Symbol:
Hamp
Name:
hepcidin antimicrobial peptide
RGD ID:
1550218
MGI Page
MGI
Description:
Enables copper ion binding activity. Involved in intracellular iron ion homeostasis and negative regulation of transcription by RNA polymerase II. Acts upstream of or within several processes, including defense response to other organism; multicellular organismal-level iron ion homeostasis; and positive regulation of macromolecule metabolic process. Located in extracellular space and nucleus. Is expressed in embryo; liver; and yolk sac. Used to study hemochromatosis type 2B. Human ortholog(s) of this gene implicated in anemia; hemochromatosis; hemochromatosis type 2B; and hepatocellular carcinoma. Orthologous to human HAMP (hepcidin antimicrobial peptide).
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
Hamp1; Hep; Hepc; Hepc1; hepcidin; hepcidin antimicrobial peptide 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 30,641,793 - 30,643,454 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 30,641,793 - 30,643,457 (-) Ensembl GRCm39 Ensembl GRCm38 7 30,942,368 - 30,944,029 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 30,942,368 - 30,944,032 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 31,727,387 - 31,729,036 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 30,651,128 - 30,652,777 (-) NCBI MGSCv36 mm8 Celera 7 25,508,433 - 25,510,082 (-) NCBI Celera Cytogenetic Map 7 B1 NCBI cM Map 7 19.27 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hamp Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of HAMP mRNA CTD PMID:36331819 Hamp Mouse 1,10-phenanthroline decreases expression ISO HAMP (Homo sapiens) 6480464 1 and 10-phenanthroline results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse 10-(beta-Dimethylaminopropionyl)phenothiazine decreases expression ISO HAMP (Homo sapiens) 6480464 10-(alpha-diethylaminopropionyl)phenothiazine results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse 17beta-estradiol multiple interactions ISO HAMP (Homo sapiens) 6480464 Tamoxifen inhibits the reaction [Estradiol results in decreased expression of HAMP mRNA] CTD PMID:25686467 Hamp Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of HAMP mRNA CTD PMID:39298647 Hamp Mouse 17beta-estradiol decreases expression ISO Hamp (Rattus norvegicus) 6480464 Estradiol results in decreased expression of HAMP mRNA CTD PMID:32145629 Hamp Mouse 17beta-estradiol decreases expression ISO HAMP (Homo sapiens) 6480464 Estradiol results in decreased expression of HAMP mRNA CTD PMID:20106945 and PMID:25686467 Hamp Mouse 2,2',4,4',5,5'-hexachlorobiphenyl decreases expression ISO HAMP (Homo sapiens) 6480464 2 more ... CTD PMID:25686467 Hamp Mouse 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO HAMP (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Hamp Mouse 2,2'-bipyridine decreases expression ISO HAMP (Homo sapiens) 6480464 2 and 2'-Dipyridyl results in decreased expression of HAMP mRNA CTD PMID:19924283 Hamp Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to HAMP promoter] CTD PMID:19654925 Hamp Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Hamp (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of HAMP mRNA CTD PMID:32109520 Hamp Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HAMP mRNA CTD PMID:28213091 Hamp Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of HAMP mRNA CTD PMID:26377647 Hamp Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO HAMP (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of HAMP mRNA CTD PMID:20106945 more ... Hamp Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:28213091 Hamp Mouse 2,4-D multiple interactions EXP 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Hamp Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Hamp Mouse 2,6-dinitrotoluene affects expression ISO Hamp (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of HAMP mRNA CTD PMID:21346803 Hamp Mouse 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile multiple interactions EXP 6480464 Verapamil promotes the reaction [Iron-Dextran Complex results in increased expression of HAMP mRNA] CTD PMID:27095094 Hamp Mouse 2-acetamidofluorene multiple interactions ISO Hamp (Rattus norvegicus) 6480464 2-Acetylaminofluorene inhibits the reaction [CEBPB protein binds to HAMP promoter] CTD PMID:21785164 Hamp Mouse 2-acetamidofluorene decreases expression ISO Hamp (Rattus norvegicus) 6480464 2-Acetylaminofluorene results in decreased expression of HAMP mRNA CTD PMID:21785164 Hamp Mouse 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:25686467 Hamp Mouse 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [3 more ... CTD PMID:30744511 Hamp Mouse 3,3',4,4',5-pentachlorobiphenyl decreases response to substance EXP 6480464 HAMP protein results in decreased susceptibility to 3 more ... CTD PMID:25686467 Hamp Mouse 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO HAMP (Homo sapiens) 6480464 3 more ... CTD PMID:25686467 Hamp Mouse 3,4,5,3',4',5'-Hexachlorobiphenyl multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [3 more ... CTD PMID:30744511 Hamp Mouse 3,7-dihydropurine-6-thione increases expression ISO Hamp (Rattus norvegicus) 6480464 Mercaptopurine results in increased expression of HAMP mRNA CTD PMID:23358152 Hamp Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of HAMP mRNA CTD PMID:39298647 Hamp Mouse 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole multiple interactions ISO HAMP (Homo sapiens) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Omeprazole results in increased expression of HAMP mRNA] and AHR protein affects the reaction [Omeprazole results in increased expression of HAMP mRNA] CTD PMID:31669099 Hamp Mouse 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole increases expression EXP 6480464 Omeprazole results in increased expression of HAMP mRNA and Omeprazole results in increased expression of HAMP protein CTD PMID:31669099 Hamp Mouse 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole increases expression ISO HAMP (Homo sapiens) 6480464 Omeprazole results in increased expression of HAMP mRNA CTD PMID:31669099 Hamp Mouse 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole increases secretion ISO HAMP (Homo sapiens) 6480464 Omeprazole results in increased secretion of HAMP protein CTD PMID:31669099 Hamp Mouse acetaldehyde decreases expression ISO HAMP (Homo sapiens) 6480464 Acetaldehyde results in decreased expression of HAMP mRNA CTD PMID:16737972 Hamp Mouse acetaldehyde multiple interactions ISO HAMP (Homo sapiens) 6480464 Acetaldehyde inhibits the reaction [Ethanol results in decreased expression of HAMP mRNA] CTD PMID:16737972 Hamp Mouse acrolein increases expression ISO Hamp (Rattus norvegicus) 6480464 Acrolein results in increased expression of HAMP mRNA CTD PMID:38090360 Hamp Mouse acrylamide decreases expression ISO Hamp (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of HAMP mRNA CTD PMID:28959563 Hamp Mouse Actein decreases expression ISO Hamp (Rattus norvegicus) 6480464 actein results in decreased expression of HAMP protein CTD PMID:29969672 Hamp Mouse aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of HAMP mRNA CTD PMID:19770486 Hamp Mouse aflatoxin B1 decreases expression ISO HAMP (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of HAMP mRNA CTD PMID:21632981 more ... Hamp Mouse aflatoxin B1 multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [sulforaphane co-treated with Aflatoxin B1] affects the expression of HAMP mRNA CTD PMID:25450479 Hamp Mouse aldehydo-D-glucose multiple interactions EXP 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Hamp Mouse ammonium chloride affects expression ISO Hamp (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of HAMP mRNA CTD PMID:16483693 Hamp Mouse apomorphine multiple interactions ISO HAMP (Homo sapiens) 6480464 Apomorphine inhibits the reaction [BMP6 protein results in increased expression of HAMP mRNA] more ... CTD PMID:25633564 Hamp Mouse apomorphine decreases secretion ISO HAMP (Homo sapiens) 6480464 Apomorphine results in decreased secretion of HAMP protein modified form CTD PMID:25633564 Hamp Mouse apomorphine decreases expression ISO HAMP (Homo sapiens) 6480464 Apomorphine results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse aristolochic acid A increases expression ISO HAMP (Homo sapiens) 6480464 aristolochic acid I results in increased expression of HAMP mRNA CTD PMID:33212167 Hamp Mouse aurantio-obtusin decreases expression EXP 6480464 aurantio-obtusin results in decreased expression of HAMP mRNA CTD PMID:34718095 Hamp Mouse Benzamil decreases expression ISO HAMP (Homo sapiens) 6480464 benzamil results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse Benzamil multiple interactions ISO HAMP (Homo sapiens) 6480464 benzamil inhibits the reaction [BMP6 protein results in increased expression of HAMP mRNA] CTD PMID:25633564 Hamp Mouse benzo[a]pyrene decreases expression ISO HAMP (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of HAMP mRNA CTD PMID:20106945 Hamp Mouse benzo[a]pyrene affects methylation ISO HAMP (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HAMP exon and Benzo(a)pyrene affects the methylation of HAMP promoter CTD PMID:27901495 Hamp Mouse benzo[a]pyrene increases expression ISO HAMP (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of HAMP mRNA CTD PMID:16269432 Hamp Mouse benzo[a]pyrene multiple interactions ISO HAMP (Homo sapiens) 6480464 [Benzo(a)pyrene co-treated with dibenzo(a and l)pyrene] results in increased expression of HAMP mRNA CTD PMID:17690111 Hamp Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of HAMP mRNA CTD PMID:22228805 Hamp Mouse benzo[a]pyrene diol epoxide I decreases expression ISO HAMP (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Hamp Mouse benzo[b]fluoranthene increases expression ISO HAMP (Homo sapiens) 6480464 benzo(b)fluoranthene results in increased expression of HAMP mRNA CTD PMID:16269432 Hamp Mouse benzo[b]fluoranthene decreases expression EXP 6480464 benzo(b)fluoranthene results in decreased expression of HAMP mRNA CTD PMID:26377693 Hamp Mouse beta-naphthoflavone multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of HAMP mRNA CTD PMID:18164116 Hamp Mouse beta-naphthoflavone decreases expression ISO HAMP (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of HAMP mRNA CTD PMID:32858204 Hamp Mouse bisphenol A increases expression ISO Hamp (Rattus norvegicus) 6480464 bisphenol A results in increased expression of HAMP mRNA CTD PMID:25181051 more ... Hamp Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HAMP mRNA CTD PMID:33221593 Hamp Mouse bisphenol A decreases expression ISO Hamp (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of HAMP mRNA CTD PMID:32145629 Hamp Mouse bisphenol A affects expression ISO Hamp (Rattus norvegicus) 6480464 bisphenol A affects the expression of HAMP mRNA CTD PMID:30903817 Hamp Mouse bisphenol A affects expression ISO HAMP (Homo sapiens) 6480464 bisphenol A affects the expression of HAMP mRNA CTD PMID:30903817 Hamp Mouse bisphenol A increases methylation ISO Hamp (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of HAMP gene CTD PMID:28505145 Hamp Mouse bromobenzene decreases expression ISO Hamp (Rattus norvegicus) 6480464 bromobenzene results in decreased expression of HAMP mRNA CTD PMID:32479839 Hamp Mouse C60 fullerene increases expression ISO Hamp (Rattus norvegicus) 6480464 fullerene C60 results in increased expression of HAMP mRNA CTD PMID:19167457 Hamp Mouse cadmium atom decreases expression EXP 6480464 Cadmium results in decreased expression of HAMP mRNA CTD PMID:23358151 Hamp Mouse cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HAMP mRNA CTD PMID:32645461 Hamp Mouse cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HAMP mRNA CTD PMID:32645461 Hamp Mouse cadmium dichloride increases expression ISO Hamp (Rattus norvegicus) 6480464 [Cadmium Chloride results in increased expression of IL6 mRNA] which results in increased expression of HAMP mRNA and Cadmium Chloride results in increased expression of HAMP mRNA CTD PMID:21540277 and PMID:25993096 Hamp Mouse cadmium dichloride decreases expression ISO Hamp (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of HAMP mRNA CTD PMID:21540277 Hamp Mouse camptothecin decreases expression ISO HAMP (Homo sapiens) 6480464 Camptothecin results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse cantharidin decreases expression ISO HAMP (Homo sapiens) 6480464 Cantharidin analog results in decreased expression of HAMP mRNA and Cantharidin results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse carbofuran increases expression ISO Hamp (Rattus norvegicus) 6480464 Carbofuran results in increased expression of HAMP mRNA CTD PMID:20211217 Hamp Mouse carbon nanotube affects expression EXP 6480464 Nanotubes and Carbon analog affects the expression of HAMP mRNA CTD PMID:25554681 Hamp Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes and Carbon results in decreased expression of HAMP mRNA CTD PMID:25554681 Hamp Mouse CGS 15943 decreases secretion ISO HAMP (Homo sapiens) 6480464 9-chloro-2-(2-furyl)-(1 more ... CTD PMID:25633564 Hamp Mouse CGS 15943 multiple interactions ISO HAMP (Homo sapiens) 6480464 9-chloro-2-(2-furyl)-(1 more ... CTD PMID:25633564 Hamp Mouse CGS 15943 decreases expression ISO HAMP (Homo sapiens) 6480464 9-chloro-2-(2-furyl)-(1 more ... CTD PMID:25633564 Hamp Mouse chlorpyrifos decreases expression ISO HAMP (Homo sapiens) 6480464 Chlorpyrifos results in decreased expression of HAMP mRNA CTD PMID:25176568 Hamp Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of HAMP mRNA CTD PMID:37019170 Hamp Mouse ciglitazone multiple interactions ISO HAMP (Homo sapiens) 6480464 [ciglitazone binds to PPARG protein alternative form] which results in increased expression of HAMP mRNA CTD PMID:16197558 Hamp Mouse ciguatoxin CTX1B affects expression EXP 6480464 Ciguatoxins affects the expression of HAMP mRNA CTD PMID:18353800 Hamp Mouse cisplatin decreases expression ISO Hamp (Rattus norvegicus) 6480464 Cisplatin results in decreased expression of HAMP mRNA CTD PMID:22023808 Hamp Mouse cisplatin increases expression ISO HAMP (Homo sapiens) 6480464 Cisplatin results in increased expression of HAMP mRNA CTD PMID:33545341 Hamp Mouse cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of HAMP mRNA CTD PMID:25270620 Hamp Mouse cobalt dichloride multiple interactions ISO HAMP (Homo sapiens) 6480464 cobaltous chloride inhibits the reaction [BMP6 protein results in increased expression of HAMP mRNA] CTD PMID:25633564 Hamp Mouse cobalt dichloride decreases expression ISO HAMP (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse cobalt dichloride decreases expression ISO Hamp (Rattus norvegicus) 6480464 cobaltous chloride results in decreased expression of HAMP mRNA CTD PMID:21558026 Hamp Mouse colforsin daropate hydrochloride affects expression ISO HAMP (Homo sapiens) 6480464 Colforsin affects the expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse colforsin daropate hydrochloride multiple interactions ISO HAMP (Homo sapiens) 6480464 Colforsin inhibits the reaction [IL6 protein results in increased expression of HAMP mRNA] CTD PMID:25633564 Hamp Mouse copper atom multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [Fructose co-treated with Copper deficiency] results in decreased expression of HAMP protein CTD PMID:25813056 Hamp Mouse copper atom decreases expression EXP 6480464 Copper deficiency results in decreased expression of HAMP mRNA CTD PMID:23555700 Hamp Mouse copper atom decreases expression ISO Hamp (Rattus norvegicus) 6480464 Copper deficiency results in decreased expression of HAMP mRNA CTD PMID:20164366 and PMID:22457245 Hamp Mouse copper atom affects expression EXP 6480464 Copper affects the expression of HAMP mRNA CTD PMID:16614410 Hamp Mouse copper(0) multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [Fructose co-treated with Copper deficiency] results in decreased expression of HAMP protein CTD PMID:25813056 Hamp Mouse copper(0) decreases expression EXP 6480464 Copper deficiency results in decreased expression of HAMP mRNA CTD PMID:23555700 Hamp Mouse copper(0) decreases expression ISO Hamp (Rattus norvegicus) 6480464 Copper deficiency results in decreased expression of HAMP mRNA CTD PMID:20164366 and PMID:22457245 Hamp Mouse copper(0) affects expression EXP 6480464 Copper affects the expression of HAMP mRNA CTD PMID:16614410 Hamp Mouse copper(II) chloride increases expression EXP 6480464 cupric chloride results in increased expression of HAMP mRNA CTD PMID:17211630 Hamp Mouse copper(II) sulfate affects expression ISO HAMP (Homo sapiens) 6480464 Copper Sulfate affects the expression of HAMP mRNA CTD PMID:19549813 Hamp Mouse corn oil affects expression ISO Hamp (Rattus norvegicus) 6480464 Corn Oil affects the expression of HAMP mRNA CTD PMID:16360708 Hamp Mouse curcumin decreases expression EXP 6480464 Curcumin results in decreased expression of HAMP mRNA CTD PMID:24634837 Hamp Mouse cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of HAMP mRNA CTD PMID:32129080 Hamp Mouse cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of HAMP mRNA CTD PMID:19770486 Hamp Mouse cyclosporin A decreases expression ISO HAMP (Homo sapiens) 6480464 Cyclosporine results in decreased expression of HAMP mRNA CTD PMID:27989131 Hamp Mouse cyclosporin A increases expression ISO HAMP (Homo sapiens) 6480464 Cyclosporine results in increased expression of HAMP mRNA CTD PMID:25562108 Hamp Mouse D-glucose multiple interactions EXP 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Hamp Mouse desferrioxamine B affects expression ISO HAMP (Homo sapiens) 6480464 Deferoxamine affects the expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse desferrioxamine B multiple interactions EXP 6480464 Deferoxamine inhibits the reaction [[Iron-Dextran Complex results in increased abundance of Iron] which results in increased expression of HAMP protein] CTD PMID:38971422 Hamp Mouse desferrioxamine B decreases expression ISO Hamp (Rattus norvegicus) 6480464 Deferoxamine results in decreased expression of HAMP protein CTD PMID:21558026 Hamp Mouse desferrioxamine B multiple interactions ISO HAMP (Homo sapiens) 6480464 Deferoxamine inhibits the reaction [BMP6 protein results in increased expression of HAMP mRNA] more ... CTD PMID:25633564 Hamp Mouse dibenz[a,h]anthracene increases expression ISO HAMP (Homo sapiens) 6480464 1 more ... CTD PMID:16269432 Hamp Mouse dibenzo[a,l]pyrene multiple interactions ISO HAMP (Homo sapiens) 6480464 [Benzo(a)pyrene co-treated with dibenzo(a and l)pyrene] results in increased expression of HAMP mRNA CTD PMID:17690111 Hamp Mouse dibenzofurans increases expression EXP 6480464 Dibenzofurans results in increased expression of HAMP mRNA CTD PMID:34254344 Hamp Mouse diclofenac affects expression EXP 6480464 Diclofenac affects the expression of HAMP mRNA CTD PMID:26934552 Hamp Mouse diclofenac decreases secretion EXP 6480464 Diclofenac results in decreased secretion of HAMP protein CTD PMID:24038040 Hamp Mouse dicrotophos increases expression ISO HAMP (Homo sapiens) 6480464 dicrotophos results in increased expression of HAMP mRNA CTD PMID:28302478 Hamp Mouse diethyl maleate increases expression ISO HAMP (Homo sapiens) 6480464 diethyl maleate results in increased expression of HAMP mRNA CTD PMID:33545341 Hamp Mouse diltiazem multiple interactions EXP 6480464 Diltiazem promotes the reaction [Iron-Dextran Complex results in increased expression of HAMP mRNA] CTD PMID:27095094 Hamp Mouse dioxygen affects expression ISO HAMP (Homo sapiens) 6480464 Oxygen deficiency affects the expression of HAMP mRNA CTD PMID:19924283 Hamp Mouse dioxygen multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of HAMP mRNA CTD PMID:33729688 Hamp Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of HAMP mRNA CTD PMID:30529165 Hamp Mouse diquat increases expression ISO Hamp (Rattus norvegicus) 6480464 Diquat results in increased expression of HAMP mRNA CTD PMID:21698372 Hamp Mouse diquat increases expression EXP 6480464 Diquat results in increased expression of HAMP protein CTD PMID:36851058 Hamp Mouse dorsomorphin multiple interactions ISO HAMP (Homo sapiens) 6480464 dorsomorphin inhibits the reaction [BMP6 protein results in increased expression of HAMP mRNA] more ... CTD PMID:25633564 Hamp Mouse dorsomorphin decreases secretion ISO HAMP (Homo sapiens) 6480464 dorsomorphin results in decreased secretion of HAMP protein modified form CTD PMID:25633564 Hamp Mouse dorsomorphin decreases expression ISO HAMP (Homo sapiens) 6480464 dorsomorphin results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse doxorubicin increases expression ISO Hamp (Rattus norvegicus) 6480464 Doxorubicin results in increased expression of HAMP mRNA CTD PMID:20211217 Hamp Mouse doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of HAMP protein CTD PMID:35667395 Hamp Mouse endosulfan decreases expression ISO Hamp (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of HAMP mRNA CTD PMID:29391264 Hamp Mouse ethanol decreases expression ISO HAMP (Homo sapiens) 6480464 Ethanol results in decreased expression of HAMP mRNA and Ethanol results in decreased expression of HAMP protein CTD PMID:16737972 Hamp Mouse ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of HAMP mRNA and Ethanol results in decreased expression of HAMP protein CTD PMID:16737972 more ... Hamp Mouse ethanol multiple interactions EXP 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of HAMP mRNA more ... CTD PMID:16737972 more ... Hamp Mouse ethanol multiple interactions ISO HAMP (Homo sapiens) 6480464 Acetaldehyde inhibits the reaction [Ethanol results in decreased expression of HAMP mRNA] more ... CTD PMID:16737972 and PMID:24746831 Hamp Mouse etoposide decreases expression EXP 6480464 Etoposide results in decreased expression of HAMP mRNA CTD PMID:25270620 Hamp Mouse etoposide decreases expression ISO HAMP (Homo sapiens) 6480464 Etoposide results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse etoposide multiple interactions ISO HAMP (Homo sapiens) 6480464 Etoposide inhibits the reaction [BMP6 protein results in increased expression of HAMP mRNA] CTD PMID:25633564 Hamp Mouse ferric ammonium citrate decreases expression ISO HAMP (Homo sapiens) 6480464 ferric ammonium citrate results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse ferric ammonium citrate multiple interactions ISO HAMP (Homo sapiens) 6480464 Deferoxamine promotes the reaction [ferric ammonium citrate results in decreased expression of HAMP mRNA] more ... CTD PMID:25633564 Hamp Mouse flutamide increases expression ISO Hamp (Rattus norvegicus) 6480464 Flutamide results in increased expression of HAMP mRNA CTD PMID:24793618 Hamp Mouse fomepizole multiple interactions ISO HAMP (Homo sapiens) 6480464 fomepizole inhibits the reaction [Ethanol results in decreased expression of HAMP mRNA] CTD PMID:16737972 Hamp Mouse fructose multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [Fructose co-treated with Copper deficiency] results in decreased expression of HAMP protein CTD PMID:25813056 Hamp Mouse fructose multiple interactions EXP 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Hamp Mouse furan decreases expression ISO Hamp (Rattus norvegicus) 6480464 furan results in decreased expression of HAMP mRNA CTD PMID:25539665 and PMID:26194646 Hamp Mouse gadolinium trichloride increases expression ISO Hamp (Rattus norvegicus) 6480464 gadolinium chloride results in increased expression of HAMP CTD PMID:19721414 Hamp Mouse genistein affects expression EXP 6480464 Genistein affects the expression of HAMP mRNA CTD PMID:24967385 Hamp Mouse glucose multiple interactions EXP 6480464 [lard co-treated with Cholesterol more ... CTD PMID:37567420 Hamp Mouse hemin decreases response to substance EXP 6480464 HAMP mRNA results in decreased susceptibility to Hemin CTD PMID:29749404 Hamp Mouse hemin multiple interactions EXP 6480464 [HAMP mRNA results in decreased susceptibility to Hemin] which results in decreased expression of HIF1A mRNA more ... CTD PMID:29749404 Hamp Mouse hemin increases expression EXP 6480464 Hemin results in increased expression of HAMP mRNA CTD PMID:29749404 Hamp Mouse heparin multiple interactions ISO HAMP (Homo sapiens) 6480464 Heparin inhibits the reaction [BMP6 protein results in increased expression of HAMP mRNA] more ... CTD PMID:25633564 Hamp Mouse heparin decreases expression EXP 6480464 Heparin results in decreased expression of HAMP mRNA CTD PMID:25686467 Hamp Mouse heparin decreases secretion ISO HAMP (Homo sapiens) 6480464 Heparin results in decreased secretion of HAMP protein modified form CTD PMID:25633564 Hamp Mouse heparin decreases expression ISO HAMP (Homo sapiens) 6480464 Heparin results in decreased expression of HAMP mRNA CTD PMID:25633564 and PMID:25686467 Hamp Mouse hexadecanoic acid increases expression ISO HAMP (Homo sapiens) 6480464 Palmitic Acid results in increased expression of HAMP mRNA CTD PMID:17658692 Hamp Mouse hydrogen peroxide affects expression ISO HAMP (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of HAMP mRNA CTD PMID:23410634 Hamp Mouse indole-3-methanol affects expression ISO Hamp (Rattus norvegicus) 6480464 indole-3-carbinol affects the expression of HAMP mRNA CTD PMID:21396975 Hamp Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of HAMP mRNA CTD PMID:36331819 Hamp Mouse iron atom decreases secretion ISO HAMP (Homo sapiens) 6480464 HAMP protein results in decreased secretion of Iron CTD PMID:16460831 Hamp Mouse iron atom increases expression ISO Hamp (Rattus norvegicus) 6480464 Iron results in increased expression of HAMP protein CTD PMID:22659129 Hamp Mouse iron atom increases expression EXP 6480464 Iron results in increased expression of HAMP mRNA CTD PMID:11113132 more ... Hamp Mouse iron atom decreases expression ISO Hamp (Rattus norvegicus) 6480464 Iron deficiency results in decreased expression of HAMP mRNA CTD PMID:21540277 and PMID:22457245 Hamp Mouse iron atom affects expression ISO Hamp (Rattus norvegicus) 6480464 Iron affects the expression of HAMP mRNA CTD PMID:17116712 Hamp Mouse iron atom decreases secretion EXP 6480464 HAMP protein results in decreased secretion of Iron CTD PMID:16648237 Hamp Mouse iron atom multiple interactions EXP 6480464 [Acetaminophen results in decreased expression of HAMP mRNA] which results in increased abundance of Iron more ... CTD PMID:19061943 more ... Hamp Mouse iron atom affects metabolic processing EXP 6480464 HAMP protein affects the metabolism of Iron CTD PMID:16574947 and PMID:17194590 Hamp Mouse iron atom multiple interactions ISO HAMP (Homo sapiens) 6480464 [IL6 protein results in increased expression of HAMP protein] which results in decreased secretion of Iron and Iron affects the reaction [HAMP protein results in increased uptake of SLC40A1 protein] CTD PMID:16460831 and PMID:20655381 Hamp Mouse iron dextran multiple interactions EXP 6480464 [Iron-Dextran Complex results in increased abundance of Iron] which results in increased expression of HAMP mRNA more ... CTD PMID:27095094 more ... Hamp Mouse iron dextran increases expression EXP 6480464 Iron-Dextran Complex results in increased expression of HAMP mRNA CTD PMID:27095094 Hamp Mouse iron trichloride increases expression ISO Hamp (Rattus norvegicus) 6480464 ferric chloride results in increased expression of HAMP mRNA CTD PMID:30506659 Hamp Mouse iron(0) decreases secretion EXP 6480464 HAMP protein results in decreased secretion of Iron CTD PMID:16648237 Hamp Mouse iron(0) affects expression ISO Hamp (Rattus norvegicus) 6480464 Iron affects the expression of HAMP mRNA CTD PMID:17116712 Hamp Mouse iron(0) affects metabolic processing EXP 6480464 HAMP protein affects the metabolism of Iron CTD PMID:16574947 and PMID:17194590 Hamp Mouse iron(0) increases expression EXP 6480464 Iron results in increased expression of HAMP mRNA CTD PMID:11113132 more ... Hamp Mouse iron(0) multiple interactions ISO HAMP (Homo sapiens) 6480464 [IL6 protein results in increased expression of HAMP protein] which results in decreased secretion of Iron and Iron affects the reaction [HAMP protein results in increased uptake of SLC40A1 protein] CTD PMID:16460831 and PMID:20655381 Hamp Mouse iron(0) increases expression ISO Hamp (Rattus norvegicus) 6480464 Iron results in increased expression of HAMP protein CTD PMID:22659129 Hamp Mouse iron(0) decreases secretion ISO HAMP (Homo sapiens) 6480464 HAMP protein results in decreased secretion of Iron CTD PMID:16460831 Hamp Mouse iron(0) decreases expression ISO Hamp (Rattus norvegicus) 6480464 Iron deficiency results in decreased expression of HAMP mRNA CTD PMID:21540277 and PMID:22457245 Hamp Mouse iron(0) multiple interactions EXP 6480464 [Acetaminophen results in decreased expression of HAMP mRNA] which results in increased abundance of Iron more ... CTD PMID:19061943 more ... Hamp Mouse isoprenaline increases expression ISO Hamp (Rattus norvegicus) 6480464 Isoproterenol results in increased expression of HAMP mRNA CTD PMID:20211217 Hamp Mouse isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of HAMP mRNA CTD PMID:21335049 Hamp Mouse kenpaullone decreases expression ISO HAMP (Homo sapiens) 6480464 kenpaullone results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse kenpaullone multiple interactions ISO HAMP (Homo sapiens) 6480464 kenpaullone inhibits the reaction [BMP6 protein results in increased secretion of HAMP protein modified form] and kenpaullone inhibits the reaction [IL6 protein results in increased expression of HAMP mRNA] CTD PMID:25633564 Hamp Mouse kenpaullone decreases secretion ISO HAMP (Homo sapiens) 6480464 kenpaullone results in decreased secretion of HAMP protein modified form CTD PMID:25633564 Hamp Mouse ketoconazole multiple interactions EXP 6480464 Ketoconazole inhibits the reaction [IL6 protein results in increased expression of HAMP mRNA] CTD PMID:17966066 Hamp Mouse ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of HAMP protein CTD PMID:17966066 Hamp Mouse lansoprazole increases expression ISO HAMP (Homo sapiens) 6480464 Lansoprazole results in increased expression of HAMP mRNA CTD PMID:31669099 Hamp Mouse lead diacetate multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of HAMP mRNA CTD PMID:39276841 Hamp Mouse lead nitrate multiple interactions EXP 6480464 [lead nitrate co-treated with EIF2AK1 gene mutant form] results in increased expression of HAMP mRNA CTD PMID:25411909 Hamp Mouse lead(0) multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of HAMP mRNA CTD PMID:39276841 Hamp Mouse leflunomide increases expression ISO HAMP (Homo sapiens) 6480464 leflunomide results in increased expression of HAMP mRNA CTD PMID:28988120 Hamp Mouse Licochalcone B increases expression ISO HAMP (Homo sapiens) 6480464 licochalcone B results in increased expression of HAMP mRNA CTD PMID:33647349 Hamp Mouse lipopolysaccharide increases expression ISO HAMP (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of HAMP mRNA CTD PMID:21685415 Hamp Mouse lipopolysaccharide increases secretion ISO Hamp (Rattus norvegicus) 6480464 Lipopolysaccharides results in increased secretion of HAMP protein CTD PMID:24038040 Hamp Mouse lipopolysaccharide increases secretion EXP 6480464 Lipopolysaccharides results in increased secretion of HAMP protein CTD PMID:24038040 Hamp Mouse lipopolysaccharide increases secretion ISO HAMP (Homo sapiens) 6480464 Lipopolysaccharides results in increased secretion of HAMP protein CTD PMID:24038040 Hamp Mouse lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of HAMP mRNA CTD PMID:11113132 more ... Hamp Mouse lipopolysaccharide multiple interactions EXP 6480464 BMP6 gene mutant form inhibits the reaction [Lipopolysaccharides results in increased expression of HAMP mRNA] more ... CTD PMID:17255318 more ... Hamp Mouse lipopolysaccharide multiple interactions ISO HAMP (Homo sapiens) 6480464 TNF protein affects the reaction [Lipopolysaccharides results in increased expression of HAMP mRNA] CTD PMID:21685415 Hamp Mouse manganese atom decreases expression EXP 6480464 Manganese results in decreased expression of HAMP mRNA CTD PMID:29020610 Hamp Mouse manganese atom multiple interactions EXP 6480464 [manganese chloride results in increased abundance of Manganese] promotes the reaction [Ethanol results in decreased expression of HAMP protein] and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of HAMP protein CTD PMID:34590183 Hamp Mouse manganese(0) decreases expression EXP 6480464 Manganese results in decreased expression of HAMP mRNA CTD PMID:29020610 Hamp Mouse manganese(0) multiple interactions EXP 6480464 [manganese chloride results in increased abundance of Manganese] promotes the reaction [Ethanol results in decreased expression of HAMP protein] and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of HAMP protein CTD PMID:34590183 Hamp Mouse manganese(II) chloride decreases expression ISO Hamp (Rattus norvegicus) 6480464 manganese chloride results in decreased expression of HAMP mRNA CTD PMID:20635692 Hamp Mouse manganese(II) chloride multiple interactions EXP 6480464 [manganese chloride results in increased abundance of Manganese] promotes the reaction [Ethanol results in decreased expression of HAMP protein] and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of HAMP protein CTD PMID:34590183 Hamp Mouse menadione affects expression ISO HAMP (Homo sapiens) 6480464 Vitamin K 3 affects the expression of HAMP mRNA CTD PMID:23410634 Hamp Mouse mercaptopurine increases expression ISO Hamp (Rattus norvegicus) 6480464 Mercaptopurine results in increased expression of HAMP mRNA CTD PMID:23358152 Hamp Mouse mercury atom multiple interactions ISO HAMP (Homo sapiens) 6480464 [HAMP protein results in decreased expression of SLC11A2 mRNA] which results in decreased uptake of Mercury CTD PMID:25772431 Hamp Mouse mercury(0) multiple interactions ISO HAMP (Homo sapiens) 6480464 [HAMP protein results in decreased expression of SLC11A2 mRNA] which results in decreased uptake of Mercury CTD PMID:25772431 Hamp Mouse metacetamol decreases secretion ISO Hamp (Rattus norvegicus) 6480464 3-hydroxyacetanilide results in decreased secretion of HAMP protein CTD PMID:24038040 Hamp Mouse metformin decreases expression ISO Hamp (Rattus norvegicus) 6480464 Metformin results in decreased expression of HAMP mRNA CTD PMID:31324951 Hamp Mouse methapyrilene increases expression ISO HAMP (Homo sapiens) 6480464 Methapyrilene results in increased expression of HAMP mRNA CTD PMID:28935588 Hamp Mouse methimazole increases expression ISO HAMP (Homo sapiens) 6480464 Methimazole results in increased expression of HAMP mRNA CTD PMID:20144635 Hamp Mouse methimazole decreases expression ISO HAMP (Homo sapiens) 6480464 Methimazole results in decreased expression of HAMP mRNA CTD PMID:20144635 Hamp Mouse mitomycin C decreases expression EXP 6480464 Mitomycin results in decreased expression of HAMP mRNA CTD PMID:25270620 Hamp Mouse Muraglitazar decreases expression ISO Hamp (Rattus norvegicus) 6480464 muraglitazar results in decreased expression of HAMP mRNA CTD PMID:21515302 Hamp Mouse N-methyl-4-phenylpyridinium decreases expression ISO Hamp (Rattus norvegicus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of HAMP mRNA CTD PMID:28801915 Hamp Mouse N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of HAMP mRNA CTD PMID:19061943 Hamp Mouse N-nitrosodiethylamine multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of HAMP mRNA and [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of HAMP mRNA CTD PMID:18164116 and PMID:20360939 Hamp Mouse N-nitrosodiethylamine multiple interactions EXP 6480464 Iron inhibits the reaction [Diethylnitrosamine results in decreased expression of HAMP mRNA] CTD PMID:19061943 Hamp Mouse nefazodone decreases expression ISO Hamp (Rattus norvegicus) 6480464 nefazodone results in decreased expression of HAMP mRNA CTD PMID:24136188 Hamp Mouse niclosamide decreases expression ISO HAMP (Homo sapiens) 6480464 Niclosamide results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse niclosamide increases expression ISO HAMP (Homo sapiens) 6480464 Niclosamide results in increased expression of HAMP mRNA CTD PMID:28284560 Hamp Mouse nimodipine multiple interactions EXP 6480464 Nimodipine promotes the reaction [Iron-Dextran Complex results in increased expression of HAMP mRNA] CTD PMID:27095094 Hamp Mouse nitrofen multiple interactions ISO Hamp (Rattus norvegicus) 6480464 Vitamin D affects the reaction [nitrofen results in increased expression of HAMP mRNA] CTD PMID:33484710 Hamp Mouse nitrofen increases expression ISO Hamp (Rattus norvegicus) 6480464 nitrofen results in increased expression of HAMP mRNA CTD PMID:33484710 Hamp Mouse nocodazole decreases expression ISO HAMP (Homo sapiens) 6480464 Nocodazole results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse omeprazole increases secretion ISO HAMP (Homo sapiens) 6480464 Omeprazole results in increased secretion of HAMP protein CTD PMID:31669099 Hamp Mouse omeprazole increases expression EXP 6480464 Omeprazole results in increased expression of HAMP mRNA and Omeprazole results in increased expression of HAMP protein CTD PMID:31669099 Hamp Mouse omeprazole multiple interactions ISO HAMP (Homo sapiens) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Omeprazole results in increased expression of HAMP mRNA] and AHR protein affects the reaction [Omeprazole results in increased expression of HAMP mRNA] CTD PMID:31669099 Hamp Mouse omeprazole increases expression ISO HAMP (Homo sapiens) 6480464 Omeprazole results in increased expression of HAMP mRNA CTD PMID:31669099 Hamp Mouse ozone decreases expression EXP 6480464 Ozone results in decreased expression of HAMP mRNA CTD PMID:31626304 Hamp Mouse ozone multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of HAMP mRNA CTD PMID:33317425 Hamp Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of HAMP mRNA CTD PMID:34911549 Hamp Mouse ozone multiple interactions ISO HAMP (Homo sapiens) 6480464 [Ozone results in increased abundance of Soot metabolite] which results in decreased expression of HAMP mRNA CTD PMID:28410501 Hamp Mouse pantoprazole increases expression ISO HAMP (Homo sapiens) 6480464 Pantoprazole results in increased expression of HAMP mRNA CTD PMID:31669099 Hamp Mouse papaverine decreases expression ISO HAMP (Homo sapiens) 6480464 Papaverine results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse paracetamol increases expression ISO HAMP (Homo sapiens) 6480464 Acetaminophen results in increased expression of HAMP mRNA CTD PMID:22230336 Hamp Mouse paracetamol decreases expression ISO HAMP (Homo sapiens) 6480464 Acetaminophen results in decreased expression of HAMP mRNA CTD PMID:29067470 Hamp Mouse paracetamol decreases secretion ISO Hamp (Rattus norvegicus) 6480464 Acetaminophen results in decreased secretion of HAMP protein CTD PMID:24038040 Hamp Mouse paracetamol decreases expression ISO Hamp (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of HAMP mRNA CTD PMID:32479839 Hamp Mouse paracetamol multiple interactions EXP 6480464 [Acetaminophen results in decreased expression of HAMP mRNA] which results in increased abundance of Iron CTD PMID:22610607 Hamp Mouse paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of HAMP mRNA CTD PMID:22610607 Hamp Mouse pentacarbonyliron increases expression EXP 6480464 Iron Carbonyl Compounds results in increased expression of HAMP mRNA and Iron Carbonyl Compounds results in increased expression of HAMP protein CTD PMID:24746831 Hamp Mouse pentacarbonyliron multiple interactions EXP 6480464 Ethanol inhibits the reaction [Iron Carbonyl Compounds results in increased expression of HAMP mRNA] more ... CTD PMID:24746831 Hamp Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of HAMP mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of HAMP mRNA CTD PMID:36331819 Hamp Mouse phenethyl caffeate multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of HAMP mRNA CTD PMID:20360939 Hamp Mouse phenformin decreases expression ISO Hamp (Rattus norvegicus) 6480464 Phenformin results in decreased expression of HAMP mRNA CTD PMID:31324951 Hamp Mouse phenylephrine decreases expression ISO Hamp (Rattus norvegicus) 6480464 Phenylephrine results in decreased expression of HAMP mRNA CTD PMID:18158353 Hamp Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of HAMP mRNA CTD PMID:20813756 and PMID:23811191 Hamp Mouse pravastatin increases expression ISO Hamp (Rattus norvegicus) 6480464 Pravastatin results in increased expression of HAMP mRNA CTD PMID:27225895 Hamp Mouse pravastatin increases expression EXP 6480464 Pravastatin results in increased expression of HAMP mRNA CTD PMID:27225895 Hamp Mouse protein kinase inhibitor multiple interactions ISO HAMP (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of HAMP mRNA] CTD PMID:28003376 Hamp Mouse purine-6-thiol increases expression ISO Hamp (Rattus norvegicus) 6480464 Mercaptopurine results in increased expression of HAMP mRNA CTD PMID:23358152 Hamp Mouse quercetin decreases expression ISO HAMP (Homo sapiens) 6480464 Quercetin results in decreased expression of HAMP mRNA CTD PMID:21632981 Hamp Mouse quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Ethanol inhibits the reaction [SMAD4 protein binds to HAMP promoter]] more ... CTD PMID:24746831 Hamp Mouse quinolin-8-ol decreases expression ISO HAMP (Homo sapiens) 6480464 Oxyquinoline results in decreased expression of HAMP mRNA CTD PMID:21632981 Hamp Mouse rabeprazole increases expression ISO HAMP (Homo sapiens) 6480464 Rabeprazole results in increased expression of HAMP mRNA CTD PMID:31669099 Hamp Mouse rotenone increases expression ISO Hamp (Rattus norvegicus) 6480464 Rotenone results in increased expression of HAMP mRNA CTD PMID:28374803 Hamp Mouse rottlerin decreases expression ISO HAMP (Homo sapiens) 6480464 rottlerin results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse Rutecarpine multiple interactions ISO HAMP (Homo sapiens) 6480464 rutecarpine inhibits the reaction [IL6 protein results in increased expression of HAMP mRNA] CTD PMID:25633564 Hamp Mouse Rutecarpine decreases expression ISO HAMP (Homo sapiens) 6480464 rutecarpine results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse serpentine asbestos decreases expression EXP 6480464 Asbestos and Serpentine results in decreased expression of HAMP mRNA CTD PMID:21514415 Hamp Mouse serpentine asbestos multiple interactions EXP 6480464 SPP1 gene mutant form inhibits the reaction [Asbestos and Serpentine results in decreased expression of HAMP mRNA] CTD PMID:21514415 Hamp Mouse silver atom increases expression ISO HAMP (Homo sapiens) 6480464 Silver results in increased expression of HAMP mRNA CTD PMID:26014281 Hamp Mouse silver(0) increases expression ISO HAMP (Homo sapiens) 6480464 Silver results in increased expression of HAMP mRNA CTD PMID:26014281 Hamp Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of HAMP mRNA CTD PMID:37682722 Hamp Mouse sodium fluoride multiple interactions EXP 6480464 Grape Seed Proanthocyanidins inhibits the reaction [Sodium Fluoride results in increased expression of HAMP mRNA] and Grape Seed Proanthocyanidins inhibits the reaction [Sodium Fluoride results in increased expression of HAMP protein] CTD PMID:29743442 Hamp Mouse sodium fluoride increases expression EXP 6480464 Sodium Fluoride results in increased expression of HAMP mRNA and Sodium Fluoride results in increased expression of HAMP protein CTD PMID:29743442 Hamp Mouse streptozocin multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [Streptozocin co-treated with iron pentacarbonyl] results in increased expression of HAMP mRNA CTD PMID:22170771 Hamp Mouse sulforaphane multiple interactions EXP 6480464 sulforaphane inhibits the reaction [Lipopolysaccharides results in increased expression of HAMP mRNA] CTD PMID:21303654 Hamp Mouse sulforaphane multiple interactions ISO Hamp (Rattus norvegicus) 6480464 [sulforaphane co-treated with Aflatoxin B1] affects the expression of HAMP mRNA CTD PMID:25450479 Hamp Mouse tamoxifen multiple interactions ISO HAMP (Homo sapiens) 6480464 Tamoxifen inhibits the reaction [Estradiol results in decreased expression of HAMP mRNA] CTD PMID:25686467 Hamp Mouse tebuconazole decreases expression ISO Hamp (Rattus norvegicus) 6480464 tebuconazole results in decreased expression of HAMP mRNA CTD PMID:33049508 Hamp Mouse tert-butyl hydroperoxide affects expression ISO HAMP (Homo sapiens) 6480464 tert-Butylhydroperoxide affects the expression of HAMP mRNA CTD PMID:23410634 Hamp Mouse Tesaglitazar decreases expression ISO Hamp (Rattus norvegicus) 6480464 tesaglitazar results in decreased expression of HAMP mRNA CTD PMID:21515302 Hamp Mouse tetrachloromethane increases expression ISO Hamp (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of HAMP mRNA CTD PMID:16239168 Hamp Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of HAMP mRNA CTD PMID:31919559 Hamp Mouse tetrachloromethane multiple interactions EXP 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of HAMP mRNA CTD PMID:30517762 Hamp Mouse tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of HAMP mRNA CTD PMID:17484886 Hamp Mouse thioacetamide increases expression ISO Hamp (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of HAMP mRNA CTD PMID:34492290 Hamp Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of HAMP mRNA CTD PMID:23557971 Hamp Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of HAMP mRNA CTD PMID:27760801 Hamp Mouse tributylstannane decreases expression EXP 6480464 tributyltin results in decreased expression of HAMP mRNA CTD PMID:31939706 Hamp Mouse trichloroethene increases expression ISO Hamp (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of HAMP mRNA CTD PMID:33387578 Hamp Mouse triclosan decreases expression ISO HAMP (Homo sapiens) 6480464 Triclosan results in decreased expression of HAMP mRNA CTD PMID:30510588 Hamp Mouse tris(2-butoxyethyl) phosphate affects expression ISO HAMP (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of HAMP mRNA CTD PMID:29024780 Hamp Mouse urethane decreases expression ISO HAMP (Homo sapiens) 6480464 Urethane results in decreased expression of HAMP mRNA CTD PMID:28818685 Hamp Mouse valproic acid decreases expression ISO HAMP (Homo sapiens) 6480464 Valproic Acid results in decreased expression of HAMP mRNA CTD PMID:29154799 Hamp Mouse verapamil multiple interactions EXP 6480464 Verapamil promotes the reaction [Iron-Dextran Complex results in increased expression of HAMP mRNA] CTD PMID:27095094 Hamp Mouse vincristine decreases expression ISO HAMP (Homo sapiens) 6480464 Vincristine results in decreased expression of HAMP mRNA CTD PMID:25633564 Hamp Mouse vitamin D multiple interactions ISO Hamp (Rattus norvegicus) 6480464 Vitamin D affects the reaction [nitrofen results in increased expression of HAMP mRNA] CTD PMID:33484710 Hamp Mouse vitamin E multiple interactions EXP 6480464 Vitamin E inhibits the reaction [Ethanol results in decreased expression of HAMP mRNA] CTD PMID:16737972 Hamp Mouse zaragozic acid A decreases expression ISO Hamp (Rattus norvegicus) 6480464 squalestatin 1 results in decreased expression of HAMP mRNA CTD PMID:27225895 Hamp Mouse zaragozic acid A affects expression EXP 6480464 squalestatin 1 affects the expression of HAMP mRNA CTD PMID:27225895
(1->4)-beta-D-glucan (EXP) 1,10-phenanthroline (ISO) 10-(beta-Dimethylaminopropionyl)phenothiazine (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2'-bipyridine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-D (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,6-dinitrotoluene (ISO) 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (EXP) 2-acetamidofluorene (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3,4,5,3',4',5'-Hexachlorobiphenyl (ISO) 3,7-dihydropurine-6-thione (ISO) 4,4'-sulfonyldiphenol (EXP) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP,ISO) acetaldehyde (ISO) acrolein (ISO) acrylamide (ISO) Actein (ISO) aflatoxin B1 (EXP,ISO) aldehydo-D-glucose (EXP) ammonium chloride (ISO) apomorphine (ISO) aristolochic acid A (ISO) aurantio-obtusin (EXP) Benzamil (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (EXP,ISO) beta-naphthoflavone (ISO) bisphenol A (EXP,ISO) bromobenzene (ISO) C60 fullerene (ISO) cadmium atom (EXP) cadmium dichloride (EXP,ISO) camptothecin (ISO) cantharidin (ISO) carbofuran (ISO) carbon nanotube (EXP) CGS 15943 (ISO) chlorpyrifos (EXP,ISO) ciglitazone (ISO) ciguatoxin CTX1B (EXP) cisplatin (EXP,ISO) cobalt dichloride (ISO) colforsin daropate hydrochloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (EXP) copper(II) sulfate (ISO) corn oil (ISO) curcumin (EXP) cyclophosphamide (EXP) cyclosporin A (EXP,ISO) D-glucose (EXP) desferrioxamine B (EXP,ISO) dibenz[a,h]anthracene (ISO) dibenzo[a,l]pyrene (ISO) dibenzofurans (EXP) diclofenac (EXP) dicrotophos (ISO) diethyl maleate (ISO) diltiazem (EXP) dioxygen (EXP,ISO) diquat (EXP,ISO) dorsomorphin (ISO) doxorubicin (EXP,ISO) endosulfan (ISO) ethanol (EXP,ISO) etoposide (EXP,ISO) ferric ammonium citrate (ISO) flutamide (ISO) fomepizole (ISO) fructose (EXP,ISO) furan (ISO) gadolinium trichloride (ISO) genistein (EXP) glucose (EXP) hemin (EXP) heparin (EXP,ISO) hexadecanoic acid (ISO) hydrogen peroxide (ISO) indole-3-methanol (ISO) inulin (EXP) iron atom (EXP,ISO) iron dextran (EXP) iron trichloride (ISO) iron(0) (EXP,ISO) isoprenaline (EXP,ISO) kenpaullone (ISO) ketoconazole (EXP) lansoprazole (ISO) lead diacetate (ISO) lead nitrate (EXP) lead(0) (ISO) leflunomide (ISO) Licochalcone B (ISO) lipopolysaccharide (EXP,ISO) manganese atom (EXP) manganese(0) (EXP) manganese(II) chloride (EXP,ISO) menadione (ISO) mercaptopurine (ISO) mercury atom (ISO) mercury(0) (ISO) metacetamol (ISO) metformin (ISO) methapyrilene (ISO) methimazole (ISO) mitomycin C (EXP) Muraglitazar (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP,ISO) nefazodone (ISO) niclosamide (ISO) nimodipine (EXP) nitrofen (ISO) nocodazole (ISO) omeprazole (EXP,ISO) ozone (EXP,ISO) pantoprazole (ISO) papaverine (ISO) paracetamol (EXP,ISO) pentacarbonyliron (EXP) perfluorooctane-1-sulfonic acid (EXP) phenethyl caffeate (ISO) phenformin (ISO) phenylephrine (ISO) pirinixic acid (EXP) pravastatin (EXP,ISO) protein kinase inhibitor (ISO) purine-6-thiol (ISO) quercetin (EXP,ISO) quinolin-8-ol (ISO) rabeprazole (ISO) rotenone (ISO) rottlerin (ISO) Rutecarpine (ISO) serpentine asbestos (EXP) silver atom (ISO) silver(0) (ISO) sodium arsenite (EXP) sodium fluoride (EXP) streptozocin (ISO) sulforaphane (EXP,ISO) tamoxifen (ISO) tebuconazole (ISO) tert-butyl hydroperoxide (ISO) Tesaglitazar (ISO) tetrachloromethane (EXP,ISO) thioacetamide (ISO) titanium dioxide (EXP) tributylstannane (EXP) trichloroethene (ISO) triclosan (ISO) tris(2-butoxyethyl) phosphate (ISO) urethane (ISO) valproic acid (ISO) verapamil (EXP) vincristine (ISO) vitamin D (ISO) vitamin E (EXP) zaragozic acid A (EXP,ISO)
Biological Process
acute-phase response (ISO) antimicrobial humoral immune response mediated by antimicrobial peptide (ISO) cell surface receptor signaling pathway via JAK-STAT (IDA) cellular response to bile acid (ISO) cellular response to interleukin-6 (ISO) cellular response to lipopolysaccharide (ISO) cellular response to tumor necrosis factor (ISO) cellular response to X-ray (ISO) defense response to bacterium (IBA,IDA,IMP) defense response to fungus (IDA,ISO) defense response to Gram-negative bacterium (ISO) defense response to Gram-positive bacterium (ISO) establishment of localization in cell (IGI) inflammatory response (IGI) intracellular iron ion homeostasis (IBA,IDA,ISO) iron ion transmembrane transport (IGI) killing of cells of another organism (ISO) liver regeneration (ISO) macrophage activation (IMP) multicellular organismal-level iron ion homeostasis (IDA,IMP,ISO) myeloid cell homeostasis (IMP) negative regulation of bone resorption (IMP) negative regulation of inflammatory response (IGI) negative regulation of intestinal absorption (IEA,ISO) negative regulation of ion transmembrane transporter activity (ISO) negative regulation of iron export across plasma membrane (IEA,ISO) negative regulation of iron ion transmembrane transport (IBA,IGI) negative regulation of transcription by RNA polymerase II (IMP) positive regulation of cell growth involved in cardiac muscle cell development (ISO) positive regulation of macrophage activation (IMP) positive regulation of proteasomal ubiquitin-dependent protein catabolic process (IEA) positive regulation of protein catabolic process (IDA) positive regulation of protein polyubiquitination (ISO) positive regulation of receptor catabolic process (ISO) positive regulation of receptor internalization (ISO) positive regulation of transcription by RNA polymerase II (IGI) protein catabolic process (IDA) response to erythropoietin (ISO) response to ethanol (ISO) response to iron ion (IEA,ISO) response to iron ion starvation (ISO) response to vitamin A (ISO) response to zinc ion (ISO) transcription by RNA polymerase II (IGI)
1.
Association of hepcidin promoter c.-582 A>G variant and iron overload in thalassemia major.
Andreani M, etal., Haematologica. 2009 Sep;94(9):1293-6. doi: 10.3324/haematol.2009.006270.
2.
Vitamin A deficiency increases hepcidin expression and oxidative stress in rat.
Arruda SF, etal., Nutrition. 2009 Apr;25(4):472-8. doi: 10.1016/j.nut.2008.11.030. Epub 2009 Feb 12.
3.
Plasma hepcidin levels are elevated but responsive to erythropoietin therapy in renal disease.
Ashby DR, etal., Kidney Int. 2009 May;75(9):976-81. doi: 10.1038/ki.2009.21. Epub 2009 Feb 11.
4.
Transferrin is a major determinant of hepcidin expression in hypotransferrinemic mice.
Bartnikas TB, etal., Blood. 2011 Jan 13;117(2):630-7. doi: 10.1182/blood-2010-05-287359. Epub 2010 Oct 18.
5.
Changes in serum hepcidin levels in acute iron intoxication in a rat model.
Ben-Assa E, etal., Toxicol Lett. 2009 Sep 28;189(3):242-7. doi: 10.1016/j.toxlet.2009.06.848. Epub 2009 Jun 12.
6.
Suppressed hepcidin expression correlates with hypotransferrinemia in copper-deficient rat pups but not dams.
Broderius M, etal., Genes Nutr. 2012 Jul;7(3):405-14. doi: 10.1007/s12263-012-0293-7. Epub 2012 Mar 29.
7.
Hepcidin demonstrates a biphasic association with anemia in acute Plasmodium falciparum malaria.
Casals-Pascual C, etal., Haematologica. 2012 Nov;97(11):1695-8. doi: 10.3324/haematol.2012.065854. Epub 2012 Jun 11.
8.
Hepcidin is involved in iron regulation in the ischemic brain.
Ding H, etal., PLoS One. 2011;6(9):e25324. doi: 10.1371/journal.pone.0025324. Epub 2011 Sep 21.
9.
Hepcidin in anemia of chronic heart failure.
Divakaran V, etal., Am J Hematol. 2011 Jan;86(1):107-9. doi: 10.1002/ajh.21902.
10.
Ironing out Ferroportin.
Drakesmith H, etal., Cell Metab. 2015 Nov 3;22(5):777-87. doi: 10.1016/j.cmet.2015.09.006. Epub 2015 Oct 1.
11.
Iron as the key modulator of hepcidin expression in erythroid antibody-mediated hypoplasia.
Fernandes JC, etal., Biomed Res Int. 2014;2014:421304. doi: 10.1155/2014/421304. Epub 2014 Dec 18.
12.
Ineffective erythropoiesis in beta-thalassemia is characterized by increased iron absorption mediated by down-regulation of hepcidin and up-regulation of ferroportin.
Gardenghi S, etal., Blood. 2007 Jun 1;109(11):5027-35. Epub 2007 Feb 13.
13.
Distinct roles for hepcidin and interleukin-6 in the recovery from anemia in mice injected with heat-killed Brucella abortus.
Gardenghi S, etal., Blood. 2014 Feb 20;123(8):1137-45. doi: 10.1182/blood-2013-08-521625. Epub 2013 Dec 19.
14.
Hepcidin expression in colon during trinitrobenzene sulfonic acid-induced colitis in rats.
Gotardo EM, etal., World J Gastroenterol. 2014 Apr 21;20(15):4345-52. doi: 10.3748/wjg.v20.i15.4345.
15.
Differences in hepatic expression of iron, inflammation and stress-related genes in patients with nonalcoholic steatohepatitis.
Handa P, etal., Ann Hepatol. 2017 Jan-Feb 2017;16(1):77-85. doi: 10.5604/16652681.1226818.
16.
Cholestasis downregulate hepcidin expression through inhibiting IL-6-induced phosphorylation of signal transducer and activator of transcription 3 signaling.
Huang YH, etal., Lab Invest. 2009 Oct;89(10):1128-39. doi: 10.1038/labinvest.2009.82. Epub 2009 Aug 3.
17.
Expression of the peptide hormone hepcidin increases in cardiomyocytes under myocarditis and myocardial infarction.
Isoda M, etal., J Nutr Biochem. 2010 Aug;21(8):749-56. doi: 10.1016/j.jnutbio.2009.04.009. Epub 2009 Jul 16.
18.
Inflammatory regulation of iron metabolism during thioacetamide-induced acute liver injury in rats.
Izawa T, etal., Exp Toxicol Pathol. 2014 Mar;66(2-3):155-62. doi: 10.1016/j.etp.2013.12.002. Epub 2013 Dec 25.
19.
Study of iron metabolism disturbances in an animal model of insulin resistance.
Le Guenno G, etal., Diabetes Res Clin Pract. 2007 Mar 8;.
20.
Does hepatic hepcidin play an important role in exercise-associated anemia in rats?
Liu YQ, etal., Int J Sport Nutr Exerc Metab. 2011 Feb;21(1):19-26.
21.
Hepcidin levels correlate to liver iron content, but not steatohepatitis, in non-alcoholic fatty liver disease.
Marmur J, etal., BMC Gastroenterol. 2018 Jun 5;18(1):78. doi: 10.1186/s12876-018-0804-0.
22.
Hepcidin and GDF15 in anemia of multiple myeloma.
Mei S, etal., Int J Hematol. 2014 Sep;100(3):266-73. doi: 10.1007/s12185-014-1626-7. Epub 2014 Jul 23.
23.
MGDs mouse GO annotations
MGD data from the GO Consortium
24.
Hepcidin is increased in the hypertrophied heart of Dahl salt-sensitive rats.
Naito Y, etal., Int J Cardiol. 2014 Mar 1;172(1):e45-7. doi: 10.1016/j.ijcard.2013.12.067. Epub 2013 Dec 28.
25.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
26.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
27.
A new mouse liver-specific gene, encoding a protein homologous to human antimicrobial peptide hepcidin, is overexpressed during iron overload.
Pigeon C, etal., J Biol Chem 2001 Mar 16;276(11):7811-9.
28.
Hepcidin expression from monocyte of splenectomized and non-splenectomized patients with HbE-beta-thalassemia.
Pratummo K, etal., Hematology. 2014 Apr;19(3):175-80. doi: 10.1179/1607845413Y.0000000110. Epub 2013 Nov 25.
29.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
30.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
31.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
32.
Mutant antimicrobial peptide hepcidin is associated with severe juvenile hemochromatosis.
Roetto A, etal., Nat Genet. 2003 Jan;33(1):21-2. Epub 2002 Dec 9.
33.
Hepcidin antimicrobial peptide transgenic mice exhibit features of the anemia of inflammation.
Roy CN, etal., Blood. 2007 May 1;109(9):4038-44. Epub 2007 Jan 11.
34.
Hepcidin is localised in gastric parietal cells, regulates acid secretion and is induced by Helicobacter pylori infection.
Schwarz P, etal., Gut. 2012 Feb;61(2):193-201. doi: 10.1136/gut.2011.241208. Epub 2011 Jul 13.
35.
Erythropoietin regulates intestinal iron absorption in a rat model of chronic renal failure.
Srai SK, etal., Kidney Int. 2010 Oct;78(7):660-7. doi: 10.1038/ki.2010.217. Epub 2010 Jul 14.
36.
Pharmacologic inhibition of hepcidin expression reverses anemia of chronic inflammation in rats.
Theurl I, etal., Blood. 2011 Nov 3;118(18):4977-84. doi: 10.1182/blood-2011-03-345066. Epub 2011 Jul 5.
37.
Hepcidin as a predictive factor and therapeutic target in erythropoiesis-stimulating agent treatment for anemia of chronic disease in rats.
Theurl M, etal., Haematologica. 2014 Sep;99(9):1516-24. doi: 10.3324/haematol.2013.099481. Epub 2014 Jun 3.
38.
Hepcidin and DNA promoter methylation in hepatocellular carcinoma.
Udali S, etal., Eur J Clin Invest. 2018 Feb;48(2):e12870. doi: 10.1111/eci.12870. Epub 2017 Dec 28.
39.
Inhibiting heme oxygenase-1 attenuates rat liver fibrosis by removing iron accumulation.
Wang QM, etal., World J Gastroenterol. 2013 May 21;19(19):2921-34. doi: 10.3748/wjg.v19.i19.2921.
40.
[Effect of hepcidin on the development of alcoholic liver disease in rats].
Xu L, etal., Sichuan Da Xue Xue Bao Yi Xue Ban. 2008 Nov;39(6):936-9.
41.
Suppression of hepcidin expression and iron overload mediate Salmonella susceptibility in ankyrin 1 ENU-induced mutant.
Yuki KE, etal., PLoS One. 2013;8(2):e55331. doi: 10.1371/journal.pone.0055331. Epub 2013 Feb 4.
Hamp Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 30,641,793 - 30,643,454 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 30,641,793 - 30,643,457 (-) Ensembl GRCm39 Ensembl GRCm38 7 30,942,368 - 30,944,029 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 30,942,368 - 30,944,032 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 31,727,387 - 31,729,036 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 30,651,128 - 30,652,777 (-) NCBI MGSCv36 mm8 Celera 7 25,508,433 - 25,510,082 (-) NCBI Celera Cytogenetic Map 7 B1 NCBI cM Map 7 19.27 NCBI
HAMP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 35,282,528 - 35,285,143 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 35,280,716 - 35,285,143 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 35,773,431 - 35,776,046 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 40,465,250 - 40,467,886 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 40,465,249 - 40,467,883 NCBI Celera 19 32,486,848 - 32,489,484 (+) NCBI Celera Cytogenetic Map 19 q13.12 NCBI HuRef 19 32,282,038 - 32,284,542 (+) NCBI HuRef CHM1_1 19 35,775,030 - 35,777,667 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 37,827,196 - 37,829,811 (+) NCBI T2T-CHM13v2.0
Hamp Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 95,298,332 - 95,300,271 (-) NCBI GRCr8 mRatBN7.2 1 86,170,926 - 86,172,865 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 86,170,901 - 86,172,891 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 91,591,061 - 91,592,997 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 100,057,225 - 100,059,161 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 93,349,359 - 93,351,295 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 89,368,021 - 89,369,960 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 89,368,021 - 89,369,960 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 90,523,506 - 90,525,473 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 85,978,120 - 85,980,059 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 86,056,230 - 86,058,170 (-) NCBI Celera 1 80,539,771 - 80,541,710 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
Hamp Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955468 4,575,510 - 4,577,649 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955468 4,576,080 - 4,577,591 (+) NCBI ChiLan1.0 ChiLan1.0
HAMP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 41,294,878 - 41,297,684 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 43,278,243 - 43,281,051 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 32,228,701 - 32,231,494 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 40,964,445 - 40,968,861 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 40,964,445 - 40,968,861 (+) Ensembl panpan1.1 panPan2
HAMP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 117,305,531 - 117,306,587 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 117,305,411 - 117,306,619 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 116,708,503 - 116,709,559 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 117,905,446 - 117,906,502 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 117,905,326 - 117,906,534 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 117,468,198 - 117,469,254 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 117,094,052 - 117,095,108 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 118,149,597 - 118,150,653 (-) NCBI UU_Cfam_GSD_1.0
Hamp Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 10,634,907 - 10,636,644 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936570 1,009,312 - 1,010,686 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936570 1,009,344 - 1,010,654 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HAMP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 44,784,160 - 44,787,305 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 44,785,863 - 44,787,303 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 40,205,859 - 40,207,301 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HAMP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 30,214,820 - 30,218,100 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 30,215,563 - 30,217,996 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 7,989,379 - 7,992,640 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hamp
.
Predicted Target Of
Count of predictions: 181 Count of miRNA genes: 177 Interacting mature miRNAs: 181 Transcripts: ENSMUST00000062620 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
25314307 Mlh1fc2_m MLH1 foci count 2 (mouse) 7 6502999 133501729 Mouse 4141566 Femwf8_m femur work to failure 8 (mouse) Not determined 13032485 47032621 Mouse 1301969 Lbw5_m lupus NZB x NZW 5 (mouse) Not determined 7 26847615 60851775 Mouse 38501068 Tip1_m tuberculosis immunophenotype 1, spleen CFU (mouse) 7 3602999 72549748 Mouse 25314314 Sccor1_m synaptonemal complex length to mean MLH1 count ratio 1 (mouse) 7 13333925 47349748 Mouse 7394747 asp3_m audiogenic seizure prone 3 (mouse) Not determined 7 27305798 36842367 Mouse 12790989 Tgl6_m triglyceride 6 (mouse) 7 27540549 61540549 Mouse 11522751 Cocia17_m cocaine-induced activity, QTL 17 (mouse) 7 13135204 47135204 Mouse 12792978 Fbmd3_m femoral bone mineral density 3, females only (mouse) 7 7050288 142367832 Mouse 4141805 Sle19_m systematic lupus erythematosus susceptibility 19 (mouse) Not determined 30032485 81135653 Mouse 1301572 Sluc30_m susceptibility to lung cancer 30 (mouse) Not determined 7 2431696 36431844 Mouse 1357699 Nhdlq6_m non-HDL QTL 6 (mouse) Not determined 7 9988867 43988984 Mouse 10449158 Eosn3_m eosinophil differential 3 (mouse) 7 12480877 46480877 Mouse 1301709 Bdt4_m bone density traits 4 (mouse) Not determined 7 22888572 56888716 Mouse 1300722 Sle3_m systemic lupus erythmatosus susceptibility 3 (mouse) Not determined 7 3511728 87142720 Mouse 1301041 Prnr2_m prion resistance 2 (mouse) Not determined 7 18728794 39674033 Mouse 12904742 Litsq2_m litter size QTL 2 (mouse) 7 22673887 56674033 Mouse 1301622 Eae12_m susceptibility to experimental allergic encephalomyelitis 12 (mouse) Not determined 7 19280015 53280104 Mouse 11354952 Pdcc1_m plasmacytoid dentritic cell compartment 1 (mouse) 7 23066531 57066531 Mouse 10449139 Eosn1_m eosinophil differential 1 (mouse) 7 12480877 46480877 Mouse 26884404 Huml1_m humerus length 1, 5 week (mouse) 7 30199425 108999207 Mouse 1301052 Bhr6_m bronchial hyperresponsiveness 6 (mouse) Not determined 7 19842250 53842367 Mouse 1301158 Eae4_m susceptibility to experimental allergic encephalomyelitis 4 (mouse) Not determined 7 19147398 141919804 Mouse 10412199 Sst2_m susceptibility to tuberculosis 2 (mouse) Not determined 7 18728794 119485380 Mouse 1558893 Spir1_m Streptococcus pneumoniae infection resistance 1 (mouse) Not determined 7 10305798 44305936 Mouse 1559016 Drsi_m DCC-related Spp1 induction (mouse) Not determined 7 16637293 49159331 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000062620 ⟹ ENSMUSP00000055404
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 30,641,793 - 30,643,457 (-) Ensembl GRCm38.p6 Ensembl 7 30,942,368 - 30,944,032 (-) Ensembl
RefSeq Acc Id:
NM_032541 ⟹ NP_115930
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 30,641,793 - 30,643,454 (-) NCBI GRCm38 7 30,942,368 - 30,944,029 (-) NCBI MGSCv37 7 31,727,387 - 31,729,036 (-) RGD Celera 7 25,508,433 - 25,510,082 (-) RGD cM Map 7 ENTREZGENE
Sequence:
AGCCACCACACAAGTCCTTAGACTGCACAGCAGAACAGAAGGCATGATGGCACTCAGCACTCGGACCCAGGCTGCCTGTCTCCTGCTTCTCCTCCTTGCCAGCCTGAGCAGCACCACCTATCTCCATC
hide sequence
RefSeq Acc Id:
NP_115930 ⟸ NM_032541
- Peptide Label:
preproprotein
- UniProtKB:
Q9EQ21 (UniProtKB/Swiss-Prot)
- Sequence:
MALSTRTQAACLLLLLLASLSSTTYLHQQMRQTTELQPLHGEESRADIAIPMQKRRKRDTNFPICIFCCKCCNNSQCGICCKT
hide sequence
Ensembl Acc Id:
ENSMUSP00000055404 ⟸ ENSMUST00000062620
RGD ID: 8663537 Promoter ID: EPDNEW_M9800 Type: multiple initiation site Name: Hamp_1 Description: Mus musculus hepcidin antimicrobial peptide , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 7 30,944,029 - 30,944,089 EPDNEW
RGD ID: 6841273 Promoter ID: MM_KWN:49874 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day2, BoneMarrow_0Hour, BoneMarrow_4Hour, Brain, Liver, MEF_B6 Transcripts: NM_032541 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 7 31,728,856 - 31,729,607 (-) MPROMDB
