Symbol:
VGLL4
Name:
vestigial like family member 4
RGD ID:
1323223
HGNC Page
HGNC:28966
Description:
Predicted to enable transcription coactivator binding activity. Involved in negative regulation of Wnt signaling pathway; negative regulation of cell growth; and negative regulation of hippo signaling. Predicted to be located in nucleus.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
KIAA0121; transcription cofactor vestigial-like protein 4; vestigial like 4; Vestigial-like 4; vestigial-like family member 4; VGL-4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Vgll4 (vestigial like family member 4) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Vgll4 (vestigial-like family member 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Vgll4 (vestigial like family member 4) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
VGLL4 (vestigial like family member 4) NCBI
Ortholog
Canis lupus familiaris (dog):
VGLL4 (vestigial like family member 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Vgll4 (vestigial like family member 4) NCBI
Ortholog
Sus scrofa (pig):
VGLL4 (vestigial like family member 4) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
VGLL4 (vestigial like family member 4) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Vgll4 (vestigial like family member 4) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Vgll4 (vestigial-like family member 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Vgll4 (vestigial like family member 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
vgll4b (vestigial-like family member 4b)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
vgll4a (vestigial-like family member 4a)
Alliance
DIOPT (OrthoFinder|PANTHER|ZFIN)
Drosophila melanogaster (fruit fly):
Tgi
Alliance
DIOPT (OrthoFinder|PANTHER)
Xenopus laevis (African clawed frog):
vgll4.L
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
vgll4.S
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
vgll4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 11,556,067 - 11,721,815 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 11,556,069 - 11,771,350 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 11,597,541 - 11,762,013 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 11,572,544 - 11,737,037 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 11,572,543 - 11,737,037 NCBI Celera 3 11,532,949 - 11,697,489 (-) NCBI Celera Cytogenetic Map 3 p25.3-p25.2 NCBI HuRef 3 11,531,091 - 11,695,667 (-) NCBI HuRef CHM1_1 3 11,547,671 - 11,712,219 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 11,551,371 - 11,717,542 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
VGLL4 Human (1->4)-beta-D-glucan multiple interactions ISO Vgll4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of VGLL4 mRNA CTD PMID:36331819 VGLL4 Human 17alpha-ethynylestradiol affects expression ISO Vgll4 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of VGLL4 mRNA CTD PMID:17555576 VGLL4 Human 17alpha-ethynylestradiol multiple interactions ISO Vgll4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of VGLL4 mRNA CTD PMID:17942748 VGLL4 Human 17alpha-ethynylestradiol increases expression ISO Vgll4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of VGLL4 mRNA CTD PMID:17942748 VGLL4 Human 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO Vgll4 (Rattus norvegicus) 6480464 2 more ... CTD PMID:27291303 VGLL4 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Vgll4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of VGLL4 mRNA CTD PMID:17942748 VGLL4 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Vgll4 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of VGLL4 mRNA CTD PMID:34747641 VGLL4 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Vgll4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of VGLL4 mRNA CTD PMID:26290441 VGLL4 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Vgll4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of VGLL4 mRNA CTD PMID:21570461 VGLL4 Human 2-methylcholine affects expression EXP 6480464 beta-methylcholine affects the expression of VGLL4 mRNA CTD PMID:21179406 VGLL4 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of VGLL4 mRNA CTD PMID:28628672 VGLL4 Human 4,4'-diaminodiphenylmethane decreases expression ISO Vgll4 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of VGLL4 mRNA CTD PMID:18648102 VGLL4 Human 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of VGLL4 mRNA CTD PMID:28628672 VGLL4 Human 4,4'-sulfonyldiphenol affects methylation ISO Vgll4 (Mus musculus) 6480464 bisphenol S affects the methylation of VGLL4 gene CTD PMID:31683443 VGLL4 Human 4,4'-sulfonyldiphenol decreases methylation ISO Vgll4 (Mus musculus) 6480464 bisphenol S results in decreased methylation of VGLL4 exon CTD PMID:33297965 VGLL4 Human 4-hydroxyphenyl retinamide increases expression ISO Vgll4 (Mus musculus) 6480464 Fenretinide results in increased expression of VGLL4 mRNA CTD PMID:28973697 VGLL4 Human aflatoxin B1 increases methylation EXP 6480464 Aflatoxin B1 results in increased methylation of VGLL4 gene and Aflatoxin B1 results in increased methylation of VGLL4 intron CTD PMID:27153756 and PMID:30157460 VGLL4 Human Aflatoxin B2 alpha increases methylation EXP 6480464 aflatoxin B2 results in increased methylation of VGLL4 intron CTD PMID:30157460 VGLL4 Human amphetamine decreases expression ISO Vgll4 (Rattus norvegicus) 6480464 Amphetamine results in decreased expression of VGLL4 mRNA CTD PMID:30779732 VGLL4 Human antimycin A decreases expression EXP 6480464 Antimycin A results in decreased expression of VGLL4 mRNA CTD PMID:33512557 VGLL4 Human aristolochic acid A decreases expression EXP 6480464 aristolochic acid I results in decreased expression of VGLL4 mRNA CTD PMID:33212167 VGLL4 Human arsane affects methylation EXP 6480464 Arsenic affects the methylation of VGLL4 gene CTD PMID:25304211 VGLL4 Human arsane multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of VGLL4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of VGLL4 mRNA CTD PMID:39836092 VGLL4 Human arsenic atom affects methylation EXP 6480464 Arsenic affects the methylation of VGLL4 gene CTD PMID:25304211 VGLL4 Human arsenic atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of VGLL4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of VGLL4 mRNA CTD PMID:39836092 VGLL4 Human arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of VGLL4 mRNA CTD PMID:20458559 VGLL4 Human atrazine affects methylation ISO Vgll4 (Rattus norvegicus) 6480464 Atrazine affects the methylation of VGLL4 gene CTD PMID:35440735 VGLL4 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of VGLL4 mRNA CTD PMID:20064835 VGLL4 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of VGLL4 intron CTD PMID:30157460 VGLL4 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of VGLL4 3' UTR CTD PMID:27901495 VGLL4 Human benzo[a]pyrene multiple interactions ISO Vgll4 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of VGLL4 mRNA] CTD PMID:22228805 VGLL4 Human benzo[e]pyrene decreases methylation EXP 6480464 benzo(e)pyrene results in decreased methylation of VGLL4 intron CTD PMID:30157460 VGLL4 Human bis(2-ethylhexyl) phthalate multiple interactions ISO Vgll4 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of VGLL4 mRNA CTD PMID:39150890 VGLL4 Human bisphenol A increases expression ISO Vgll4 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of VGLL4 mRNA CTD PMID:25181051 VGLL4 Human bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of VGLL4 gene CTD PMID:31601247 VGLL4 Human bisphenol A decreases expression ISO Vgll4 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of VGLL4 mRNA CTD PMID:30816183 VGLL4 Human bisphenol A increases methylation ISO Vgll4 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of VGLL4 gene CTD PMID:28505145 VGLL4 Human bisphenol F increases expression ISO Vgll4 (Mus musculus) 6480464 bisphenol F results in increased expression of VGLL4 mRNA CTD PMID:38685157 VGLL4 Human Butylbenzyl phthalate multiple interactions ISO Vgll4 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of VGLL4 mRNA CTD PMID:39150890 VGLL4 Human cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of VGLL4 mRNA CTD PMID:35301059 VGLL4 Human cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of VGLL4 mRNA CTD PMID:35301059 VGLL4 Human caffeine affects phosphorylation EXP 6480464 Caffeine affects the phosphorylation of VGLL4 protein CTD PMID:35688186 VGLL4 Human calcitriol increases expression EXP 6480464 Calcitriol results in increased expression of VGLL4 mRNA CTD PMID:16002434 VGLL4 Human carbon nanotube decreases expression ISO Vgll4 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of VGLL4 mRNA CTD PMID:25620056 VGLL4 Human chloroprene decreases expression ISO Vgll4 (Rattus norvegicus) 6480464 Chloroprene results in decreased expression of VGLL4 mRNA CTD PMID:23125180 VGLL4 Human cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of VGLL4 mRNA CTD PMID:19376846 VGLL4 Human copper atom increases expression ISO Vgll4 (Rattus norvegicus) 6480464 Copper results in increased expression of VGLL4 mRNA CTD PMID:30556269 VGLL4 Human copper(0) increases expression ISO Vgll4 (Rattus norvegicus) 6480464 Copper results in increased expression of VGLL4 mRNA CTD PMID:30556269 VGLL4 Human coumarin decreases phosphorylation EXP 6480464 coumarin results in decreased phosphorylation of VGLL4 protein CTD PMID:35688186 VGLL4 Human coumestrol decreases expression EXP 6480464 Coumestrol results in decreased expression of VGLL4 mRNA CTD PMID:19167446 VGLL4 Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of VGLL4 mRNA CTD PMID:20106945 VGLL4 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of VGLL4 mRNA CTD PMID:25562108 VGLL4 Human cytarabine decreases expression EXP 6480464 Cytarabine results in decreased expression of VGLL4 mRNA CTD PMID:21198554 VGLL4 Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of VGLL4 mRNA CTD PMID:28628672 VGLL4 Human diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of VGLL4 mRNA CTD PMID:20458559 VGLL4 Human dibutyl phthalate increases expression ISO Vgll4 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of VGLL4 mRNA CTD PMID:21266533 VGLL4 Human dibutyl phthalate multiple interactions ISO Vgll4 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of VGLL4 mRNA CTD PMID:39150890 VGLL4 Human diethyl phthalate multiple interactions ISO Vgll4 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of VGLL4 mRNA CTD PMID:39150890 VGLL4 Human diisobutyl phthalate multiple interactions ISO Vgll4 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of VGLL4 mRNA CTD PMID:39150890 VGLL4 Human diisononyl phthalate multiple interactions ISO Vgll4 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of VGLL4 mRNA CTD PMID:39150890 VGLL4 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of VGLL4 mRNA CTD PMID:29803840 VGLL4 Human endosulfan decreases expression ISO Vgll4 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of VGLL4 mRNA CTD PMID:29391264 VGLL4 Human ethanol multiple interactions EXP 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of VGLL4 mRNA CTD PMID:29432896 VGLL4 Human ethanol affects expression ISO Vgll4 (Mus musculus) 6480464 Ethanol affects the expression of VGLL4 mRNA CTD PMID:30319688 VGLL4 Human ethanol affects splicing ISO Vgll4 (Mus musculus) 6480464 Ethanol affects the splicing of VGLL4 mRNA CTD PMID:30319688 VGLL4 Human fenpyroximate decreases expression EXP 6480464 fenpyroximate results in decreased expression of VGLL4 mRNA CTD PMID:33512557 VGLL4 Human fenthion increases expression ISO Vgll4 (Mus musculus) 6480464 Fenthion results in increased expression of VGLL4 mRNA CTD PMID:34813904 VGLL4 Human FR900359 decreases phosphorylation EXP 6480464 FR900359 results in decreased phosphorylation of VGLL4 protein CTD PMID:37730182 VGLL4 Human fulvestrant decreases methylation EXP 6480464 Fulvestrant results in decreased methylation of VGLL4 gene CTD PMID:31601247 VGLL4 Human furan decreases expression ISO Vgll4 (Rattus norvegicus) 6480464 furan results in decreased expression of VGLL4 mRNA CTD PMID:26194646 VGLL4 Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of VGLL4 mRNA CTD PMID:28628672 VGLL4 Human inulin multiple interactions ISO Vgll4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of VGLL4 mRNA CTD PMID:36331819 VGLL4 Human ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of VGLL4 mRNA CTD PMID:36621641 VGLL4 Human manganese atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of VGLL4 mRNA CTD PMID:39836092 VGLL4 Human manganese(0) multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of VGLL4 mRNA CTD PMID:39836092 VGLL4 Human manganese(II) chloride multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of VGLL4 mRNA CTD PMID:39836092 VGLL4 Human menadione affects expression EXP 6480464 Vitamin K 3 affects the expression of VGLL4 mRNA CTD PMID:20044591 VGLL4 Human metformin decreases expression ISO Vgll4 (Rattus norvegicus) 6480464 Metformin results in decreased expression of VGLL4 mRNA CTD PMID:31324951 VGLL4 Human methapyrilene decreases methylation EXP 6480464 Methapyrilene results in decreased methylation of VGLL4 intron CTD PMID:30157460 VGLL4 Human methoxychlor affects methylation ISO Vgll4 (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of VGLL4 gene CTD PMID:35440735 VGLL4 Human methyl methanesulfonate decreases expression EXP 6480464 Methyl Methanesulfonate results in decreased expression of VGLL4 mRNA CTD PMID:23649840 VGLL4 Human ozone multiple interactions ISO Vgll4 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of VGLL4 mRNA CTD PMID:34911549 VGLL4 Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of VGLL4 mRNA CTD PMID:29067470 VGLL4 Human paracetamol decreases expression ISO Vgll4 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of VGLL4 mRNA CTD PMID:33387578 VGLL4 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Vgll4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of VGLL4 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of VGLL4 mRNA CTD PMID:36331819 VGLL4 Human phenformin decreases expression ISO Vgll4 (Rattus norvegicus) 6480464 Phenformin results in decreased expression of VGLL4 mRNA CTD PMID:31324951 VGLL4 Human phenobarbital affects expression ISO Vgll4 (Mus musculus) 6480464 Phenobarbital affects the expression of VGLL4 mRNA CTD PMID:23091169 VGLL4 Human pirinixic acid multiple interactions ISO Vgll4 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of VGLL4 mRNA CTD PMID:19710929 VGLL4 Human silver atom decreases expression ISO Vgll4 (Mus musculus) 6480464 Silver results in decreased expression of VGLL4 mRNA CTD PMID:27131904 VGLL4 Human silver(0) decreases expression ISO Vgll4 (Mus musculus) 6480464 Silver results in decreased expression of VGLL4 mRNA CTD PMID:27131904 VGLL4 Human sodium arsenite multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of VGLL4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of VGLL4 mRNA CTD PMID:39836092 VGLL4 Human sodium arsenite decreases expression ISO Vgll4 (Mus musculus) 6480464 sodium arsenite results in decreased expression of VGLL4 mRNA CTD PMID:37682722 VGLL4 Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of VGLL4 mRNA CTD PMID:31533062 VGLL4 Human tamoxifen affects expression ISO Vgll4 (Mus musculus) 6480464 Tamoxifen affects the expression of VGLL4 mRNA CTD PMID:17555576 VGLL4 Human tebufenpyrad decreases expression EXP 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of VGLL4 mRNA CTD PMID:33512557 VGLL4 Human tert-butyl hydroperoxide decreases expression EXP 6480464 tert-Butylhydroperoxide results in decreased expression of VGLL4 mRNA CTD PMID:15336504 VGLL4 Human trichloroethene increases expression ISO Vgll4 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of VGLL4 mRNA CTD PMID:33387578 VGLL4 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of VGLL4 mRNA CTD PMID:37042841 VGLL4 Human tunicamycin increases expression EXP 6480464 Tunicamycin results in increased expression of VGLL4 mRNA CTD PMID:29453283 VGLL4 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of VGLL4 mRNA CTD PMID:25979313 VGLL4 Human vitamin E decreases expression EXP 6480464 Vitamin E results in decreased expression of VGLL4 mRNA CTD PMID:19244175
(1->4)-beta-D-glucan (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-methylcholine (EXP) 3-isobutyl-1-methyl-7H-xanthine (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) aflatoxin B1 (EXP) Aflatoxin B2 alpha (EXP) amphetamine (ISO) antimycin A (EXP) aristolochic acid A (EXP) arsane (EXP) arsenic atom (EXP) arsenous acid (EXP) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) Butylbenzyl phthalate (ISO) cadmium atom (EXP) cadmium dichloride (EXP) caffeine (EXP) calcitriol (EXP) carbon nanotube (ISO) chloroprene (ISO) cobalt dichloride (EXP) copper atom (ISO) copper(0) (ISO) coumarin (EXP) coumestrol (EXP) cyclosporin A (EXP) cytarabine (EXP) dexamethasone (EXP) diarsenic trioxide (EXP) dibutyl phthalate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) doxorubicin (EXP) endosulfan (ISO) ethanol (EXP,ISO) fenpyroximate (EXP) fenthion (ISO) FR900359 (EXP) fulvestrant (EXP) furan (ISO) indometacin (EXP) inulin (ISO) ketoconazole (EXP) manganese atom (EXP) manganese(0) (EXP) manganese(II) chloride (EXP) menadione (EXP) metformin (ISO) methapyrilene (EXP) methoxychlor (ISO) methyl methanesulfonate (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenformin (ISO) phenobarbital (ISO) pirinixic acid (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (EXP,ISO) sunitinib (EXP) tamoxifen (ISO) tebufenpyrad (EXP) tert-butyl hydroperoxide (EXP) trichloroethene (ISO) triphenyl phosphate (EXP) tunicamycin (EXP) valproic acid (EXP) vitamin E (EXP)
VGLL4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 11,556,067 - 11,721,815 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 11,556,069 - 11,771,350 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 11,597,541 - 11,762,013 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 11,572,544 - 11,737,037 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 11,572,543 - 11,737,037 NCBI Celera 3 11,532,949 - 11,697,489 (-) NCBI Celera Cytogenetic Map 3 p25.3-p25.2 NCBI HuRef 3 11,531,091 - 11,695,667 (-) NCBI HuRef CHM1_1 3 11,547,671 - 11,712,219 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 11,551,371 - 11,717,542 (-) NCBI T2T-CHM13v2.0
Vgll4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 114,836,850 - 114,946,932 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 114,837,589 - 114,946,955 (-) Ensembl GRCm39 Ensembl GRCm38 6 114,860,621 - 114,970,007 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 114,860,628 - 114,969,994 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 114,812,108 - 114,871,770 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 114,827,709 - 114,887,371 (-) NCBI MGSCv36 mm8 Celera 6 116,699,571 - 116,759,386 (-) NCBI Celera Cytogenetic Map 6 E3 NCBI cM Map 6 53.07 NCBI
Vgll4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 149,598,151 - 149,711,186 (-) NCBI GRCr8 mRatBN7.2 4 147,925,630 - 148,038,519 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 147,927,034 - 148,038,471 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 154,151,173 - 154,264,033 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 149,934,223 - 150,047,087 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 148,558,058 - 148,670,911 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 146,778,556 - 146,890,063 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 146,779,276 - 146,839,397 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 210,069,578 - 210,129,654 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 150,995,533 - 151,055,736 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 151,240,377 - 151,300,577 (-) NCBI Celera 4 136,824,155 - 136,883,668 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
Vgll4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955429 14,303,682 - 14,400,743 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955429 14,301,509 - 14,413,163 (-) NCBI ChiLan1.0 ChiLan1.0
VGLL4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 11,549,922 - 11,715,904 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 11,554,683 - 11,719,713 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 11,489,805 - 11,654,507 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 11,834,746 - 11,999,783 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 11,834,746 - 11,981,877 (-) Ensembl panpan1.1 panPan2
VGLL4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 6,751,951 - 6,915,650 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 6,751,801 - 6,913,201 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 6,788,411 - 6,951,089 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 6,781,024 - 6,944,924 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 6,780,872 - 6,973,869 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 6,498,117 - 6,661,200 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 6,854,645 - 7,017,774 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 6,825,251 - 6,988,564 (+) NCBI UU_Cfam_GSD_1.0
Vgll4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404942 16,971,272 - 17,120,226 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936602 1,815,313 - 1,936,031 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936602 1,789,479 - 1,938,440 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
VGLL4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 67,698,083 - 67,872,486 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 67,698,082 - 67,873,119 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 74,916,759 - 74,947,883 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
VGLL4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 47,572,345 - 47,734,089 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 47,574,828 - 47,658,057 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 118,782,175 - 118,944,113 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Vgll4
.
Predicted Target Of
Count of predictions: 5843 Count of miRNA genes: 1229 Interacting mature miRNAs: 1574 Transcripts: ENST00000273038, ENST00000404339, ENST00000413604, ENST00000417206, ENST00000417466, ENST00000418000, ENST00000419541, ENST00000424529, ENST00000424709, ENST00000426568, ENST00000430365, ENST00000437722, ENST00000445411, ENST00000451674, ENST00000458499, ENST00000463387, ENST00000480288 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
407023043 GWAS672019_H HVA measurement QTL GWAS672019 (human) 0.000002 HVA measurement 3 11583940 11583941 Human 597210905 GWAS1306979_H birth weight, parental genotype effect measurement QTL GWAS1306979 (human) 3e-08 birth weight, parental genotype effect measurement neonatal body weight (CMO:0002079) 3 11595034 11595035 Human 597134998 GWAS1231072_H diastolic blood pressure QTL GWAS1231072 (human) 6e-09 diastolic blood pressure diastolic blood pressure (CMO:0000005) 3 11635953 11635954 Human 596954134 GWAS1073653_H body mass index QTL GWAS1073653 (human) 1e-10 body mass index 3 11587946 11587947 Human 597317144 GWAS1413218_H body surface area QTL GWAS1413218 (human) 3e-09 body surface area 3 11588778 11588779 Human 597105683 GWAS1201757_H cortex volume change measurement, age at assessment QTL GWAS1201757 (human) 0.000004 cortex volume change measurement, age at assessment 3 11627997 11627998 Human 597280669 GWAS1376743_H BMI-adjusted hip circumference QTL GWAS1376743 (human) 2e-09 BMI-adjusted hip circumference hip circumference (CMO:0000014) 3 11660260 11660261 Human 597280668 GWAS1376742_H BMI-adjusted hip circumference QTL GWAS1376742 (human) 4e-10 BMI-adjusted hip circumference hip circumference (CMO:0000014) 3 11567724 11567725 Human 597238815 GWAS1334889_H appendicular lean mass QTL GWAS1334889 (human) 6e-13 appendicular lean mass 3 11588778 11588779 Human 406894539 GWAS543515_H HVA measurement, 5-HIAA measurement QTL GWAS543515 (human) 0.000008 HVA measurement, 5-HIAA measurement cervical spinal cord 5-HIAA level (CMO:0003127) 3 11583940 11583941 Human 597030558 GWAS1126632_H body mass index QTL GWAS1126632 (human) 4e-10 body mass index body mass index (BMI) (CMO:0000105) 3 11584990 11584991 Human 597249554 GWAS1345628_H Ischemic stroke QTL GWAS1345628 (human) 0.0000002 Ischemic stroke 3 11602638 11602639 Human 597175060 GWAS1271134_H body mass index QTL GWAS1271134 (human) 5e-10 body mass index body mass index (BMI) (CMO:0000105) 3 11584990 11584991 Human 597147035 GWAS1243109_H chronic obstructive pulmonary disease QTL GWAS1243109 (human) 5e-20 lung integrity trait (VT:0010906) 3 11600640 11600641 Human 407276489 GWAS925465_H spontaneous preterm birth QTL GWAS925465 (human) 0.000001 spontaneous preterm birth 3 11608090 11608091 Human 407094609 GWAS743585_H balding measurement QTL GWAS743585 (human) 4e-20 hair amount (VT:0000416) coat/hair morphological measurement (CMO:0001807) 3 11566640 11566641 Human 596986753 GWAS1106272_H body mass index QTL GWAS1106272 (human) 2e-09 body mass index 3 11599007 11599008 Human 597075470 GWAS1171544_H body mass index QTL GWAS1171544 (human) 5e-08 body mass index body mass index (BMI) (CMO:0000105) 3 11613907 11613908 Human 597266432 GWAS1362506_H insomnia QTL GWAS1362506 (human) 2e-08 insomnia 3 11560019 11560020 Human 407128285 GWAS777261_H handedness QTL GWAS777261 (human) 0.000009 handedness 3 11652993 11652994 Human 2316345 GLUCO224_H Glucose level QTL 224 (human) 1.27 0.008 Glucose level 3 1 21543441 Human 597346821 GWAS1442895_H FEV/FVC ratio QTL GWAS1442895 (human) 3e-25 FEV/FVC ratio forced expiratory volume to forced vital capacity ratio (CMO:0000241) 3 11610857 11610858 Human 407093212 GWAS742188_H hair color QTL GWAS742188 (human) 1e-08 hair color 3 11620818 11620819 Human 597142838 GWAS1238912_H RS-10-hydroxywarfarin to RS-warfarin ratio measurement QTL GWAS1238912 (human) 0.000006 RS-10-hydroxywarfarin to RS-warfarin ratio measurement 3 11636898 11636899 Human 597463350 GWAS1559424_H diastolic blood pressure QTL GWAS1559424 (human) 1e-08 diastolic blood pressure diastolic blood pressure (CMO:0000005) 3 11625649 11625650 Human 597126567 GWAS1222641_H total hip arthroplasty, osteoarthritis QTL GWAS1222641 (human) 3e-09 total hip arthroplasty, osteoarthritis 3 11601991 11601992 Human 597022118 GWAS1118192_H interleukin 4 measurement QTL GWAS1118192 (human) 0.000002 blood interleukin-4 amount (VT:0008601) blood interleukin-4 level (CMO:0003065) 3 11663411 11663412 Human 597030445 GWAS1126519_H body mass index QTL GWAS1126519 (human) 1e-08 body mass index body mass index (BMI) (CMO:0000105) 3 11599007 11599008 Human 597293216 GWAS1389290_H body mass index QTL GWAS1389290 (human) 1e-10 body mass index body mass index (BMI) (CMO:0000105) 3 11587946 11587947 Human 597288866 GWAS1384940_H body weight QTL GWAS1384940 (human) 1e-11 body mass (VT:0001259) body weight (CMO:0000012) 3 11594157 11594158 Human 597343909 GWAS1439983_H color vision disorder QTL GWAS1439983 (human) 0.000002 color vision disorder 3 11584990 11584991 Human 597085654 GWAS1181728_H body mass index QTL GWAS1181728 (human) 1e-08 body mass index body mass index (BMI) (CMO:0000105) 3 11592477 11592478 Human 406963588 GWAS612564_H clopidogrel metabolite measurement QTL GWAS612564 (human) 0.000009 clopidogrel metabolite measurement 3 11583728 11583729 Human 406960264 GWAS609240_H anorexia nervosa QTL GWAS609240 (human) 0.000009 anorexia nervosa 3 11634315 11634316 Human 407389955 GWAS1038931_H protein measurement QTL GWAS1038931 (human) 3e-09 protein measurement 3 11584596 11584597 Human 597108059 GWAS1204133_H Agents acting on the renin-angiotensin system use measurement QTL GWAS1204133 (human) 6e-09 Agents acting on the renin-angiotensin system use measurement 3 11562645 11562646 Human 597300054 GWAS1396128_H body mass index QTL GWAS1396128 (human) 2e-09 body mass index body mass index (BMI) (CMO:0000105) 3 11599007 11599008 Human 407055756 GWAS704732_H chronic obstructive pulmonary disease QTL GWAS704732 (human) 2e-10 lung integrity trait (VT:0010906) 3 11599127 11599128 Human 597173193 GWAS1269267_H body mass index QTL GWAS1269267 (human) 8e-12 body mass index body mass index (BMI) (CMO:0000105) 3 11599007 11599008 Human 597029570 GWAS1125644_H balding measurement QTL GWAS1125644 (human) 5e-14 hair amount (VT:0000416) coat/hair morphological measurement (CMO:0001807) 3 11566640 11566641 Human 597249472 GWAS1345546_H BMI-adjusted hip circumference QTL GWAS1345546 (human) 1e-08 BMI-adjusted hip circumference hip circumference (CMO:0000014) 3 11559886 11559887 Human 597021263 GWAS1117337_H granulocyte colony-stimulating factor measurement QTL GWAS1117337 (human) 0.000009 cytokine amount (VT:0008713) 3 11665176 11665177 Human 597322182 GWAS1418256_H drug allergy, trait in response to platinum QTL GWAS1418256 (human) 0.000005 drug allergy, trait in response to platinum 3 11599164 11599165 Human 597271878 GWAS1367952_H systolic blood pressure QTL GWAS1367952 (human) 1e-09 systolic blood pressure systolic blood pressure (CMO:0000004) 3 11596433 11596434 Human 407086113 GWAS735089_H preterm premature rupture of the membranes, spontaneous preterm birth QTL GWAS735089 (human) 0.000004 preterm premature rupture of the membranes, spontaneous preterm birth 3 11623075 11623076 Human 597167357 GWAS1263431_H body mass index QTL GWAS1263431 (human) 2e-11 body mass index body mass index (BMI) (CMO:0000105) 3 11600640 11600641 Human 597061631 GWAS1157705_H FEV/FVC ratio QTL GWAS1157705 (human) 1e-20 FEV/FVC ratio forced expiratory volume to forced vital capacity ratio (CMO:0000241) 3 11600640 11600641 Human 597449969 GWAS1546043_H systolic blood pressure QTL GWAS1546043 (human) 5e-10 systolic blood pressure systolic blood pressure (CMO:0000004) 3 11596433 11596434 Human 597062011 GWAS1158085_H susceptibility to chronic sinus infection measurement QTL GWAS1158085 (human) 0.000005 susceptibility to chronic sinus infection measurement 3 11624009 11624010 Human 597134969 GWAS1231043_H pulse pressure measurement QTL GWAS1231043 (human) 0.0000009 pulse pressure measurement pulse pressure (CMO:0000292) 3 11635953 11635954 Human 406919987 GWAS568963_H lean body mass QTL GWAS568963 (human) 7e-09 body lean mass (VT:0010483) total body lean mass (CMO:0003950) 3 11588003 11588004 Human 597198703 GWAS1294777_H systolic blood pressure QTL GWAS1294777 (human) 2e-11 systolic blood pressure systolic blood pressure (CMO:0000004) 3 11635953 11635954 Human 596976365 GWAS1095884_H body height QTL GWAS1095884 (human) 6e-20 body height 3 11608635 11608636 Human 597099884 GWAS1195958_H alopecia QTL GWAS1195958 (human) 2e-09 alopecia 3 11561755 11561756 Human 597327201 GWAS1423275_H body mass index QTL GWAS1423275 (human) 2e-09 body mass index body mass index (BMI) (CMO:0000105) 3 11584990 11584991 Human
D3S3714
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 11,668,640 - 11,668,792 UniSTS GRCh37 Build 36 3 11,643,640 - 11,643,792 RGD NCBI36 Celera 3 11,603,945 - 11,604,097 RGD Cytogenetic Map 3 p25.3 UniSTS HuRef 3 11,602,119 - 11,602,271 UniSTS Marshfield Genetic Map 3 36.65 RGD Marshfield Genetic Map 3 36.65 UniSTS Genethon Genetic Map 3 30.4 UniSTS deCODE Assembly Map 3 30.16 UniSTS Whitehead-YAC Contig Map 3 UniSTS
D3S3680
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 11,726,147 - 11,726,272 UniSTS GRCh37 Build 36 3 11,701,147 - 11,701,272 RGD NCBI36 Celera 3 11,661,430 - 11,661,555 RGD Cytogenetic Map 3 p25.3 UniSTS HuRef 3 11,659,594 - 11,659,721 UniSTS Marshfield Genetic Map 3 36.1 RGD Marshfield Genetic Map 3 36.1 UniSTS Genethon Genetic Map 3 30.4 UniSTS deCODE Assembly Map 3 30.13 UniSTS Stanford-G3 RH Map 3 522.0 UniSTS Whitehead-YAC Contig Map 3 UniSTS NCBI RH Map 3 138.4 UniSTS GeneMap99-G3 RH Map 3 522.0 UniSTS
RH15949
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 11,597,593 - 11,597,730 UniSTS GRCh37 Build 36 3 11,572,593 - 11,572,730 RGD NCBI36 Celera 3 11,532,998 - 11,533,135 RGD Cytogenetic Map 3 p25.3 UniSTS HuRef 3 11,531,140 - 11,531,277 UniSTS GeneMap99-GB4 RH Map 3 50.67 UniSTS NCBI RH Map 3 166.8 UniSTS
SHGC-76714
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 11,738,901 - 11,739,043 UniSTS GRCh37 Build 36 3 11,713,901 - 11,714,043 RGD NCBI36 Celera 3 11,674,186 - 11,674,328 RGD Cytogenetic Map 3 p25.3 UniSTS HuRef 3 11,672,353 - 11,672,495 UniSTS GeneMap99-GB4 RH Map 3 52.69 UniSTS NCBI RH Map 3 162.3 UniSTS
RH25345
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 11,597,726 - 11,597,968 UniSTS GRCh37 Build 36 3 11,572,726 - 11,572,968 RGD NCBI36 Celera 3 11,533,131 - 11,533,373 RGD Cytogenetic Map 3 p25.3 UniSTS HuRef 3 11,531,273 - 11,531,515 UniSTS
SHGC-144750
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 11,603,851 - 11,604,172 UniSTS GRCh37 Build 36 3 11,578,851 - 11,579,172 RGD NCBI36 Celera 3 11,539,257 - 11,539,578 RGD Cytogenetic Map 3 p25.2 UniSTS Cytogenetic Map 3 p25.3 UniSTS HuRef 3 11,537,399 - 11,537,720 UniSTS TNG Radiation Hybrid Map 3 7007.0 UniSTS
SHGC-76706
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 11,598,868 - 11,598,998 UniSTS GRCh37 Build 36 3 11,573,868 - 11,573,998 RGD NCBI36 Celera 3 11,534,273 - 11,534,403 RGD Cytogenetic Map 3 p25.3 UniSTS HuRef 3 11,532,415 - 11,532,545 UniSTS TNG Radiation Hybrid Map 3 6990.0 UniSTS GeneMap99-GB4 RH Map 3 50.67 UniSTS NCBI RH Map 3 165.6 UniSTS
SHGC-76717
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 11,599,342 - 11,599,524 UniSTS GRCh37 Build 36 3 11,574,342 - 11,574,524 RGD NCBI36 Celera 3 11,534,747 - 11,534,929 RGD Cytogenetic Map 3 p25.3 UniSTS HuRef 3 11,532,889 - 11,533,071 UniSTS TNG Radiation Hybrid Map 3 7002.0 UniSTS GeneMap99-GB4 RH Map 3 52.79 UniSTS NCBI RH Map 3 132.9 UniSTS
RH36277
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 11,704,043 - 11,704,142 UniSTS GRCh37 Build 36 3 11,679,043 - 11,679,142 RGD NCBI36 Celera 3 11,639,328 - 11,639,427 RGD Cytogenetic Map 3 p25.3 UniSTS HuRef 3 11,637,494 - 11,637,593 UniSTS GeneMap99-GB4 RH Map 3 57.32 UniSTS NCBI RH Map 3 142.6 UniSTS
D3S3828
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 11,597,586 - 11,597,693 UniSTS GRCh37 Build 36 3 11,572,586 - 11,572,693 RGD NCBI36 Celera 3 11,532,991 - 11,533,098 RGD Cytogenetic Map 3 p25.3 UniSTS HuRef 3 11,531,133 - 11,531,240 UniSTS Whitehead-YAC Contig Map 3 UniSTS
RH48202
Human Assembly Chr Position (strand) Source JBrowse GRCh37 3 11,697,826 - 11,697,955 UniSTS GRCh37 Build 36 3 11,672,826 - 11,672,955 RGD NCBI36 Celera 3 11,633,109 - 11,633,238 RGD Cytogenetic Map 3 p25.3 UniSTS HuRef 3 11,631,275 - 11,631,404 UniSTS GeneMap99-GB4 RH Map 3 50.85 UniSTS NCBI RH Map 3 164.5 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2251
4971
1725
2351
5
622
1951
465
2269
7303
6469
53
3732
852
1744
1617
174
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000273038 ⟹ ENSP00000273038
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,556,070 - 11,720,746 (-) Ensembl
Ensembl Acc Id:
ENST00000413604 ⟹ ENSP00000404624
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,558,069 - 11,604,581 (-) Ensembl
Ensembl Acc Id:
ENST00000414047
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,720,456 - 11,724,979 (-) Ensembl
Ensembl Acc Id:
ENST00000417206 ⟹ ENSP00000391932
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,564,766 - 11,719,638 (-) Ensembl
Ensembl Acc Id:
ENST00000417466 ⟹ ENSP00000411670
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,564,848 - 11,719,619 (-) Ensembl
Ensembl Acc Id:
ENST00000418000 ⟹ ENSP00000394439
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,559,332 - 11,719,594 (-) Ensembl
Ensembl Acc Id:
ENST00000419541 ⟹ ENSP00000395557
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,564,892 - 11,710,537 (-) Ensembl
Ensembl Acc Id:
ENST00000424529 ⟹ ENSP00000402878
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,558,470 - 11,568,924 (-) Ensembl
Ensembl Acc Id:
ENST00000424709 ⟹ ENSP00000391554
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,564,852 - 11,612,667 (-) Ensembl
Ensembl Acc Id:
ENST00000426568 ⟹ ENSP00000413030
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,558,476 - 11,720,722 (-) Ensembl
Ensembl Acc Id:
ENST00000430365 ⟹ ENSP00000404251
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,556,069 - 11,643,915 (-) Ensembl
Ensembl Acc Id:
ENST00000437722 ⟹ ENSP00000393100
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,564,915 - 11,610,504 (-) Ensembl
Ensembl Acc Id:
ENST00000445411 ⟹ ENSP00000412923
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,558,758 - 11,720,729 (-) Ensembl
Ensembl Acc Id:
ENST00000451674 ⟹ ENSP00000416615
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,558,343 - 11,582,391 (-) Ensembl
Ensembl Acc Id:
ENST00000458499 ⟹ ENSP00000394123
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,559,351 - 11,627,406 (-) Ensembl
Ensembl Acc Id:
ENST00000463387
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,699,546 - 11,720,460 (-) Ensembl
Ensembl Acc Id:
ENST00000480288
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,601,992 - 11,633,671 (-) Ensembl
Ensembl Acc Id:
ENST00000623028 ⟹ ENSP00000485472
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,601,910 - 11,771,350 (-) Ensembl
Ensembl Acc Id:
ENST00000638314 ⟹ ENSP00000492281
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 3 11,702,696 - 11,703,034 (-) Ensembl
RefSeq Acc Id:
NM_001128219 ⟹ NP_001121691
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,069 - 11,643,915 (-) NCBI GRCh37 3 11,597,543 - 11,762,220 (-) NCBI Celera 3 11,532,949 - 11,697,489 (-) RGD HuRef 3 11,531,088 - 11,695,689 (-) NCBI CHM1_1 3 11,547,668 - 11,634,617 (-) NCBI T2T-CHM13v2.0 3 11,551,373 - 11,639,661 (-) NCBI
Sequence:
ATAGCCCTCATGTCAGCGCTGCCGGCTTGCAGCGGGCTGTGAGAGGGGCCGGCGCCGCTTTGTCCTAGGAAACGGGCTGCGCGTTTCTCTTTTTCACTCTTTTCCATTTCCAGGAAGGACTTGTAAGG
hide sequence
RefSeq Acc Id:
NM_001128220 ⟹ NP_001121692
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,069 - 11,582,356 (-) NCBI GRCh37 3 11,597,543 - 11,762,220 (-) NCBI Celera 3 11,532,949 - 11,697,489 (-) RGD HuRef 3 11,531,088 - 11,695,689 (-) NCBI CHM1_1 3 11,547,668 - 11,573,975 (-) NCBI T2T-CHM13v2.0 3 11,551,373 - 11,577,605 (-) NCBI
Sequence:
GTGAGGCCCAAGGCTTTCTTGTGGGAGGACGCTGGGCTGTCTTCATGCTCTTTGGCAATGATTA
hide sequence
RefSeq Acc Id:
NM_001128221 ⟹ NP_001121693
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,069 - 11,568,798 (-) NCBI GRCh37 3 11,597,543 - 11,762,220 (-) NCBI Celera 3 11,532,949 - 11,697,489 (-) RGD HuRef 3 11,531,088 - 11,695,689 (-) NCBI CHM1_1 3 11,547,668 - 11,560,526 (-) NCBI T2T-CHM13v2.0 3 11,551,373 - 11,564,104 (-) NCBI
Sequence:
CTCTCGGGCACAGTCCTGACCAGGAGCGGAGGCGACTTCCATCTCCCGGGCAGGATGCGTGCGG
hide sequence
RefSeq Acc Id:
NM_001284390 ⟹ NP_001271319
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,069 - 11,720,539 (-) NCBI HuRef 3 11,531,088 - 11,695,689 (-) NCBI CHM1_1 3 11,547,668 - 11,712,241 (-) NCBI T2T-CHM13v2.0 3 11,551,373 - 11,716,266 (-) NCBI
Sequence:
GCGAGTGTGAAGTGCAGCGCTGGAGTGCAACATGCTGTAATGGGAGGAAACCCAGCGGCGTCGG
hide sequence
RefSeq Acc Id:
NM_001284391 ⟹ NP_001271320
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,067 - 11,604,581 (-) NCBI HuRef 3 11,531,088 - 11,695,689 (-) NCBI CHM1_1 3 11,547,668 - 11,599,132 (-) NCBI T2T-CHM13v2.0 3 11,551,371 - 11,600,403 (-) NCBI
Sequence:
AATTTTAACCCCACCACACATACAACAGTTACCACTCTTGTCTAACATACAAGTGTTGGGTTAA
hide sequence
RefSeq Acc Id:
NM_014667 ⟹ NP_055482
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,069 - 11,720,539 (-) NCBI GRCh37 3 11,597,543 - 11,762,220 (-) NCBI Build 36 3 11,572,544 - 11,737,037 (-) NCBI Archive Celera 3 11,532,949 - 11,697,489 (-) RGD HuRef 3 11,531,088 - 11,695,689 (-) NCBI CHM1_1 3 11,547,668 - 11,712,241 (-) NCBI T2T-CHM13v2.0 3 11,551,373 - 11,716,266 (-) NCBI
Sequence:
GCGAGTGTGAAGTGCAGCGCTGGAGTGCAACATGCTGTAATGGGAGGAAACCCAGCGGCGTCGG
hide sequence
RefSeq Acc Id:
XM_011534269 ⟹ XP_011532571
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,067 - 11,610,370 (-) NCBI
Sequence:
ATAGTATGAGAGGTGCTTTGTGTTGCCACCCAAGGGCTGGGGGATTGCAGGCGATCCTTGCGCTTGGGCAGACAGCACGTCACGGCTTTTATCTGCCGGCTCGCATTGCAATGGGCGTCCTATAAAAA
hide sequence
RefSeq Acc Id:
XM_024453835 ⟹ XP_024309603
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,067 - 11,719,529 (-) NCBI
Sequence:
CGTGCGTGTGCGTGTGCGTGTTTGGCGGGGGCCCGTGCGGGGGCTCGGGCGCGAGCCCGCCTGTGCGTCTGCGCGCCCTCGGGGTGCGCCCCGCGTGCCCAGGTCCCGTCCCCGCCCCTGGGTCCCCC
hide sequence
RefSeq Acc Id:
XM_024453836 ⟹ XP_024309604
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,067 - 11,710,814 (-) NCBI
Sequence:
TTCTTGATGGCCAAGAAGTACACCCCATGCCATGGTGTGATAGTTCATACTTTTGGGTTTGTCCTACCATTGTATATTATTAGCTGAAACCAAATTGGTTTTAGCTCAGGGAGTGGTCCTGGGGAGGC
hide sequence
RefSeq Acc Id:
XM_024453837 ⟹ XP_024309605
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,069 - 11,719,529 (-) NCBI
Sequence:
CTCGGGCGCGAGCCCGCCTGTGCGTCTGCGCGCCCTCGGGGTGCGCCCCGCGTGCCCAGGTCCC
hide sequence
RefSeq Acc Id:
XM_047449259 ⟹ XP_047305215
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,067 - 11,721,815 (-) NCBI
RefSeq Acc Id:
XM_047449260 ⟹ XP_047305216
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,067 - 11,702,998 (-) NCBI
RefSeq Acc Id:
XM_047449261 ⟹ XP_047305217
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,067 - 11,633,421 (-) NCBI
RefSeq Acc Id:
XM_047449262 ⟹ XP_047305218
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,069 - 11,721,815 (-) NCBI
RefSeq Acc Id:
XM_047449263 ⟹ XP_047305219
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 3 11,556,069 - 11,643,915 (-) NCBI
RefSeq Acc Id:
XM_054348499 ⟹ XP_054204474
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 11,551,371 - 11,717,542 (-) NCBI
RefSeq Acc Id:
XM_054348500 ⟹ XP_054204475
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 11,551,371 - 11,698,729 (-) NCBI
RefSeq Acc Id:
XM_054348501 ⟹ XP_054204476
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 11,551,371 - 11,715,394 (-) NCBI
RefSeq Acc Id:
XM_054348502 ⟹ XP_054204477
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 11,551,371 - 11,706,534 (-) NCBI
RefSeq Acc Id:
XM_054348503 ⟹ XP_054204478
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 11,551,371 - 11,629,168 (-) NCBI
RefSeq Acc Id:
XM_054348504 ⟹ XP_054204479
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 11,551,373 - 11,717,542 (-) NCBI
RefSeq Acc Id:
XM_054348505 ⟹ XP_054204480
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 11,551,373 - 11,639,661 (-) NCBI
RefSeq Acc Id:
XM_054348506 ⟹ XP_054204481
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 11,551,373 - 11,715,275 (-) NCBI
RefSeq Acc Id:
XM_054348507 ⟹ XP_054204482
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 3 11,551,371 - 11,606,131 (-) NCBI
RefSeq Acc Id:
NP_055482 ⟸ NM_014667
- Peptide Label:
isoform b
- UniProtKB:
Q9BQ78 (UniProtKB/Swiss-Prot), Q7L5V0 (UniProtKB/Swiss-Prot), Q14135 (UniProtKB/Swiss-Prot), J3KN68 (UniProtKB/Swiss-Prot), G5E9M7 (UniProtKB/Swiss-Prot), B4DTS7 (UniProtKB/Swiss-Prot), A0A075B6E4 (UniProtKB/TrEMBL)
- Sequence:
METPLDVLSRAASLVHADDEKREAALRGEPRIQTLPVASALSSHRTGPPPISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLG
hide sequence
RefSeq Acc Id:
NP_001121691 ⟸ NM_001128219
- Peptide Label:
isoform a
- Sequence:
MLFMKMDLLNYQYLDKMNNNIGILCYEGEAALRGEPRIQTLPVASALSSHRTGPPPISPSKRKF
hide sequence
RefSeq Acc Id:
NP_001121692 ⟸ NM_001128220
- Peptide Label:
isoform c
- UniProtKB:
Q0H0I7 (UniProtKB/TrEMBL)
- Sequence:
MIKVRNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSLDASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPV
hide sequence
RefSeq Acc Id:
NP_001121693 ⟸ NM_001128221
- Peptide Label:
isoform d
- UniProtKB:
Q0H0I7 (UniProtKB/TrEMBL)
- Sequence:
MNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSLDASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVEEH
hide sequence
RefSeq Acc Id:
NP_001271319 ⟸ NM_001284390
- Peptide Label:
isoform e
- UniProtKB:
A0A0A6YYI5 (UniProtKB/TrEMBL)
- Sequence:
MTENTHFDKIPESCALKSWRHPGLHHGEAALRGEPRIQTLPVASALSSHRTGPPPISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTS
hide sequence
RefSeq Acc Id:
NP_001271320 ⟸ NM_001284391
- Peptide Label:
isoform f
- UniProtKB:
G5E9M9 (UniProtKB/TrEMBL), A0A024R2F0 (UniProtKB/TrEMBL), A0A9K3Y712 (UniProtKB/TrEMBL), Q0H0I7 (UniProtKB/TrEMBL)
- Sequence:
MEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTS
hide sequence
RefSeq Acc Id:
XP_011532571 ⟸ XM_011534269
- Peptide Label:
isoform X4
- UniProtKB:
G5E9M9 (UniProtKB/TrEMBL), A0A024R2F0 (UniProtKB/TrEMBL), A0A9K3Y712 (UniProtKB/TrEMBL), Q0H0I7 (UniProtKB/TrEMBL)
- Sequence:
MEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTS
hide sequence
RefSeq Acc Id:
XP_024309603 ⟸ XM_024453835
- Peptide Label:
isoform X3
- UniProtKB:
Q9BQ78 (UniProtKB/Swiss-Prot), Q7L5V0 (UniProtKB/Swiss-Prot), Q14135 (UniProtKB/Swiss-Prot), J3KN68 (UniProtKB/Swiss-Prot), G5E9M7 (UniProtKB/Swiss-Prot), B4DTS7 (UniProtKB/Swiss-Prot), A0A075B6E4 (UniProtKB/TrEMBL)
- Sequence:
METPLDVLSRAASLVHADDEKREAALRGEPRIQTLPVASALSSHRTGPPPISPSKRKFSMEPGD
hide sequence
RefSeq Acc Id:
XP_024309605 ⟸ XM_024453837
- Peptide Label:
isoform X7
- UniProtKB:
E7EQU6 (UniProtKB/TrEMBL)
- Sequence:
METPLDVLSRAASLVHADDEKREAALRGEPRIQTLPVASALSSHRTGPPPISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLG
hide sequence
RefSeq Acc Id:
XP_024309604 ⟸ XM_024453836
- Peptide Label:
isoform X3
- UniProtKB:
Q9BQ78 (UniProtKB/Swiss-Prot), Q7L5V0 (UniProtKB/Swiss-Prot), Q14135 (UniProtKB/Swiss-Prot), J3KN68 (UniProtKB/Swiss-Prot), G5E9M7 (UniProtKB/Swiss-Prot), B4DTS7 (UniProtKB/Swiss-Prot), A0A075B6E4 (UniProtKB/TrEMBL)
- Sequence:
METPLDVLSRAASLVHADDEKREAALRGEPRIQTLPVASALSSHRTGPPPISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLG
hide sequence
Ensembl Acc Id:
ENSP00000393100 ⟸ ENST00000437722
Ensembl Acc Id:
ENSP00000402878 ⟸ ENST00000424529
Ensembl Acc Id:
ENSP00000391554 ⟸ ENST00000424709
Ensembl Acc Id:
ENSP00000413030 ⟸ ENST00000426568
Ensembl Acc Id:
ENSP00000416615 ⟸ ENST00000451674
Ensembl Acc Id:
ENSP00000485472 ⟸ ENST00000623028
Ensembl Acc Id:
ENSP00000404624 ⟸ ENST00000413604
Ensembl Acc Id:
ENSP00000492281 ⟸ ENST00000638314
Ensembl Acc Id:
ENSP00000411670 ⟸ ENST00000417466
Ensembl Acc Id:
ENSP00000391932 ⟸ ENST00000417206
Ensembl Acc Id:
ENSP00000394439 ⟸ ENST00000418000
Ensembl Acc Id:
ENSP00000395557 ⟸ ENST00000419541
Ensembl Acc Id:
ENSP00000394123 ⟸ ENST00000458499
Ensembl Acc Id:
ENSP00000273038 ⟸ ENST00000273038
Ensembl Acc Id:
ENSP00000404251 ⟸ ENST00000430365
Ensembl Acc Id:
ENSP00000412923 ⟸ ENST00000445411
RefSeq Acc Id:
XP_047305215 ⟸ XM_047449259
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_047305216 ⟸ XM_047449260
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_047305217 ⟸ XM_047449261
- Peptide Label:
isoform X4
- UniProtKB:
A0A024R2F0 (UniProtKB/TrEMBL), A0A9K3Y712 (UniProtKB/TrEMBL), G5E9M9 (UniProtKB/TrEMBL), Q0H0I7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047305218 ⟸ XM_047449262
- Peptide Label:
isoform X5
- UniProtKB:
E7EQU6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047305219 ⟸ XM_047449263
- Peptide Label:
isoform X6
- UniProtKB:
E7ERW0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054204474 ⟸ XM_054348499
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_054204476 ⟸ XM_054348501
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_054204477 ⟸ XM_054348502
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_054204475 ⟸ XM_054348500
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_054204478 ⟸ XM_054348503
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_054204482 ⟸ XM_054348507
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_054204479 ⟸ XM_054348504
- Peptide Label:
isoform X5
- UniProtKB:
E7EQU6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054204481 ⟸ XM_054348506
- Peptide Label:
isoform X7
- UniProtKB:
E7EQU6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054204480 ⟸ XM_054348505
- Peptide Label:
isoform X6
- UniProtKB:
E7ERW0 (UniProtKB/TrEMBL)
RGD ID: 6863590 Promoter ID: EPDNEW_H4960 Type: initiation region Name: VGLL4_1 Description: vestigial like family member 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H4961 EPDNEW_H4962 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 3 11,582,356 - 11,582,416 EPDNEW
RGD ID: 6801930 Promoter ID: HG_KWN:43750 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, Lymphoblastoid Transcripts: NM_001128221, OTTHUMT00000339146 Position: Human Assembly Chr Position (strand) Source Build 36 3 11,584,961 - 11,586,012 (-) MPROMDB
RGD ID: 6801927 Promoter ID: HG_KWN:43751 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lymphoblastoid Transcripts: OTTHUMT00000339140 Position: Human Assembly Chr Position (strand) Source Build 36 3 11,598,421 - 11,598,921 (-) MPROMDB
RGD ID: 6812445 Promoter ID: HG_ACW:52861 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562, Lymphoblastoid Transcripts: VGLL4.LAPR07 Position: Human Assembly Chr Position (strand) Source Build 36 3 11,618,156 - 11,618,656 (-) MPROMDB
RGD ID: 6801926 Promoter ID: HG_KWN:43752 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lymphoblastoid Transcripts: OTTHUMT00000339139 Position: Human Assembly Chr Position (strand) Source Build 36 3 11,620,466 - 11,620,966 (-) MPROMDB
RGD ID: 6801924 Promoter ID: HG_KWN:43757 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: NM_001128219 Position: Human Assembly Chr Position (strand) Source Build 36 3 11,660,099 - 11,660,599 (-) MPROMDB
RGD ID: 6863592 Promoter ID: EPDNEW_H4961 Type: initiation region Name: VGLL4_3 Description: vestigial like family member 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H4960 EPDNEW_H4962 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 3 11,720,539 - 11,720,599 EPDNEW
RGD ID: 6863594 Promoter ID: EPDNEW_H4962 Type: initiation region Name: VGLL4_2 Description: vestigial like family member 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H4960 EPDNEW_H4961 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 3 11,720,746 - 11,720,806 EPDNEW
RGD ID: 6801931 Promoter ID: HG_KWN:43759 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_2Hour, HeLa_S3, Lymphoblastoid Transcripts: OTTHUMT00000339231, OTTHUMT00000339232, OTTHUMT00000339233 Position: Human Assembly Chr Position (strand) Source Build 36 3 11,735,906 - 11,736,502 (-) MPROMDB
RGD ID: 6801929 Promoter ID: HG_KWN:43761 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, HeLa_S3, K562, Lymphoblastoid, NB4 Transcripts: NM_014667, OTTHUMT00000339147, OTTHUMT00000339230, UC003BWG.2 Position: Human Assembly Chr Position (strand) Source Build 36 3 11,736,844 - 11,737,344 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-01
VGLL4
vestigial like family member 4
vestigial-like family member 4
Symbol and/or name change
5135510 APPROVED
2014-03-05
VGLL4
vestigial-like family member 4
vestigial like 4 (Drosophila)
Symbol and/or name change
5135510 APPROVED
