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000178526 ⟹ ENSMUSP00000137482
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 81,920,094 - 81,956,436 (+) Ensembl GRCm38.p6 Ensembl 7 82,270,886 - 82,307,228 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000179150
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 81,824,982 - 81,826,040 (+) Ensembl GRCm38.p6 Ensembl 7 82,175,234 - 82,176,292 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000179318 ⟹ ENSMUSP00000137621
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 81,823,588 - 81,956,295 (+) Ensembl GRCm38.p6 Ensembl 7 82,173,840 - 82,307,087 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000179800
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 81,824,590 - 81,919,246 (+) Ensembl GRCm38.p6 Ensembl 7 82,174,842 - 82,270,038 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000180183
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 81,823,943 - 81,933,303 (+) Ensembl GRCm38.p6 Ensembl 7 82,174,195 - 82,284,095 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000180243
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 81,824,904 - 81,933,366 (+) Ensembl GRCm38.p6 Ensembl 7 82,175,156 - 82,284,158 (+) Ensembl
RefSeq Acc Id:
NM_001277954 ⟹ NP_001264883
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 81,824,589 - 81,956,618 (+) NCBI GRCm38 7 82,174,796 - 82,307,420 (+) NCBI Celera 7 79,667,037 - 79,715,387 (+) NCBI
Sequence:
GGGGCCTCGAAACACGGTGTTGCTATCTGCGCGAGCGCCTGTGCCAGTGTGACAGCGCCGTGGCCGTGGCCGTGGCCGTGGGGCGCGCGGGGACCGCCCGGGGTGCCCGCTCCGCTCAGCGTCCGGGC
hide sequence
RefSeq Acc Id:
NM_001277955 ⟹ NP_001264884
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 81,824,589 - 81,956,618 (+) NCBI GRCm38 7 82,174,796 - 82,307,420 (+) NCBI Celera 7 79,667,037 - 79,715,387 (+) NCBI
Sequence:
GGGGCCTCGAAACACGGTGTTGCTATCTGCGCGAGCGCCTGTGCCAGTGTGACAGCGCCGTGGCCGTGGCCGTGGCCGTGGGGCGCGCGGGGACCGCCCGGGGTGCCCGCTCCGCTCAGCGTCCGGGC
hide sequence
RefSeq Acc Id:
NM_001417256 ⟹ NP_001404185
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 81,824,942 - 81,956,618 (+) NCBI
RefSeq Acc Id:
NM_001417257 ⟹ NP_001404186
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 81,824,589 - 81,956,618 (+) NCBI
RefSeq Acc Id:
NM_001417258 ⟹ NP_001404187
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 81,824,589 - 81,956,618 (+) NCBI
RefSeq Acc Id:
NM_001417259 ⟹ NP_001404188
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 81,824,589 - 81,956,618 (+) NCBI
RefSeq Acc Id:
NM_001417260 ⟹ NP_001404189
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 81,824,589 - 81,956,618 (+) NCBI
RefSeq Acc Id:
NM_017400 ⟹ NP_059096
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 81,824,589 - 81,956,618 (+) NCBI GRCm38 7 82,174,796 - 82,307,420 (+) NCBI MGSCv37 7 89,408,638 - 89,455,929 (+) RGD Celera 7 79,667,037 - 79,715,387 (+) NCBI cM Map 7 ENTREZGENE
Sequence:
GGGGCCTCGAAACACGGTGTTGCTATCTGCGCGAGCGCCTGTGCCAGTGTGACAGCGCCGTGGC
hide sequence
RefSeq Acc Id:
XM_030242263 ⟹ XP_030098123
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 81,824,958 - 81,956,618 (+) NCBI GRCm38 7 82,175,210 - 82,307,410 (+) NCBI
Sequence:
GCTGCGCCCTGGCGGTTGTAAATCTGAGCAGTTCGGCTGGCAAGGGATCGGAGGTGGTGGGCTT
hide sequence
RefSeq Acc Id:
XM_030242266 ⟹ XP_030098126
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 81,824,581 - 81,956,618 (+) NCBI GRCm38 7 82,174,822 - 82,307,410 (+) NCBI
Sequence:
CCTGTGCCAGTGTGACAGCGCCGTGGCCGTGGCCGTGGCCGTGGGGCGCGCGGGGACCGCCCGG
hide sequence
RefSeq Acc Id:
XM_036152823 ⟹ XP_036008716
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 81,824,983 - 81,956,618 (+) NCBI
Sequence:
GAGCAGTTCGGCTGGCAAGGGATCGGAGGTGGTGGGCTTGGGGATGTGCGCCCGGAGGAGAGCT
hide sequence
RefSeq Acc Id:
XM_036152824 ⟹ XP_036008717
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 81,824,581 - 81,956,618 (+) NCBI
Sequence:
CCTGTGCCAGTGTGACAGCGCCGTGGCCGTGGCCGTGGCCGTGGGGCGCGCGGGGACCGCCCGG
hide sequence
RefSeq Acc Id:
XM_036152825 ⟹ XP_036008718
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 81,825,787 - 81,956,618 (+) NCBI
Sequence:
AAGACACTGCTAGTCCCTAAGTCACAGCTGGTCCACAAGGAAGCTAAGTGATGGCTGTTCTCAGCAGGGGACATAGGGCAGACAGTGATGCTATTCAGGATGTTAGAAATCCTGGAGGAGAAATCCTG
hide sequence
RefSeq Acc Id:
NP_059096 ⟸ NM_017400
- Peptide Label:
isoform 1
- UniProtKB:
Q8R0B7 (UniProtKB/Swiss-Prot), Q62421 (UniProtKB/Swiss-Prot), A0A0R4J0B8 (UniProtKB/TrEMBL)
- Sequence:
MSVAGLKKQFHKASQLFSEKISGAEGTKLDEEFLNMEKKIDITSKAVAEILSKATEYLQPNPAYRAKLGMLNTVSKLRGQVKATGYPQTEGLLGDCMLKYGKELGEDSAFGNSLVDVGEALKLMAEVK
hide sequence
RefSeq Acc Id:
NP_001264883 ⟸ NM_001277954
- Peptide Label:
isoform 2
- UniProtKB:
Q497N4 (UniProtKB/TrEMBL), J3QQ44 (UniProtKB/TrEMBL)
- Sequence:
MLNTVSKLRGQVKATGYPQTEGLLGDCMLKYGKELGEDSAFGNSLVDVGEALKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEKFEESKELA
hide sequence
RefSeq Acc Id:
NP_001264884 ⟸ NM_001277955
- Peptide Label:
isoform 3
- UniProtKB:
Q9CZV7 (UniProtKB/TrEMBL)
- Sequence:
MLNTVSKLRGQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEKFEESKELA
hide sequence
RefSeq Acc Id:
XP_030098126 ⟸ XM_030242266
- Peptide Label:
isoform X4
- UniProtKB:
Q497N4 (UniProtKB/TrEMBL), J3QQ44 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_030098123 ⟸ XM_030242263
- Peptide Label:
isoform X2
- UniProtKB:
Q8R0B7 (UniProtKB/Swiss-Prot), Q62421 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSMUSP00000032874 ⟸ ENSMUST00000032874
Ensembl Acc Id:
ENSMUSP00000137482 ⟸ ENSMUST00000178526
Ensembl Acc Id:
ENSMUSP00000137570 ⟸ ENSMUST00000177895
Ensembl Acc Id:
ENSMUSP00000137207 ⟸ ENSMUST00000177883
Ensembl Acc Id:
ENSMUSP00000137621 ⟸ ENSMUST00000179318
RefSeq Acc Id:
XP_036008717 ⟸ XM_036152824
- Peptide Label:
isoform X4
- UniProtKB:
Q497N4 (UniProtKB/TrEMBL), J3QQ44 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036008716 ⟸ XM_036152823
- Peptide Label:
isoform X4
- UniProtKB:
Q497N4 (UniProtKB/TrEMBL), J3QQ44 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036008718 ⟸ XM_036152825
- Peptide Label:
isoform X4
- UniProtKB:
Q497N4 (UniProtKB/TrEMBL), J3QQ44 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001404189 ⟸ NM_001417260
- Peptide Label:
isoform 6
RefSeq Acc Id:
NP_001404188 ⟸ NM_001417259
- Peptide Label:
isoform 2
- UniProtKB:
Q497N4 (UniProtKB/TrEMBL), J3QQ44 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001404186 ⟸ NM_001417257
- Peptide Label:
isoform 5
- UniProtKB:
J3QQ44 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001404187 ⟸ NM_001417258
- Peptide Label:
isoform 2
- UniProtKB:
Q497N4 (UniProtKB/TrEMBL), J3QQ44 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001404185 ⟸ NM_001417256
- Peptide Label:
isoform 4
- UniProtKB:
Q8R0B7 (UniProtKB/Swiss-Prot), Q62421 (UniProtKB/Swiss-Prot)
RGD ID: 8664647 Promoter ID: EPDNEW_M10355 Type: single initiation site Name: Sh3gl3_1 Description: Mus musculus SH3-domain GRB2-like 3 , transcript variant 3, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 7 82,269,718 - 82,269,778 EPDNEW
RGD ID: 6842011 Promoter ID: MM_KWN:51365 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: ES_Cell Transcripts: UC009ICY.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 7 89,408,346 - 89,408,846 (+) MPROMDB
