Symbol:
IL21
Name:
interleukin 21
RGD ID:
14161755
Description:
ENCODES a protein that exhibits cytokine activity (inferred); cytokine receptor binding (inferred); interleukin-2 receptor binding (inferred); INVOLVED IN cellular response to virus (ortholog); germinal center B cell differentiation (ortholog); positive regulation of immunoglobulin production (ortholog); ASSOCIATED WITH Acute-On-Chronic Liver Failure (ortholog); Animal Toxoplasmosis (ortholog); anogenital venereal wart (ortholog); FOUND IN extracellular region (inferred); extracellular space (inferred); INTERACTS WITH deoxynivalenol
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
IL-21; interleukin-21
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
IL21 (interleukin 21) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Treefam
Mus musculus (house mouse):
Il21 (interleukin 21) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):
Il21 (interleukin 21) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Il21 (interleukin 21) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
IL21 (interleukin 21) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
IL21 (interleukin 21) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Il21 (interleukin 21) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
IL21 (interleukin 21) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Il21 (interleukin 21) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Latest Assembly:
Sscrofa11.1 - Pig Sscrofa11.1 Assembly
NCBI Annotation Information:
Annotation category: partial on reference assembly
Position:
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 101,532,531 - 101,541,713 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 101,532,742 - 101,540,712 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 108,688,772 - 108,696,742 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
JBrowse:
View Region in Genome Browser (JBrowse)
Model
IL21 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 101,532,531 - 101,541,713 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 101,532,742 - 101,540,712 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 108,688,772 - 108,696,742 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IL21 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 122,610,108 - 122,621,066 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 122,610,108 - 122,621,066 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 123,531,263 - 123,542,221 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 123,739,272 - 123,761,662 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 123,891,388 - 123,899,817 NCBI Celera 4 120,916,832 - 120,925,261 (-) NCBI Celera Cytogenetic Map 4 q27 NCBI HuRef 4 119,260,228 - 119,268,550 (-) NCBI HuRef CHM1_1 4 123,510,250 - 123,518,679 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 125,914,209 - 125,925,168 (-) NCBI T2T-CHM13v2.0
Il21 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 37,276,908 - 37,286,785 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 37,276,908 - 37,286,785 (-) Ensembl GRCm39 Ensembl GRCm38 3 37,222,759 - 37,232,636 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 37,222,759 - 37,232,636 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 37,121,681 - 37,131,540 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 37,107,141 - 37,117,000 (-) NCBI MGSCv36 mm8 MGSCv36 3 37,414,308 - 37,424,167 (-) NCBI MGSCv36 mm8 Celera 3 37,106,874 - 37,116,609 (-) NCBI Celera Cytogenetic Map 3 B NCBI cM Map 3 18.36 NCBI
Il21 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 122,045,240 - 122,055,142 (-) NCBI GRCr8 mRatBN7.2 2 120,117,105 - 120,127,012 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 120,119,444 - 120,126,996 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 126,682,458 - 126,689,816 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 124,794,962 - 124,802,318 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 119,423,940 - 119,431,294 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 123,965,021 - 123,972,356 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 123,965,021 - 123,972,356 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 143,573,215 - 143,580,530 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 123,774,331 - 123,781,697 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 123,697,822 - 123,750,231 (-) NCBI Celera 2 115,067,969 - 115,075,326 (-) NCBI Celera Cytogenetic Map 2 q25 NCBI
Il21 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955428 18,057,096 - 18,065,492 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955428 18,057,096 - 18,065,492 (+) NCBI ChiLan1.0 ChiLan1.0
IL21 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 120,394,845 - 120,405,796 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 120,660,750 - 120,671,701 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 114,795,979 - 114,806,936 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 125,940,979 - 125,951,915 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 125,943,495 - 125,951,915 (-) Ensembl panpan1.1 panPan2
IL21 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 19 17,641,833 - 17,651,275 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 19 17,641,833 - 17,651,266 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 19 17,860,011 - 17,869,452 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 19 17,760,158 - 17,769,609 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 19 17,760,158 - 17,769,600 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 19 17,712,780 - 17,722,226 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 19 17,993,018 - 18,002,469 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 19 18,463,313 - 18,472,753 (+) NCBI UU_Cfam_GSD_1.0
Il21 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405301 65,422,896 - 65,429,900 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936662 1,689,879 - 1,696,883 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936662 1,689,879 - 1,696,883 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
IL21 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 69,859,793 - 69,872,237 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 69,863,535 - 69,872,025 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 48,822,863 - 48,834,392 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Il21
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
2
5
2
5
7
5
5
1
3
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSSSCT00000009953 ⟹ ENSSSCP00000009696
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 Ensembl 8 101,530,949 - 101,540,713 (+) Ensembl
Ensembl Acc Id:
ENSSSCT00000043075 ⟹ ENSSSCP00000043300
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 Ensembl 8 101,532,531 - 101,541,713 (+) Ensembl
RefSeq Acc Id:
NM_214415 ⟹ NP_999580
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 8 101,532,742 - 101,540,712 (+) NCBI
Sequence:
ATGCGGTGGCCGGGGAACATGGAGAAAATAGTCATCTGCCTGATGGTCATCTTCTCAGGCACAGTGGCCCATAAATCAAGCTTCCAAGGACAAGATCGCCTCTTGATTAGACTGCGTCAACTTATAGA
hide sequence
RefSeq Acc Id:
NP_999580 ⟸ NM_214415
- Peptide Label:
precursor
- UniProtKB:
Q76LU6 (UniProtKB/Swiss-Prot), A0A8D0XZR7 (UniProtKB/TrEMBL)
- Sequence:
MRWPGNMEKIVICLMVIFSGTVAHKSSFQGQDRLLIRLRQLIDTVDQLKNYVHDLDPELLPAPEDVQRHCEQSAFSCFQKVELKSANTGDNEKIINVLIKQLKRKLPPTNAGRRQKHGLTCPTCDSYE
hide sequence
Ensembl Acc Id:
ENSSSCP00000009696 ⟸ ENSSSCT00000009953
Ensembl Acc Id:
ENSSSCP00000043300 ⟸ ENSSSCT00000043075
