Symbol:
Sall1
Name:
spalt like transcription factor 1
RGD ID:
1320516
MGI Page
MGI
Description:
Enables several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; RNA polymerase II-specific DNA-binding transcription factor binding activity; and cis-regulatory region sequence-specific DNA binding activity. Involved in several processes, including negative regulation of ectoderm development; nephron epithelium morphogenesis; and nervous system development. Acts upstream of or within several processes, including kidney development; limb morphogenesis; and nervous system development. Located in heterochromatin and nucleus. Part of NuRD complex. Is expressed in several structures, including autopod; central nervous system; embryo mesenchyme; metanephros; and sensory organ. Used to study Townes-Brocks syndrome. Human ortholog(s) of this gene implicated in Townes-Brocks syndrome; middle lobe syndrome; and renal Wilms' tumor. Orthologous to human SALL1 (spalt like transcription factor 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Msa; Msal-3; sal-3; sal-like 1; sal-like 1 (Drosophila); sal-like protein 1; zinc finger protein Spalt-3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SALL1 (spalt like transcription factor 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Sall1 (spalt-like transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sall1 (spalt like transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SALL1 (spalt like transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SALL1 (spalt like transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sall1 (spalt like transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SALL1 (spalt like transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SALL1 (spalt like transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sall1 (spalt like transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SALL3 (spalt like transcription factor 3) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Sall1 (spalt-like transcription factor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SALL1 (spalt like transcription factor 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sall1a (spalt-like transcription factor 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
sall1b (spalt-like transcription factor 1b)
Alliance
DIOPT (OrthoFinder|PANTHER|ZFIN)
Caenorhabditis elegans (roundworm):
sem-4
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
salr
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
sall1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 89,753,867 - 89,770,790 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 89,753,863 - 89,770,790 (-) Ensembl GRCm39 Ensembl GRCm38 8 89,027,242 - 89,044,162 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 89,027,235 - 89,044,162 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 91,551,141 - 91,568,061 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 91,918,348 - 91,932,544 (-) NCBI MGSCv36 mm8 Celera 8 93,321,670 - 93,338,514 (-) NCBI Celera Cytogenetic Map 8 C3 NCBI cM Map 8 43.51 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sall1 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SALL1 mRNA CTD PMID:36331819 Sall1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SALL1 mRNA CTD PMID:22206623 Sall1 Mouse 17beta-estradiol increases expression ISO SALL1 (Homo sapiens) 6480464 Estradiol results in increased expression of SALL1 mRNA CTD PMID:23019147 Sall1 Mouse 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of SALL1 mRNA CTD PMID:39298647 Sall1 Mouse 17beta-estradiol increases expression ISO Sall1 (Rattus norvegicus) 6480464 Estradiol results in increased expression of SALL1 mRNA CTD PMID:32145629 Sall1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SALL1 mRNA CTD PMID:21570461 Sall1 Mouse 2,4-dinitrotoluene affects expression ISO Sall1 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of SALL1 mRNA CTD PMID:21346803 Sall1 Mouse 2,6-dinitrotoluene affects expression ISO Sall1 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of SALL1 mRNA CTD PMID:21346803 Sall1 Mouse 2-palmitoylglycerol increases expression ISO SALL1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of SALL1 mRNA CTD PMID:37199045 Sall1 Mouse 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of SALL1 mRNA CTD PMID:18648102 Sall1 Mouse 4,4'-sulfonyldiphenol affects expression EXP 6480464 bisphenol S affects the expression of SALL1 mRNA CTD PMID:39298647 Sall1 Mouse 4,4'-sulfonyldiphenol decreases methylation ISO SALL1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of SALL1 gene CTD PMID:31601247 Sall1 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of SALL1 mRNA CTD PMID:28973697 Sall1 Mouse 5-aza-2'-deoxycytidine increases expression ISO SALL1 (Homo sapiens) 6480464 Decitabine results in increased expression of SALL1 mRNA CTD PMID:27901495 Sall1 Mouse 6-propyl-2-thiouracil increases expression ISO Sall1 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of SALL1 mRNA CTD PMID:24780913 Sall1 Mouse 6-propyl-2-thiouracil decreases expression ISO Sall1 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of SALL1 mRNA CTD PMID:30047161 Sall1 Mouse acrylamide decreases expression ISO SALL1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of SALL1 mRNA CTD PMID:32763439 Sall1 Mouse aflatoxin B1 decreases methylation ISO SALL1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of SALL1 gene CTD PMID:27153756 Sall1 Mouse aflatoxin B1 decreases expression ISO SALL1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of SALL1 mRNA CTD PMID:27153756 Sall1 Mouse amitrole decreases expression ISO Sall1 (Rattus norvegicus) 6480464 Amitrole results in decreased expression of SALL1 mRNA CTD PMID:30047161 Sall1 Mouse aristolochic acid A decreases expression ISO SALL1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SALL1 mRNA CTD PMID:33212167 Sall1 Mouse arsenite(3-) increases methylation ISO SALL1 (Homo sapiens) 6480464 arsenite results in increased methylation of SALL1 promoter CTD PMID:23974009 Sall1 Mouse azathioprine decreases expression ISO SALL1 (Homo sapiens) 6480464 Azathioprine results in decreased expression of SALL1 mRNA CTD PMID:22623647 Sall1 Mouse benzo[a]pyrene decreases expression ISO SALL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SALL1 mRNA CTD PMID:27901495 Sall1 Mouse benzo[a]pyrene decreases methylation ISO SALL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SALL1 3' UTR CTD PMID:27901495 Sall1 Mouse benzo[a]pyrene increases methylation ISO SALL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SALL1 promoter CTD PMID:27901495 Sall1 Mouse benzo[a]pyrene diol epoxide I affects expression ISO SALL1 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Sall1 Mouse bis(2-ethylhexyl) phthalate decreases expression ISO SALL1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of SALL1 mRNA CTD PMID:31163220 Sall1 Mouse bisphenol A decreases expression ISO Sall1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of SALL1 mRNA CTD PMID:25181051 and PMID:34947998 Sall1 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SALL1 mRNA CTD PMID:32156529 Sall1 Mouse bisphenol A multiple interactions ISO SALL1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of SALL1 gene CTD PMID:31601247 Sall1 Mouse bisphenol A increases expression ISO Sall1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of SALL1 mRNA CTD PMID:32145629 and PMID:36779543 Sall1 Mouse bisphenol A affects methylation ISO SALL1 (Homo sapiens) 6480464 bisphenol A affects the methylation of SALL1 gene CTD PMID:33391824 Sall1 Mouse bisphenol A increases methylation ISO SALL1 (Homo sapiens) 6480464 bisphenol A results in increased methylation of SALL1 gene CTD PMID:28582417 Sall1 Mouse buspirone increases expression ISO Sall1 (Rattus norvegicus) 6480464 Buspirone results in increased expression of SALL1 mRNA CTD PMID:24136188 Sall1 Mouse cadmium dichloride decreases expression ISO Sall1 (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of SALL1 mRNA CTD PMID:33453195 Sall1 Mouse caffeine decreases phosphorylation ISO SALL1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of SALL1 protein CTD PMID:35688186 Sall1 Mouse carbamazepine affects expression ISO SALL1 (Homo sapiens) 6480464 Carbamazepine affects the expression of SALL1 mRNA CTD PMID:25979313 Sall1 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of SALL1 gene CTD PMID:20938992 Sall1 Mouse clobetasol decreases expression EXP 6480464 Clobetasol results in decreased expression of SALL1 mRNA CTD PMID:27462272 Sall1 Mouse copper atom increases expression ISO Sall1 (Rattus norvegicus) 6480464 Copper results in increased expression of SALL1 mRNA CTD PMID:30556269 Sall1 Mouse copper(0) increases expression ISO Sall1 (Rattus norvegicus) 6480464 Copper results in increased expression of SALL1 mRNA CTD PMID:30556269 Sall1 Mouse copper(II) sulfate decreases expression ISO SALL1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SALL1 mRNA CTD PMID:19549813 Sall1 Mouse cyclophosphamide affects response to substance ISO SALL1 (Homo sapiens) 6480464 SALL1 protein affects the susceptibility to Cyclophosphamide CTD PMID:16217747 Sall1 Mouse cyclosporin A decreases expression ISO SALL1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SALL1 mRNA CTD PMID:20106945 more ... Sall1 Mouse dichloromethane decreases expression EXP 6480464 Methylene Chloride results in decreased expression of SALL1 mRNA CTD PMID:28392392 Sall1 Mouse dicrotophos increases expression ISO SALL1 (Homo sapiens) 6480464 dicrotophos results in increased expression of SALL1 mRNA CTD PMID:28302478 Sall1 Mouse dieldrin decreases expression ISO Sall1 (Rattus norvegicus) 6480464 Dieldrin results in decreased expression of SALL1 mRNA CTD PMID:23153324 Sall1 Mouse dorsomorphin multiple interactions ISO SALL1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Sall1 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of SALL1 mRNA CTD PMID:30319688 Sall1 Mouse flutamide decreases expression ISO Sall1 (Rattus norvegicus) 6480464 Flutamide results in decreased expression of SALL1 mRNA CTD PMID:24793618 Sall1 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of SALL1 gene CTD PMID:20938992 Sall1 Mouse fonofos increases methylation ISO SALL1 (Homo sapiens) 6480464 Fonofos results in increased methylation of SALL1 promoter CTD PMID:22847954 Sall1 Mouse FR900359 increases phosphorylation ISO SALL1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of SALL1 protein CTD PMID:37730182 Sall1 Mouse fulvestrant multiple interactions ISO SALL1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of SALL1 gene CTD PMID:31601247 Sall1 Mouse furan increases expression ISO Sall1 (Rattus norvegicus) 6480464 furan results in increased expression of SALL1 mRNA CTD PMID:26194646 Sall1 Mouse genistein increases expression ISO SALL1 (Homo sapiens) 6480464 Genistein results in increased expression of SALL1 mRNA CTD PMID:23019147 Sall1 Mouse indometacin increases expression ISO SALL1 (Homo sapiens) 6480464 Indomethacin results in increased expression of SALL1 mRNA CTD PMID:16984733 Sall1 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SALL1 mRNA CTD PMID:36331819 Sall1 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of SALL1 gene CTD PMID:20938992 Sall1 Mouse lipopolysaccharide increases expression ISO SALL1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of SALL1 mRNA CTD PMID:35811015 Sall1 Mouse lipopolysaccharide multiple interactions ISO SALL1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of SALL1 mRNA] CTD PMID:35811015 Sall1 Mouse metformin increases expression ISO Sall1 (Rattus norvegicus) 6480464 Metformin results in increased expression of SALL1 mRNA CTD PMID:31324951 Sall1 Mouse methapyrilene decreases expression ISO Sall1 (Rattus norvegicus) 6480464 Methapyrilene results in decreased expression of SALL1 mRNA CTD PMID:30467583 Sall1 Mouse methimazole decreases expression ISO Sall1 (Rattus norvegicus) 6480464 Methimazole results in decreased expression of SALL1 mRNA CTD PMID:30047161 Sall1 Mouse methylmercury chloride increases expression ISO SALL1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SALL1 mRNA CTD PMID:23179753 and PMID:26272509 Sall1 Mouse methylmercury chloride multiple interactions ISO SALL1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SALL1 mRNA CTD PMID:27188386 Sall1 Mouse nefazodone increases expression ISO Sall1 (Rattus norvegicus) 6480464 nefazodone results in increased expression of SALL1 mRNA CTD PMID:24136188 Sall1 Mouse paracetamol decreases expression ISO SALL1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SALL1 mRNA CTD PMID:21420995 and PMID:29067470 Sall1 Mouse parathion increases methylation ISO SALL1 (Homo sapiens) 6480464 Parathion results in increased methylation of SALL1 promoter CTD PMID:22847954 Sall1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SALL1 mRNA more ... CTD PMID:36331819 Sall1 Mouse phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of SALL1 mRNA CTD PMID:23091169 Sall1 Mouse phenylmercury acetate decreases expression ISO SALL1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of SALL1 mRNA CTD PMID:26272509 Sall1 Mouse phenylmercury acetate multiple interactions ISO SALL1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SALL1 mRNA CTD PMID:27188386 Sall1 Mouse pregnenolone 16alpha-carbonitrile decreases expression ISO Sall1 (Rattus norvegicus) 6480464 Pregnenolone Carbonitrile results in decreased expression of SALL1 mRNA CTD PMID:30047161 Sall1 Mouse quercetin decreases expression ISO SALL1 (Homo sapiens) 6480464 Quercetin results in decreased expression of SALL1 mRNA CTD PMID:21632981 Sall1 Mouse raloxifene multiple interactions ISO SALL1 (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in decreased expression of SALL1 mRNA CTD PMID:19059307 Sall1 Mouse rotenone increases expression ISO SALL1 (Homo sapiens) 6480464 Rotenone results in increased expression of SALL1 mRNA CTD PMID:29955902 Sall1 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO SALL1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of SALL1 mRNA] CTD PMID:35811015 Sall1 Mouse SB 431542 multiple interactions ISO SALL1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Sall1 Mouse sodium arsenite decreases expression ISO SALL1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SALL1 mRNA CTD PMID:29301061 Sall1 Mouse sulfadimethoxine decreases expression ISO Sall1 (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of SALL1 mRNA CTD PMID:30047161 Sall1 Mouse tamoxifen affects expression ISO SALL1 (Homo sapiens) 6480464 Tamoxifen affects the expression of SALL1 mRNA CTD PMID:14699072 Sall1 Mouse tamoxifen decreases expression EXP 6480464 Tamoxifen results in decreased expression of SALL1 mRNA CTD PMID:20127799 Sall1 Mouse tamoxifen multiple interactions ISO SALL1 (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR2 protein] results in decreased expression of SALL1 mRNA CTD PMID:19059307 Sall1 Mouse terbufos increases methylation ISO SALL1 (Homo sapiens) 6480464 terbufos results in increased methylation of SALL1 promoter CTD PMID:22847954 Sall1 Mouse tetrachloromethane decreases expression ISO Sall1 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of SALL1 mRNA CTD PMID:31150632 Sall1 Mouse thioacetamide increases expression ISO Sall1 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of SALL1 mRNA CTD PMID:34492290 Sall1 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of SALL1 mRNA CTD PMID:29264374 Sall1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of SALL1 gene CTD PMID:35295148 Sall1 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of SALL1 enhancer and titanium dioxide results in increased methylation of SALL1 gene CTD PMID:35295148 Sall1 Mouse trichloroethene increases expression ISO Sall1 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of SALL1 mRNA CTD PMID:33387578 Sall1 Mouse trichostatin A decreases expression ISO SALL1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of SALL1 mRNA CTD PMID:24935251 and PMID:26272509 Sall1 Mouse trichostatin A multiple interactions ISO SALL1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SALL1 mRNA CTD PMID:27188386 Sall1 Mouse triclosan decreases expression ISO SALL1 (Homo sapiens) 6480464 Triclosan results in decreased expression of SALL1 mRNA CTD PMID:30510588 Sall1 Mouse triphenyl phosphate affects expression ISO Sall1 (Rattus norvegicus) 6480464 triphenyl phosphate affects the expression of SALL1 mRNA CTD PMID:30589522 Sall1 Mouse tris(2-butoxyethyl) phosphate affects expression ISO SALL1 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of SALL1 mRNA CTD PMID:29024780 Sall1 Mouse urethane decreases expression ISO SALL1 (Homo sapiens) 6480464 Urethane results in decreased expression of SALL1 mRNA CTD PMID:28818685 Sall1 Mouse valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of SALL1 mRNA CTD PMID:19136453 and PMID:21427059 Sall1 Mouse valproic acid multiple interactions ISO SALL1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SALL1 mRNA CTD PMID:27188386 Sall1 Mouse valproic acid decreases expression ISO SALL1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SALL1 mRNA CTD PMID:23179753 and PMID:26272509 Sall1 Mouse valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of SALL1 mRNA CTD PMID:24896083 Sall1 Mouse valproic acid increases expression ISO SALL1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SALL1 mRNA CTD PMID:23179753 Sall1 Mouse venlafaxine hydrochloride increases expression ISO SALL1 (Homo sapiens) 6480464 Venlafaxine Hydrochloride results in increased expression of SALL1 mRNA CTD PMID:16341940 Sall1 Mouse vinclozolin decreases expression ISO Sall1 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of SALL1 mRNA CTD PMID:23034163 Sall1 Mouse zinc atom multiple interactions EXP 6480464 [zinc chloride results in increased abundance of Zinc] which results in increased expression of SALL1 mRNA CTD PMID:31588059 Sall1 Mouse zinc dichloride multiple interactions EXP 6480464 [zinc chloride results in increased abundance of Zinc] which results in increased expression of SALL1 mRNA CTD PMID:31588059 Sall1 Mouse zinc(0) multiple interactions EXP 6480464 [zinc chloride results in increased abundance of Zinc] which results in increased expression of SALL1 mRNA CTD PMID:31588059
(1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 2-palmitoylglycerol (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (EXP) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (ISO) acrylamide (ISO) aflatoxin B1 (ISO) amitrole (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) azathioprine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) buspirone (ISO) cadmium dichloride (ISO) caffeine (ISO) carbamazepine (ISO) choline (EXP) clobetasol (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cyclophosphamide (ISO) cyclosporin A (ISO) dichloromethane (EXP) dicrotophos (ISO) dieldrin (ISO) dorsomorphin (ISO) ethanol (EXP) flutamide (ISO) folic acid (EXP) fonofos (ISO) FR900359 (ISO) fulvestrant (ISO) furan (ISO) genistein (ISO) indometacin (ISO) inulin (EXP) L-methionine (EXP) lipopolysaccharide (ISO) metformin (ISO) methapyrilene (ISO) methimazole (ISO) methylmercury chloride (ISO) nefazodone (ISO) paracetamol (ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (EXP) phenylmercury acetate (ISO) pregnenolone 16alpha-carbonitrile (ISO) quercetin (ISO) raloxifene (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenite (ISO) sulfadimethoxine (ISO) tamoxifen (EXP,ISO) terbufos (ISO) tetrachloromethane (ISO) thioacetamide (ISO) titanium dioxide (EXP) trichloroethene (ISO) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) tris(2-butoxyethyl) phosphate (ISO) urethane (ISO) valproic acid (EXP,ISO) venlafaxine hydrochloride (ISO) vinclozolin (ISO) zinc atom (EXP) zinc dichloride (EXP) zinc(0) (EXP)
1.
SALL1 mutation analysis in Townes-Brocks syndrome: twelve novel mutations and expansion of the phenotype.
Botzenhart EM, etal., Hum Mutat. 2005 Sep;26(3):282.
2.
SALL4 is a marker of the embryonal subtype of hepatoblastoma.
Gnemmi V, etal., Histopathology. 2013 Sep;63(3):425-8. doi: 10.1111/his.12187. Epub 2013 Jul 3.
3.
SALL1 mutations in Townes-Brocks syndrome and related disorders.
Kohlhase J Hum Mutat. 2000 Dec;16(6):460-6.
4.
Accumulation of malignant renal stem cells is associated with epigenetic changes in normal renal progenitor genes.
Metsuyanim S, etal., Stem Cells. 2008 Jul;26(7):1808-17. doi: 10.1634/stemcells.2007-0322. Epub 2008 May 8.
5.
MGDs mouse GO annotations
MGD data from the GO Consortium
6.
MGD IEA
MGD IEA
7.
Murine homolog of SALL1 is essential for ureteric bud invasion in kidney development.
Nishinakamura R, etal., Development. 2001 Aug;128(16):3105-15. doi: 10.1242/dev.128.16.3105.
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Therapeutic potential of human induced pluripotent stem cells and renal progenitor cells in experimental chronic kidney disease.
Ribeiro PC, etal., Stem Cell Res Ther. 2020 Dec 9;11(1):530. doi: 10.1186/s13287-020-02060-4.
Sall1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 89,753,867 - 89,770,790 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 89,753,863 - 89,770,790 (-) Ensembl GRCm39 Ensembl GRCm38 8 89,027,242 - 89,044,162 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 89,027,235 - 89,044,162 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 91,551,141 - 91,568,061 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 91,918,348 - 91,932,544 (-) NCBI MGSCv36 mm8 Celera 8 93,321,670 - 93,338,514 (-) NCBI Celera Cytogenetic Map 8 C3 NCBI cM Map 8 43.51 NCBI
SALL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 51,135,982 - 51,152,334 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 51,135,982 - 51,152,334 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 51,169,893 - 51,185,181 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 49,727,387 - 49,742,684 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 49,727,829 - 49,742,653 NCBI Celera 16 35,686,254 - 35,701,557 (-) NCBI Celera Cytogenetic Map 16 q12.1 NCBI HuRef 16 37,057,983 - 37,073,288 (-) NCBI HuRef CHM1_1 16 52,577,216 - 52,592,517 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 56,933,839 - 56,950,190 (-) NCBI T2T-CHM13v2.0
Sall1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 34,179,316 - 34,196,278 (+) NCBI GRCr8 mRatBN7.2 19 18,005,782 - 18,022,705 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 18,007,503 - 18,022,705 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 19,687,226 - 19,702,424 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 24,881,820 - 24,897,018 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 27,838,998 - 27,854,185 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 23,387,737 - 23,405,025 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 23,389,375 - 23,405,039 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 34,377,838 - 34,395,131 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 19,277,337 - 19,293,298 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 19,283,733 - 19,298,618 (+) NCBI Celera 19 17,896,753 - 17,911,869 (+) NCBI Celera Cytogenetic Map 19 p11 NCBI
Sall1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 9,144,748 - 9,161,171 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 9,146,074 - 9,161,171 (-) NCBI ChiLan1.0 ChiLan1.0
SALL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 60,591,098 - 60,605,700 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 66,506,188 - 66,522,403 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 31,396,399 - 31,412,753 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 50,274,081 - 50,280,239 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 50,274,090 - 50,284,819 (-) Ensembl panpan1.1 panPan2
SALL1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 64,242,742 - 64,260,021 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 64,243,987 - 64,259,521 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 60,816,127 - 60,833,504 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 64,787,008 - 64,804,401 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 64,787,375 - 64,804,352 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 61,612,959 - 61,630,321 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 62,631,291 - 62,648,633 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 63,519,257 - 63,536,638 (+) NCBI UU_Cfam_GSD_1.0
Sall1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 55,465,986 - 55,483,143 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 4,106,084 - 4,121,413 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 4,106,663 - 4,121,356 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SALL1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 33,732,025 - 33,748,704 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 33,731,666 - 33,748,698 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 30,222,502 - 30,239,229 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SALL1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 36,928,711 - 36,944,158 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 36,927,990 - 36,943,630 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 39,548,229 - 39,564,556 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sall1
.
Predicted Target Of
Count of predictions: 262 Count of miRNA genes: 216 Interacting mature miRNAs: 233 Transcripts: ENSMUST00000034090 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
10043992 Hbnr11_m Heligmosomoides bakeri nematode resistance 11 (mouse) Not determined 8 66326836 100326976 Mouse 1301013 Capsq4_m capsaicin sensitivity related QTL 4 (mouse) Not determined 8 36630154 93455280 Mouse 11353828 Gf7_m gonadal fat pad weight 7 (mouse) 8 58928107 92928107 Mouse 1357470 Obq16_m obesity QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1558875 Eae31_m experimental allergic encephalomyelitis susceptibility 31 (mouse) Not determined 8 35109930 115563747 Mouse 1357787 Vtbt5_m vertebral trabecular bone trait 5 (mouse) Not determined 8 66084397 100084549 Mouse 1301767 Fcsa2_m femoral cross-sectional area 2 (mouse) Not determined 8 71032003 105032123 Mouse 10412234 Nhdlq14_m non-HDL QTL 14 (mouse) Not determined 8 76411976 110412125 Mouse 1301766 Desp1_m despair 1 (mouse) Not determined 8 85486208 119486373 Mouse 1301253 Skmw2_m skeletal muscle weight 2 (mouse) Not determined 8 86443553 120443701 Mouse 4140967 Bmd39_m bone mineral density 39 (mouse) Not determined 8 32506572 117965439 Mouse 1357708 Orq1_m ovulation rate QTL 1 (mouse) Not determined 8 71740461 124622354 Mouse 4141285 Tgq18_m triglyceride QTL 18 (mouse) Not determined 64186736 98186736 Mouse 4141797 Skmw16_m skeletal muscle weight 16 (mouse) Not determined 8 64666176 98666325 Mouse 10755519 Wbc1_m white blood cell count 1 (mouse) 8 82345783 116345783 Mouse 27226754 Femd6_m femur midshaft diameter 6, 10 week (mouse) 8 37867154 110326632 Mouse 10043975 Obq31_m obesity QTL 31 (mouse) Not determined 8 59136404 93136404 Mouse 1301581 Char2_m P. chabaudi malaria resistance QTL 2 (mouse) Not determined 8 79808806 113809031 Mouse 10412287 Carg3_m Candida albicans resistance gene 3 (mouse) Not determined 8 56298872 90298872 Mouse 1301874 Hdlq16_m HDL QTL 16 (mouse) Not determined 8 76411976 110412125 Mouse 1301872 Cd4ts3_m CD4 T cell subset 3 (mouse) Not determined 8 72122809 106123021 Mouse 10045619 Heal14_m wound healing/regeneration 14 (mouse) Not determined 8 86443553 120443701 Mouse 1301688 Orch6_m autoimmune orchitis resistance 6 (mouse) Not determined 8 61513479 95513605 Mouse 1558780 Idd22_m insulin dependent diabetes susceptibility 22 (mouse) Not determined 8 71829531 105829637 Mouse 1300920 Pitm3_m prion incubation time 3 (mouse) Not determined 8 73929123 107929226 Mouse 12904744 Carcdq1_m cardiac collagen deposition QTL 1 (mouse) 8 40162297 95416226 Mouse 4141395 Char2a_m P. chabaudi malaria resistance QTL 2a (mouse) Not determined 71589427 90929226 Mouse 10755530 Wbc2_m white blood cell count 2 (mouse) 8 81819296 115819296 Mouse 1302049 Heal1_m wound healing/regeneration 1 (mouse) Not determined 8 86443553 120443701 Mouse 27226796 Scvln16_m sacral vertebrae length 2, 16 week (mouse) 8 89726628 130027694 Mouse 4142283 Imraq2_m immune response to AAV2 QTL 2 (mouse) Not determined 8 71032003 105032123 Mouse 27095912 Pglq14_m pelvic girdle length QTL 14, 16 week (mouse) 8 74126628 126826739 Mouse 4142023 W3q5_m weight 3 weeks QTL 5 (mouse) Not determined 71740461 124622354 Mouse 1301099 Cbm2_m cerebellum weight 2 (mouse) Not determined 8 79245241 113245331 Mouse 1558890 Lith18_m lithogenic gene 18 (mouse) Not determined 8 76402145 110402251 Mouse
UniSTS:235962
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 89,028,354 - 89,028,436 UniSTS GRCm38 MGSCv37 8 91,552,253 - 91,552,335 UniSTS GRCm37 Celera 8 93,322,782 - 93,322,864 UniSTS Cytogenetic Map 8 D UniSTS
PMC140661P2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 89,028,096 - 89,028,383 UniSTS GRCm38 MGSCv37 8 91,551,995 - 91,552,282 UniSTS GRCm37 Celera 8 93,322,524 - 93,322,811 UniSTS Cytogenetic Map 8 D UniSTS
Sall1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 8 D UniSTS cM Map 8 UniSTS
RH47686
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 18 51,084,174 - 51,084,311 UniSTS GRCm38 GRCm38 8 89,027,320 - 89,027,459 UniSTS GRCm38 MGSCv37 18 51,243,828 - 51,243,965 UniSTS GRCm37 MGSCv37 8 91,551,219 - 91,551,358 UniSTS GRCm37 Celera 18 52,402,615 - 52,402,752 UniSTS Celera 8 93,321,748 - 93,321,887 UniSTS Cytogenetic Map 8 D UniSTS
AF021116
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 89,032,952 - 89,033,113 UniSTS GRCm38 MGSCv37 8 91,556,851 - 91,557,012 UniSTS GRCm37 Celera 8 93,327,380 - 93,327,541 UniSTS Cytogenetic Map 8 D UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000034090 ⟹ ENSMUSP00000034090
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 89,753,863 - 89,770,790 (-) Ensembl GRCm38.p6 Ensembl 8 89,027,235 - 89,044,162 (-) Ensembl
RefSeq Acc Id:
NM_001371069 ⟹ NP_001357998
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 89,753,870 - 89,770,140 (-) NCBI GRCm38 8 89,027,242 - 89,043,512 (-) NCBI
Sequence:
GAAAACTTCAGCCCTAATTGTCCCGGGAATGTCCAAGCTGATGTTTGAGCCAGCATGTCGCGGAGGAAGCAAGCGAAGCCTCAACATTTCCAATCCGACCCCGAAGTGGCCTCGCTCCCCCGGCGAGA
hide sequence
RefSeq Acc Id:
NM_001371070 ⟹ NP_001357999
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 89,753,870 - 89,769,490 (-) NCBI GRCm38 8 89,027,242 - 89,042,862 (-) NCBI
Sequence:
GCGCAGTGGCGAGGAGGCAGGCCCCCGGCGGCCGGGCCGCGGAGTCCCCGGCGGTCGCCAAGAG
hide sequence
RefSeq Acc Id:
NM_021390 ⟹ NP_067365
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 89,753,870 - 89,770,790 (-) NCBI GRCm38 8 89,027,242 - 89,044,162 (-) NCBI MGSCv37 8 91,551,141 - 91,568,061 (-) RGD Celera 8 93,321,670 - 93,338,514 (-) RGD cM Map 8 ENTREZGENE
Sequence:
CGGGAACCTCGGCGAGCGGAAACCCCGAGGCAGGAGGAGGTCTAAACTAAGCCGAGGACCAAGCCTCAGGTTCGCAGGCGCCCAAACCCGGAAGAGGGAGTACAGGGCCCGGATCCCTGGGTCCCGTG
hide sequence
RefSeq Acc Id:
XM_036154203 ⟹ XP_036010096
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 89,753,867 - 89,768,267 (-) NCBI
Sequence:
CCACACTTGCACCCATAACCCGTCAAAGTCGGGCTTGGATGTGTGCACCCCACGTATTATGGAG
hide sequence
RefSeq Acc Id:
NP_067365 ⟸ NM_021390
- UniProtKB:
Q9ER74 (UniProtKB/Swiss-Prot), Q920R5 (UniProtKB/Swiss-Prot), Q6P5E3 (UniProtKB/TrEMBL)
- Sequence:
MSRRKQAKPQHFQSDPEVASLPRRDGDTEKGQPSRPTKSKDAHVCGRCCAEFFELSDLLLHKKSCTKNQLVLIVNESPASPAKAFPPGPSLNDPDDQMKDAANKADQEDCSDLSEPKGLDREESMEVE
hide sequence
RefSeq Acc Id:
NP_001357998 ⟸ NM_001371069
- UniProtKB:
Q9ER74 (UniProtKB/Swiss-Prot), Q920R5 (UniProtKB/Swiss-Prot), Q6P5E3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001357999 ⟸ NM_001371070
- UniProtKB:
Q9ER74 (UniProtKB/Swiss-Prot), Q920R5 (UniProtKB/Swiss-Prot), Q6P5E3 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000034090 ⟸ ENSMUST00000034090
RefSeq Acc Id:
XP_036010096 ⟸ XM_036154203
- Peptide Label:
isoform X1
- UniProtKB:
Q9EPW7 (UniProtKB/TrEMBL)
RGD ID: 8667833 Promoter ID: EPDNEW_M11947 Type: multiple initiation site Name: Sall1_2 Description: Mus musculus spalt like transcription factor 1 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M11948 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 89,042,456 - 89,042,516 EPDNEW
RGD ID: 8667835 Promoter ID: EPDNEW_M11948 Type: initiation region Name: Sall1_1 Description: Mus musculus spalt like transcription factor 1 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M11947 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 89,044,183 - 89,044,243 EPDNEW
RGD ID: 6843689 Promoter ID: MM_KWN:55223 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: ES_Cell Transcripts: UC009MRZ.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 91,566,386 - 91,566,886 (-) MPROMDB
RGD ID: 6843688 Promoter ID: MM_KWN:55224 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: ES_Cell, Kidney, Liver Transcripts: NM_021390 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 91,567,576 - 91,569,052 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-10-31
Sall1
spalt like transcription factor 1
sal-like 1 (Drosophila)
Symbol and/or name change
5135510 APPROVED
