Symbol:
Pycr2
Name:
pyrroline-5-carboxylate reductase family, member 2
RGD ID:
1320769
MGI Page
MGI
Description:
Predicted to enable pyrroline-5-carboxylate reductase activity. Predicted to be involved in L-proline biosynthetic process and cellular response to oxidative stress. Predicted to be located in mitochondrion. Is expressed in several structures, including alimentary system; brain; respiratory system; sensory organ; and skeleton. Human ortholog(s) of this gene implicated in hypomyelinating leukodystrophy 10. Orthologous to human PYCR2 (pyrroline-5-carboxylate reductase 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1810018M05Rik; lefty-2; lefty2; P5c; P5C reductase 2; P5CR 2; P5cr2; pyrroline-5-carboxylate reductase 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 180,731,839 - 180,735,653 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 180,731,858 - 180,735,653 (+) Ensembl GRCm39 Ensembl GRCm38 1 180,904,274 - 180,908,088 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 180,904,293 - 180,908,088 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 182,834,405 - 182,838,219 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 182,740,984 - 182,744,763 (+) NCBI MGSCv36 mm8 Celera 1 187,967,388 - 187,971,204 (+) NCBI Celera Cytogenetic Map 1 H4 NCBI cM Map 1 84.46 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pycr2 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of PYCR2 mRNA CTD PMID:22206623 Pycr2 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of PYCR2 mRNA] CTD PMID:22206623 Pycr2 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of PYCR2 mRNA CTD PMID:17555576 Pycr2 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PYCR2 mRNA CTD PMID:17942748 Pycr2 Mouse 17beta-estradiol increases expression ISO RGD:1310074 6480464 Estradiol results in increased expression of PYCR2 mRNA CTD PMID:32145629 Pycr2 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PYCR2 mRNA CTD PMID:39298647 Pycr2 Mouse 2,2',4,4'-Tetrabromodiphenyl ether affects expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of PYCR2 mRNA CTD PMID:30294300 Pycr2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PYCR2 mRNA CTD PMID:21354282 Pycr2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PYCR2 mRNA CTD PMID:17942748|PMID:27562557 Pycr2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PYCR2 mRNA CTD PMID:21570461 Pycr2 Mouse 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4,4'-diaminodiphenylmethane results in increased expression of PYCR2 mRNA CTD PMID:18648102 Pycr2 Mouse 4,4'-sulfonyldiphenol increases expression ISO RGD:1320768 6480464 bisphenol S results in increased expression of PYCR2 protein CTD PMID:34186270 Pycr2 Mouse acetamide increases expression ISO RGD:1310074 6480464 acetamide results in increased expression of PYCR2 mRNA CTD PMID:31881176 Pycr2 Mouse acrolein multiple interactions ISO RGD:1320768 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Pycr2 Mouse alpha-pinene multiple interactions ISO RGD:1320768 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Pycr2 Mouse benzo[a]pyrene decreases methylation ISO RGD:1320768 6480464 Benzo(a)pyrene results in decreased methylation of PYCR2 3' UTR CTD PMID:27901495 Pycr2 Mouse benzo[a]pyrene affects methylation ISO RGD:1320768 6480464 Benzo(a)pyrene affects the methylation of PYCR2 promoter CTD PMID:27901495 Pycr2 Mouse beta-lapachone increases expression ISO RGD:1320768 6480464 beta-lapachone results in increased expression of PYCR2 mRNA CTD PMID:38218311 Pycr2 Mouse bisphenol A decreases expression ISO RGD:1320768 6480464 bisphenol A results in decreased expression of PYCR2 mRNA CTD PMID:25047013 Pycr2 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PYCR2 mRNA CTD PMID:32156529 Pycr2 Mouse bisphenol A increases expression ISO RGD:1320768 6480464 bisphenol A results in increased expression of PYCR2 protein CTD PMID:34186270 Pycr2 Mouse bisphenol A increases expression ISO RGD:1310074 6480464 bisphenol A results in increased expression of PYCR2 mRNA CTD PMID:25181051|PMID:32145629|PMID:34947998 Pycr2 Mouse bisphenol AF increases expression ISO RGD:1320768 6480464 bisphenol AF results in increased expression of PYCR2 protein CTD PMID:34186270 Pycr2 Mouse C60 fullerene decreases expression ISO RGD:1310074 6480464 fullerene C60 results in decreased expression of PYCR2 mRNA CTD PMID:19167457 Pycr2 Mouse cadmium dichloride decreases expression ISO RGD:1320768 6480464 Cadmium Chloride results in decreased expression of PYCR2 mRNA CTD PMID:38568856 Pycr2 Mouse caffeine decreases phosphorylation ISO RGD:1320768 6480464 Caffeine results in decreased phosphorylation of PYCR2 protein CTD PMID:35688186 Pycr2 Mouse carbon nanotube affects expression EXP 6480464 Nanotubes, Carbon affects the expression of PYCR2 mRNA CTD PMID:31978390 Pycr2 Mouse CGP 52608 multiple interactions ISO RGD:1320768 6480464 CGP 52608 promotes the reaction [RORA protein binds to PYCR2 gene] CTD PMID:28238834 Pycr2 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of PYCR2 mRNA CTD PMID:37019170 Pycr2 Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of PYCR2 mRNA CTD PMID:28472532 Pycr2 Mouse ciguatoxin CTX1B affects expression EXP 6480464 Ciguatoxins affects the expression of PYCR2 mRNA CTD PMID:18353800 Pycr2 Mouse clobetasol increases expression EXP 6480464 Clobetasol results in increased expression of PYCR2 mRNA CTD PMID:27462272 Pycr2 Mouse Dibutyl phosphate affects expression ISO RGD:1320768 6480464 di-n-butylphosphoric acid affects the expression of PYCR2 mRNA CTD PMID:37042841 Pycr2 Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PYCR2 mRNA CTD PMID:21266533 Pycr2 Mouse dorsomorphin multiple interactions ISO RGD:1320768 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Pycr2 Mouse folic acid multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of PYCR2 mRNA] CTD PMID:22206623 Pycr2 Mouse FR900359 decreases phosphorylation ISO RGD:1320768 6480464 FR900359 results in decreased phosphorylation of PYCR2 protein CTD PMID:37730182 Pycr2 Mouse hydrogen peroxide multiple interactions ISO RGD:1320768 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of PYCR2 protein CTD PMID:18951874 Pycr2 Mouse hydrogen peroxide affects expression ISO RGD:1320768 6480464 Hydrogen Peroxide affects the expression of PYCR2 mRNA CTD PMID:21179406 Pycr2 Mouse indometacin increases expression ISO RGD:1310074 6480464 Indomethacin results in increased expression of PYCR2 mRNA CTD PMID:36868495 Pycr2 Mouse ivermectin decreases expression ISO RGD:1320768 6480464 Ivermectin results in decreased expression of PYCR2 protein CTD PMID:32959892 Pycr2 Mouse methotrexate decreases expression ISO RGD:1320768 6480464 Methotrexate results in decreased expression of PYCR2 mRNA CTD PMID:24449571 Pycr2 Mouse N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PYCR2 protein CTD PMID:26558463 Pycr2 Mouse nickel atom increases expression ISO RGD:1320768 6480464 Nickel results in increased expression of PYCR2 mRNA CTD PMID:25583101 Pycr2 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PYCR2 more ... CTD PMID:35964746 Pycr2 Mouse ozone multiple interactions ISO RGD:1320768 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Pycr2 Mouse p-chloromercuribenzoic acid decreases expression ISO RGD:1320768 6480464 p-Chloromercuribenzoic Acid results in decreased expression of PYCR2 mRNA CTD PMID:27188386 Pycr2 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of PYCR2 mRNA CTD PMID:17562736 Pycr2 Mouse perfluorooctanoic acid increases expression ISO RGD:1320768 6480464 perfluorooctanoic acid results in increased expression of PYCR2 protein CTD PMID:26879310 Pycr2 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PYCR2 mRNA CTD PMID:17950772 Pycr2 Mouse pirinixic acid multiple interactions EXP 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of PYCR2 mRNA] CTD PMID:17950772 Pycr2 Mouse quercetin increases expression ISO RGD:1320768 6480464 Quercetin results in increased expression of PYCR2 mRNA CTD PMID:21632981 Pycr2 Mouse resveratrol increases expression EXP 6480464 resveratrol results in increased expression of PYCR2 protein CTD PMID:25505154 Pycr2 Mouse rotenone increases expression EXP 6480464 Rotenone results in increased expression of PYCR2 mRNA CTD PMID:32937126 Pycr2 Mouse SB 431542 multiple interactions ISO RGD:1320768 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of PYCR2 more ... CTD PMID:27188386|PMID:37664457 Pycr2 Mouse Soman decreases expression ISO RGD:1310074 6480464 Soman results in decreased expression of PYCR2 mRNA CTD PMID:19281266 Pycr2 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of PYCR2 mRNA CTD PMID:17555576 Pycr2 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PYCR2 mRNA CTD PMID:31919559 Pycr2 Mouse theophylline multiple interactions ISO RGD:1320768 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of PYCR2 protein CTD PMID:18951874 Pycr2 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of PYCR2 gene CTD PMID:35295148 Pycr2 Mouse urethane decreases expression ISO RGD:1320768 6480464 Urethane results in decreased expression of PYCR2 mRNA CTD PMID:28818685 Pycr2 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of PYCR2 mRNA CTD PMID:17292431 Pycr2 Mouse valproic acid multiple interactions ISO RGD:1320768 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Pycr2 Mouse valproic acid decreases expression ISO RGD:1320768 6480464 Valproic Acid results in decreased expression of PYCR2 mRNA CTD PMID:23179753|PMID:26272509 Pycr2 Mouse valproic acid increases methylation ISO RGD:1320768 6480464 Valproic Acid results in increased methylation of PYCR2 gene CTD PMID:29154799 Pycr2 Mouse valproic acid affects expression ISO RGD:1320768 6480464 Valproic Acid affects the expression of PYCR2 mRNA CTD PMID:25979313 Pycr2 Mouse vinclozolin decreases expression ISO RGD:1310074 6480464 vinclozolin results in decreased expression of PYCR2 mRNA CTD PMID:23034163 Pycr2 Mouse zinc atom decreases expression ISO RGD:1320768 6480464 Zinc results in decreased expression of PYCR2 protein CTD PMID:15984569 Pycr2 Mouse zinc(0) decreases expression ISO RGD:1320768 6480464 Zinc results in decreased expression of PYCR2 protein CTD PMID:15984569
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) acetamide (ISO) acrolein (ISO) alpha-pinene (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) C60 fullerene (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (EXP) CGP 52608 (ISO) chlorpyrifos (EXP) chromium(6+) (EXP) ciguatoxin CTX1B (EXP) clobetasol (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dorsomorphin (ISO) folic acid (EXP) FR900359 (ISO) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) methotrexate (ISO) N-methyl-4-phenylpyridinium (EXP) nickel atom (ISO) nitrates (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (EXP) perfluorooctanoic acid (ISO) pirinixic acid (EXP) quercetin (ISO) resveratrol (EXP) rotenone (EXP) SB 431542 (ISO) Soman (ISO) tamoxifen (EXP) tetrachloromethane (EXP) theophylline (ISO) titanium dioxide (EXP) urethane (ISO) valproic acid (EXP,ISO) vinclozolin (ISO) zinc atom (ISO) zinc(0) (ISO)
Pycr2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 180,731,839 - 180,735,653 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 180,731,858 - 180,735,653 (+) Ensembl GRCm39 Ensembl GRCm38 1 180,904,274 - 180,908,088 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 180,904,293 - 180,908,088 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 182,834,405 - 182,838,219 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 182,740,984 - 182,744,763 (+) NCBI MGSCv36 mm8 Celera 1 187,967,388 - 187,971,204 (+) NCBI Celera Cytogenetic Map 1 H4 NCBI cM Map 1 84.46 NCBI
PYCR2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 225,919,878 - 225,924,250 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 225,919,877 - 225,924,340 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 226,107,578 - 226,111,950 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 224,174,203 - 224,178,588 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 222,414,315 - 222,418,700 NCBI Celera 1 199,298,629 - 199,303,014 (-) NCBI Celera Cytogenetic Map 1 q42.12 NCBI HuRef 1 196,625,292 - 196,629,755 (-) NCBI HuRef CHM1_1 1 227,379,901 - 227,384,364 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 225,107,658 - 225,112,030 (-) NCBI T2T-CHM13v2.0
Pycr2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 95,158,236 - 95,162,030 (+) NCBI GRCr8 mRatBN7.2 13 92,626,462 - 92,630,256 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 92,626,471 - 92,634,184 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 95,131,781 - 95,135,575 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 96,531,710 - 96,535,504 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 93,706,406 - 93,710,200 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 99,184,624 - 99,188,418 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 99,184,564 - 99,188,431 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 104,182,905 - 104,186,734 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 96,633,455 - 96,637,249 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 96,822,390 - 96,826,184 (+) NCBI Celera 13 92,171,198 - 92,174,992 (+) NCBI Celera Cytogenetic Map 13 q26 NCBI
Pycr2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955489 138,600 - 143,112 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955489 138,600 - 143,112 (-) NCBI ChiLan1.0 ChiLan1.0
PYCR2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 23,612,831 - 23,617,694 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 23,561,603 - 23,566,049 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 201,381,270 - 201,385,703 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 206,381,539 - 206,386,002 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 206,381,539 - 206,386,002 (-) Ensembl panpan1.1 panPan2
PYCR2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 38,902,705 - 38,905,924 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 38,384,909 - 38,388,130 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 38,736,696 - 38,739,925 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 38,736,694 - 38,739,920 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 38,576,503 - 38,579,717 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 38,584,643 - 38,587,863 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 38,854,425 - 38,857,653 (+) NCBI UU_Cfam_GSD_1.0
Pycr2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 52,020,591 - 52,025,713 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936526 2,720,521 - 2,726,762 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936526 2,721,579 - 2,726,699 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PYCR2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 13,838,085 - 13,845,894 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 13,841,755 - 13,845,900 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 15,943,366 - 15,947,506 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PYCR2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 3,846,518 - 3,850,976 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 3,846,501 - 3,851,856 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 3,852,944 - 3,857,403 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pycr2
.
Predicted Target Of
Count of predictions: 205 Count of miRNA genes: 163 Interacting mature miRNAs: 180 Transcripts: ENSMUST00000027802 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 4141244 Bmd5c_m bone mineral density 5c (mouse) Not determined 155526796 189526897 Mouse 1558802 Skmw6_m skeletal muscle weight 6 (mouse) Not determined 1 167954584 195154279 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 13464138 Hdlq107_m HDL QTL 107 (mouse) 1 152132744 186132744 Mouse 1301652 Cpfd2_m cerebellum pattern fissures (mouse) Not determined 1 172303451 195154279 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 4142389 Scfr1_m stem cell frequency regulator 1 (mouse) Not determined 171632048 189303617 Mouse 12790984 Pcho7_m plasma cholesterol 7 (mouse) 1 147219390 181219390 Mouse 1300888 Berr1_m berghei resistance locus 1 (mouse) Not determined 1 164143227 190534272 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 1301251 Scc3_m colon tumor susceptibility 3 (mouse) Not determined 1 168213823 195154279 Mouse 14700784 Syncq4_m synovial calcification QTL 4 (mouse) 1 180673565 182085565 Mouse 1301122 Cd8mts1_m CD8 T memory cell subset 1 (mouse) Not determined 1 155831765 189831892 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 4141483 Femwf7_m femur work to failure 7 (mouse) Not determined 167462514 195154279 Mouse 1302023 Orch4_m autoimmune orchitis resistance 4 (mouse) Not determined 1 175211318 195154279 Mouse 1301385 Radpf2_m radiation pulmonary fibrosis 2 (mouse) Not determined 1 147125258 182873798 Mouse 12791001 Aath6_m aortic arch atherosclerosis 6 (mouse) 1 147219390 181219390 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 4141346 Skmw12_m skeletal muscle weight 12 (mouse) Not determined 150756737 184756922 Mouse 1301134 Bmd1_m bone mineral density 1 (mouse) Not determined 1 156602037 189303617 Mouse 1302158 Fembrs5_m femur breaking strength 5 (mouse) Not determined 1 167462514 195154279 Mouse 1301132 Mors1_m modifier of obesity related sterility 1 (mouse) Not determined 1 170379500 195154279 Mouse 1357493 Lgaq3_m late growth adjusted QTL 3 (mouse) Not determined 1 150193673 188359312 Mouse 11251722 Ewc1_m ethanol withdrawal and consumption 1 (mouse) 1 152132744 186132744 Mouse 10043963 Obq25_m obesity QTL 25 (mouse) Not determined 1 154410512 188410512 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 1357618 Splq5_m spleen weight QTL 5 (mouse) Not determined 1 150193673 188359312 Mouse 1301301 Sle1_m systemic lupus erythmatosus susceptibility 1 (mouse) Not determined 1 152038741 186038913 Mouse 10045887 Cplaq13_m circadian period of locomotor activity 13 (mouse) Not determined 1 172831765 181400659 Mouse 12904936 Edlmmq1_m extensor digitorum longus muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 1301309 Emo1_m emotionality 1 (mouse) Not determined 1 162977097 185994196 Mouse 1357732 Tbbmd1_m total body bone mineral density 1 (mouse) Not determined 1 171983110 195154279 Mouse 1301025 Lbw7_m lupus NZB x NZW 7 (mouse) Not determined 1 152038741 186038913 Mouse 10412074 Nhdlt1_m non-HDL cholesterol and triglyceride levels 1 (mouse) Not determined 1 153675990 187676105 Mouse 12904944 Tammq1_m tibialis anterior muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1357485 Lgq4_m late growth QTL 4 (mouse) Not determined 1 150193673 188359312 Mouse 12904957 Gmmq1_m gastrocnemius muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1300777 Chol10_m cholesterol 10 (mouse) Not determined 9 147875502 181875616 Mouse 11532690 Sluc37_m susceptibility to lung cancer 37 (mouse) 1 175468817 194111528 Mouse 1301932 Ssta2_m susceptibility to Salmonella typhimurium antigens 2 (mouse) Not determined 1 155716221 189716369 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 10054490 Opefa_m open field activity (mouse) Not determined 1 153712853 187712853 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1301333 Mop3_m morphine preference 3 (mouse) Not determined 1 167756737 189303617 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301339 Hdlq15_m HDL QTL 15 (mouse) Not determined 1 165873675 195154279 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 4141554 Cfmq1_m cystic fibrosis modifier QTL 1 (mouse) Not determined 1 152038741 186038913 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 10043863 Swrl5_m SWR lupus locus 5 (mouse) Not determined 1 172303451 195154279 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 11049575 Lmr8b_m leishmaniasis resistance 8b (mouse) 1 172303451 195154279 Mouse 4141165 Bglu3_m blood glucose level 3 (mouse) Not determined 155831765 189831892 Mouse 12792983 Liq1_m limb inflammation QTL 1 (mouse) 1 167586086 191225397 Mouse 1357889 Lprq3_m lipoprotein QTL 3 (mouse) Not determined 1 152038741 186038913 Mouse 1301189 Lmr8_m leishmaniasis resistance 8 (mouse) Not determined 1 156602037 189303617 Mouse 4142182 Shali5_m survival time to hyperoxic acute lung injury 5 (mouse) Not determined 155582237 185994196 Mouse 10766456 Sle21_m systematic lupus erythematosus susceptibility 21 (mouse) 1 155831765 189831892 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1301619 Cafq1_m caffeine metabolism QTL 1 (mouse) Not determined 1 155716221 189716369 Mouse 27095935 Ulnl5_m ulna length 5, 10 week (mouse) 1 128727737 181327565 Mouse 4141149 Hbnr4_m Heligmosomoides bakeri nematode resistance 4 (mouse) Not determined 147125258 188983224 Mouse 10043899 Hdlq99_m HDL QTL 99 (mouse) Not determined 1 147875502 181875616 Mouse 1300727 Mptp1_m MPTP sensitivity 1 (mouse) Not determined 1 171632048 192681050 Mouse 10054271 Nba9_m New Zealand Black autoimmunity 9 (mouse) Not determined 1 155525623 189527533 Mouse 11081167 Tir8_m trypanosome infection response 8 (mouse) 1 155716221 189716369 Mouse 10054270 Nba10_m New Zealand Black autoimmunity 10 (mouse) Not determined 1 152794822 186438620 Mouse 1302132 Pbw1_m pentobarbital withdrawal QTL 1 (mouse) Not determined 1 155831765 189831892 Mouse 1559024 Zit1_m zinc induced tolerance 1 (mouse) Not determined 1 167462514 195154279 Mouse 12880429 V25Dq1_m vitamin D inactive form serum level QTL 1 (mouse) 1 172632197 195154279 Mouse 4142291 Aec2_m autoimmune exocrinopathy 2 (mouse) Not determined 52457737 182250592 Mouse 12880426 V25Dq2_m vitamin D inactive form serum level QTL 2 (mouse) 1 172532197 195154279 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 4142159 Nba2_m New Zealand Black autoimmunity 2 (mouse) Not determined 151835111 185835280 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 1300960 Hpic2_m haloperidol induced catalepsy 2 (mouse) Not determined 1 175468817 181400659 Mouse 1301866 Cplaq3_m circadian period of locomotor activity 3 (mouse) Not determined 1 155721528 189722608 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse 26884448 Sklq1_m skull length QTL 1, 5 week (mouse) 1 75976637 181327565 Mouse 1300969 Sluc5_m susceptibility to lung cancer 5 (mouse) Not determined 1 151186243 185186402 Mouse 1301614 Cgnz1_m chronic glomerulonephritis in NZM 1 (mouse) Not determined 1 152038741 186038913 Mouse
D9Mit34.1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 13 D1 UniSTS Cytogenetic Map 1 C3 UniSTS Cytogenetic Map 2 C1.3 UniSTS Cytogenetic Map 19 D1 UniSTS Cytogenetic Map 9 F1 UniSTS Cytogenetic Map 1 F UniSTS Cytogenetic Map 7 D3 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 3 F2 UniSTS Cytogenetic Map 14 C3 UniSTS Cytogenetic Map 9 A3 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 11 E1 UniSTS Cytogenetic Map 2 H4 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 4 E2 UniSTS Cytogenetic Map 2 E5 UniSTS Cytogenetic Map 11 B4 UniSTS Cytogenetic Map 5 G3 UniSTS Cytogenetic Map X A5 UniSTS Cytogenetic Map 10 C1 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 6 F2 UniSTS Cytogenetic Map 1 C1.3 UniSTS Cytogenetic Map 16 B1 UniSTS Cytogenetic Map 12 C1 UniSTS Cytogenetic Map 7 E2 UniSTS Cytogenetic Map 9 F2 UniSTS Cytogenetic Map 5 F UniSTS Cytogenetic Map 2 H1 UniSTS Cytogenetic Map 2 E2 UniSTS Cytogenetic Map 15 F1 UniSTS Cytogenetic Map 15 E1 UniSTS Cytogenetic Map 3 G2 UniSTS Cytogenetic Map 6 F3 UniSTS Cytogenetic Map 13 B3 UniSTS Cytogenetic Map 12 F1 UniSTS Cytogenetic Map 1 E4 UniSTS Cytogenetic Map 1 E3 UniSTS Cytogenetic Map 5 E1 UniSTS Cytogenetic Map 7 F3 UniSTS Cytogenetic Map 16 B3 UniSTS Cytogenetic Map 14 D2 UniSTS Cytogenetic Map 19 C2 UniSTS Cytogenetic Map 19 D3 UniSTS Cytogenetic Map 1 H5 UniSTS Cytogenetic Map 1 D UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 11 C UniSTS Cytogenetic Map 10 B4 UniSTS Cytogenetic Map 6 G3 UniSTS Cytogenetic Map 7 A1 UniSTS Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 8 E1 UniSTS Cytogenetic Map 8 A2 UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 2 B UniSTS Cytogenetic Map 5 A3 UniSTS Cytogenetic Map 9 D UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 19 C3 UniSTS Cytogenetic Map 13 A2-A3 UniSTS Cytogenetic Map 4 C6 UniSTS Cytogenetic Map 17 D UniSTS Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 17 A3.3 UniSTS Cytogenetic Map 13 A1 UniSTS Cytogenetic Map 3 F2.1 UniSTS Cytogenetic Map 15 D3 UniSTS Cytogenetic Map 8 D2 UniSTS Cytogenetic Map 12 A3 UniSTS Cytogenetic Map 1 H2.1 UniSTS Cytogenetic Map 7 F5 UniSTS Cytogenetic Map 7 C UniSTS Cytogenetic Map 2 E1 UniSTS Cytogenetic Map 11 B2 UniSTS Cytogenetic Map 16 A3 UniSTS Cytogenetic Map 5 C3.3 UniSTS Cytogenetic Map 16 A1 UniSTS Cytogenetic Map 5 G1 UniSTS Cytogenetic Map 6 A2 UniSTS Cytogenetic Map 7 B1 UniSTS Cytogenetic Map 3 F2.2 UniSTS Cytogenetic Map 5 C3.1 UniSTS Cytogenetic Map 2 C3 UniSTS Cytogenetic Map 17 A3.2-A3.3 UniSTS Cytogenetic Map 6 E3 UniSTS Cytogenetic Map 11 B1.1 UniSTS Cytogenetic Map 1 H6 UniSTS Cytogenetic Map 2 C2 UniSTS Cytogenetic Map 19 C UniSTS Cytogenetic Map 17 E1.3 UniSTS Cytogenetic Map 5 A1 UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map 9 A5.2 UniSTS Cytogenetic Map 1 A1 UniSTS Cytogenetic Map 13 A5 UniSTS Cytogenetic Map X A1.1 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 3 A3 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 8 C UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map 10 C2 UniSTS Cytogenetic Map 5 G2 UniSTS Cytogenetic Map 5 B1 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 2 H3 UniSTS Cytogenetic Map 2 A1 UniSTS Cytogenetic Map 1 H1 UniSTS Cytogenetic Map 15 F3 UniSTS Cytogenetic Map 9 E1 UniSTS Cytogenetic Map 9 C UniSTS Cytogenetic Map 1 A2 UniSTS Cytogenetic Map 12 C3 UniSTS Cytogenetic Map 19 A UniSTS Cytogenetic Map 5 B2 UniSTS Cytogenetic Map 3 D UniSTS Cytogenetic Map 11 B1.3 UniSTS Cytogenetic Map 6 B1 UniSTS Cytogenetic Map X C-D UniSTS Cytogenetic Map 5 G1.3 UniSTS Cytogenetic Map 7 D1-E2 UniSTS Cytogenetic Map 11 A1 UniSTS Cytogenetic Map 13 B1 UniSTS Cytogenetic Map 1 H2.2 UniSTS Cytogenetic Map 8 C3 UniSTS Cytogenetic Map 11 D UniSTS Cytogenetic Map X A7.3 UniSTS Cytogenetic Map 16 C1.1 UniSTS Cytogenetic Map 15 F2 UniSTS Cytogenetic Map 9 A2 UniSTS Cytogenetic Map 1 H4-H6 UniSTS Cytogenetic Map 12 D2 UniSTS Cytogenetic Map 1 G3 UniSTS Cytogenetic Map 5 E5 UniSTS Cytogenetic Map 1 H3 UniSTS Cytogenetic Map 19 B UniSTS cM Map 9 50.0 UniSTS Whitehead Genetic 9 43.7 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000027802 ⟹ ENSMUSP00000027802
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 180,731,858 - 180,735,653 (+) Ensembl GRCm38.p6 Ensembl 1 180,904,293 - 180,908,088 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000194026
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 180,731,874 - 180,734,184 (+) Ensembl GRCm38.p6 Ensembl 1 180,904,309 - 180,906,619 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000194253
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 180,731,888 - 180,735,652 (+) Ensembl GRCm38.p6 Ensembl 1 180,904,323 - 180,908,087 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000195270
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 180,733,480 - 180,734,467 (+) Ensembl GRCm38.p6 Ensembl 1 180,905,915 - 180,906,902 (+) Ensembl
RefSeq Acc Id:
NM_133705 ⟹ NP_598466
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 180,731,839 - 180,735,653 (+) NCBI GRCm38 1 180,904,274 - 180,908,088 (+) ENTREZGENE MGSCv37 1 182,834,405 - 182,838,219 (+) RGD Celera 1 187,967,388 - 187,971,204 (+) RGD cM Map 1 ENTREZGENE
Sequence:
GTGGCCAACCGGAGGCTGCGTATTTGGCGGTGGATGCTCTGGGATACTTGGGGCCTCTCTAGCAGTTCATCTGGTGCATCCCGGTTTGAAAGCTGTTCCGAGCAATTCGGGTCCATCTTTTTCCACGC
hide sequence
RefSeq Acc Id:
NP_598466 ⟸ NM_133705
- UniProtKB:
Q922Q4 (UniProtKB/Swiss-Prot), Q3TJ21 (UniProtKB/TrEMBL), Q3TMZ1 (UniProtKB/TrEMBL)
- Sequence:
MSVGFIGAGQLACALARGFTAAGVLSAHKIIASSPDMDLPTVSALRRMGVNLTRSNKDTVRHSDVLFLAVKPHIIPFILDEIGADVQERHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVV
hide sequence
Ensembl Acc Id:
ENSMUSP00000027802 ⟸ ENSMUST00000027802
RGD ID: 6875936 Promoter ID: EPDNEW_M1419 Type: initiation region Name: Pycr2_1 Description: Mus musculus pyrroline-5-carboxylate reductase family, member2 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 180,904,293 - 180,904,353 EPDNEW
RGD ID: 6818341 Promoter ID: MM_KWN:3140 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: NM_133705_PYCR2 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 182,834,104 - 182,834,604 (+) MPROMDB
RGD ID: 6846642 Promoter ID: MM_ACW:3447 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: ES_Cell Transcripts: PYCR2.DSEP07 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 182,835,751 - 182,836,251 (+) MPROMDB
RGD ID: 6846643 Promoter ID: MM_ACW:3448 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, ES_Cell Transcripts: PYCR2.GSEP07-UNSPLICED Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 182,836,414 - 182,836,914 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-26
Pycr2
pyrroline-5-carboxylate reductase family, member 2
Leftb
left-right determination, factor B
Symbol and/or name updated
27372883 PROVISIONAL
2024-08-21
Leftb
left-right determination, factor B
Pycr2
pyrroline-5-carboxylate reductase family, member 2
Symbol and/or name change
5135510 APPROVED
2024-08-21
Pycr2
pyrroline-5-carboxylate reductase family, member 2
Leftb
left-right determination, factor B
Symbol and/or name change
5135510 APPROVED
2024-08-21
Leftb
left-right determination, factor B
Pycr2
pyrroline-5-carboxylate reductase family, member 2
Symbol and/or name change
5135510 APPROVED
