Symbol:
Dnajc6
Name:
DnaJ heat shock protein family (Hsp40) member C6
RGD ID:
1320496
MGI Page
MGI
Description:
Predicted to enable clathrin heavy chain binding activity and heat shock protein binding activity. Involved in clathrin-dependent endocytosis and synaptic vesicle uncoating. Acts upstream of or within clathrin coat disassembly and regulation of clathrin-dependent endocytosis. Located in postsynaptic density. Is extrinsic component of presynaptic endocytic zone membrane. Is expressed in genital tubercle of male; gut; nervous system; and sensory organ. Human ortholog(s) of this gene implicated in Parkinson's disease and Parkinson's disease 19A. Orthologous to human DNAJC6 (DnaJ heat shock protein family (Hsp40) member C6).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2810027M23Rik; au; auxilin; DnaJ (Hsp40) homolog, subfamily B, member 6; DnaJ (Hsp40) homolog, subfamily C, member 6; dnaJ homolog subfamily C member 6; mKIAA0473; putative tyrosine-protein phosphatase auxilin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DNAJC6 (DnaJ heat shock protein family (Hsp40) member C6) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Dnajc6 (DnaJ heat shock protein family (Hsp40) member C6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dnajc6 (DnaJ heat shock protein family (Hsp40) member C6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DNAJC6 (DnaJ heat shock protein family (Hsp40) member C6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DNAJC6 (DnaJ heat shock protein family (Hsp40) member C6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dnajc6 (DnaJ heat shock protein family (Hsp40) member C6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DNAJC6 (DnaJ heat shock protein family (Hsp40) member C6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DNAJC6 (DnaJ heat shock protein family (Hsp40) member C6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dnajc6 (DnaJ heat shock protein family (Hsp40) member C6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GAK (cyclin G associated kinase) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Dnajc6 (DnaJ heat shock protein family (Hsp40) member C6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
DNAJC6 (DnaJ heat shock protein family (Hsp40) member C6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dnajc6 (DnaJ (Hsp40) homolog, subfamily C, member 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
dnj-25
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
SWA2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
aux
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
dnajc6
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 101,353,751 - 101,499,996 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 101,353,828 - 101,499,996 (+) Ensembl GRCm39 Ensembl GRCm38 4 101,496,648 - 101,642,799 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 101,496,631 - 101,642,799 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 101,169,253 - 101,315,404 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 101,048,526 - 101,140,731 (+) NCBI MGSCv36 mm8 Celera 4 99,840,177 - 99,986,461 (+) NCBI Celera Cytogenetic Map 4 C6 NCBI cM Map 4 46.89 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dnajc6 Mouse 1,1-dichloroethene decreases expression EXP 6480464 vinylidene chloride results in decreased expression of DNAJC6 mRNA CTD PMID:26682919 Dnajc6 Mouse 17beta-estradiol multiple interactions ISO Dnajc6 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of DNAJC6 mRNA CTD PMID:26496021 Dnajc6 Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of DNAJC6 mRNA CTD PMID:39298647 Dnajc6 Mouse 17beta-estradiol multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of DNAJC6 mRNA CTD PMID:30165855 Dnajc6 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Dnajc6 Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Dnajc6 Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of DNAJC6 mRNA CTD PMID:20188158 Dnajc6 Mouse 3-chloropropane-1,2-diol increases expression ISO Dnajc6 (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in increased expression of DNAJC6 mRNA CTD PMID:28522335 Dnajc6 Mouse 4,4'-sulfonyldiphenol increases methylation ISO DNAJC6 (Homo sapiens) 6480464 bisphenol S results in increased methylation of DNAJC6 gene CTD PMID:31601247 Dnajc6 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO Dnajc6 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of DNAJC6 mRNA CTD PMID:36041667 Dnajc6 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of DNAJC6 mRNA CTD PMID:28973697 Dnajc6 Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of DNAJC6 mRNA CTD PMID:28973697 Dnajc6 Mouse alpha-Zearalanol multiple interactions ISO Dnajc6 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of DNAJC6 mRNA CTD PMID:35163327 Dnajc6 Mouse antirheumatic drug decreases expression ISO DNAJC6 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of DNAJC6 mRNA CTD PMID:24449571 Dnajc6 Mouse arsane affects methylation ISO DNAJC6 (Homo sapiens) 6480464 Arsenic affects the methylation of DNAJC6 gene CTD PMID:25304211 Dnajc6 Mouse arsenic atom affects methylation ISO DNAJC6 (Homo sapiens) 6480464 Arsenic affects the methylation of DNAJC6 gene CTD PMID:25304211 Dnajc6 Mouse arsenite(3-) increases methylation ISO DNAJC6 (Homo sapiens) 6480464 arsenite results in increased methylation of DNAJC6 promoter CTD PMID:23974009 Dnajc6 Mouse benzo[a]pyrene decreases methylation ISO DNAJC6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of DNAJC6 3' UTR CTD PMID:27901495 Dnajc6 Mouse benzo[a]pyrene increases methylation ISO DNAJC6 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of DNAJC6 5' UTR and Benzo(a)pyrene results in increased methylation of DNAJC6 promoter CTD PMID:27901495 Dnajc6 Mouse benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of DNAJC6 intron CTD PMID:27901495 Dnajc6 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO DNAJC6 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Dnajc6 Mouse beta-lapachone increases expression ISO DNAJC6 (Homo sapiens) 6480464 beta-lapachone results in increased expression of DNAJC6 mRNA CTD PMID:38218311 Dnajc6 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of DNAJC6 mRNA CTD PMID:28085963 Dnajc6 Mouse bisphenol A multiple interactions ISO Dnajc6 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of DNAJC6 mRNA more ... CTD PMID:26496021 and PMID:36041667 Dnajc6 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DNAJC6 mRNA CTD PMID:32156529 Dnajc6 Mouse bisphenol A increases methylation ISO DNAJC6 (Homo sapiens) 6480464 bisphenol A results in increased methylation of DNAJC6 gene CTD PMID:31601247 Dnajc6 Mouse bisphenol A decreases expression ISO Dnajc6 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of DNAJC6 mRNA CTD PMID:25181051 Dnajc6 Mouse bisphenol F multiple interactions ISO Dnajc6 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of DNAJC6 mRNA CTD PMID:36041667 Dnajc6 Mouse Brodifacoum decreases expression ISO Dnajc6 (Rattus norvegicus) 6480464 bromfenacoum results in decreased expression of DNAJC6 protein CTD PMID:28903499 Dnajc6 Mouse carbamazepine affects expression ISO DNAJC6 (Homo sapiens) 6480464 Carbamazepine affects the expression of DNAJC6 mRNA CTD PMID:24752500 Dnajc6 Mouse chenodeoxycholic acid multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of DNAJC6 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of DNAJC6 mRNA CTD PMID:32152650 Dnajc6 Mouse coumarin increases phosphorylation ISO DNAJC6 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of DNAJC6 protein CTD PMID:35688186 Dnajc6 Mouse cyclosporin A decreases expression ISO DNAJC6 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of DNAJC6 mRNA CTD PMID:27989131 Dnajc6 Mouse cyclosporin A multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of DNAJC6 mRNA CTD PMID:32152650 Dnajc6 Mouse cyclosporin A increases expression ISO DNAJC6 (Homo sapiens) 6480464 Cyclosporine results in increased expression of DNAJC6 mRNA CTD PMID:32152650 Dnajc6 Mouse deoxycholic acid multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of DNAJC6 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of DNAJC6 mRNA CTD PMID:32152650 Dnajc6 Mouse diclofenac affects expression ISO DNAJC6 (Homo sapiens) 6480464 Diclofenac affects the expression of DNAJC6 mRNA CTD PMID:24752500 Dnajc6 Mouse dorsomorphin multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Dnajc6 Mouse doxorubicin decreases expression ISO DNAJC6 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of DNAJC6 mRNA CTD PMID:29803840 Dnajc6 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of DNAJC6 mRNA CTD PMID:30319688 Dnajc6 Mouse formaldehyde increases expression ISO DNAJC6 (Homo sapiens) 6480464 Formaldehyde results in increased expression of DNAJC6 mRNA CTD PMID:23649840 Dnajc6 Mouse FR900359 increases phosphorylation ISO DNAJC6 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of DNAJC6 protein CTD PMID:37730182 Dnajc6 Mouse glycochenodeoxycholic acid multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of DNAJC6 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of DNAJC6 mRNA CTD PMID:32152650 Dnajc6 Mouse glycocholic acid multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of DNAJC6 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of DNAJC6 mRNA CTD PMID:32152650 Dnajc6 Mouse glycodeoxycholic acid multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of DNAJC6 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of DNAJC6 mRNA CTD PMID:32152650 Dnajc6 Mouse hexadecanoic acid increases phosphorylation ISO DNAJC6 (Homo sapiens) 6480464 Palmitic Acid results in increased phosphorylation of DNAJC6 protein CTD PMID:28073184 Dnajc6 Mouse lead(0) affects expression ISO DNAJC6 (Homo sapiens) 6480464 Lead affects the expression of DNAJC6 mRNA CTD PMID:28903495 Dnajc6 Mouse leflunomide increases expression ISO DNAJC6 (Homo sapiens) 6480464 leflunomide results in increased expression of DNAJC6 mRNA CTD PMID:28988120 Dnajc6 Mouse lipopolysaccharide multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of DNAJC6 mRNA CTD PMID:35811015 Dnajc6 Mouse mercury dibromide increases expression ISO DNAJC6 (Homo sapiens) 6480464 mercuric bromide results in increased expression of DNAJC6 mRNA CTD PMID:26272509 Dnajc6 Mouse mercury dibromide multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DNAJC6 mRNA CTD PMID:27188386 Dnajc6 Mouse methotrexate affects expression EXP 6480464 Methotrexate affects the expression of DNAJC6 mRNA CTD PMID:18502557 Dnajc6 Mouse nefazodone increases expression ISO DNAJC6 (Homo sapiens) 6480464 nefazodone results in increased expression of DNAJC6 mRNA CTD PMID:32152650 Dnajc6 Mouse nefazodone multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of DNAJC6 mRNA CTD PMID:32152650 Dnajc6 Mouse paracetamol increases expression ISO DNAJC6 (Homo sapiens) 6480464 Acetaminophen results in increased expression of DNAJC6 mRNA CTD PMID:29067470 Dnajc6 Mouse PCB138 multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Dnajc6 Mouse perfluorooctanoic acid multiple interactions ISO Dnajc6 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of DNAJC6 mRNA CTD PMID:35163327 Dnajc6 Mouse phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of DNAJC6 mRNA CTD PMID:19363144 Dnajc6 Mouse phenylmercury acetate increases expression ISO DNAJC6 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of DNAJC6 mRNA CTD PMID:26272509 Dnajc6 Mouse phenylmercury acetate multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DNAJC6 mRNA CTD PMID:27188386 Dnajc6 Mouse rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of DNAJC6 mRNA CTD PMID:23186747 Dnajc6 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of DNAJC6 mRNA CTD PMID:35811015 Dnajc6 Mouse SB 431542 multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Dnajc6 Mouse silver atom increases expression ISO DNAJC6 (Homo sapiens) 6480464 Silver results in increased expression of DNAJC6 mRNA CTD PMID:26551752 Dnajc6 Mouse silver(0) increases expression ISO DNAJC6 (Homo sapiens) 6480464 Silver results in increased expression of DNAJC6 mRNA CTD PMID:26551752 Dnajc6 Mouse sirolimus decreases expression ISO Dnajc6 (Rattus norvegicus) 6480464 Sirolimus results in decreased expression of DNAJC6 mRNA CTD PMID:21865292 Dnajc6 Mouse sodium arsenite increases expression ISO DNAJC6 (Homo sapiens) 6480464 sodium arsenite results in increased expression of DNAJC6 mRNA CTD PMID:22714537 more ... Dnajc6 Mouse sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of DNAJC6 mRNA CTD PMID:37682722 Dnajc6 Mouse Soman decreases expression ISO Dnajc6 (Rattus norvegicus) 6480464 Soman results in decreased expression of DNAJC6 mRNA CTD PMID:19281266 Dnajc6 Mouse sunitinib decreases expression ISO DNAJC6 (Homo sapiens) 6480464 Sunitinib results in decreased expression of DNAJC6 mRNA CTD PMID:31533062 Dnajc6 Mouse testosterone multiple interactions ISO Dnajc6 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of DNAJC6 mRNA CTD PMID:26496021 Dnajc6 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of DNAJC6 gene and titanium dioxide results in decreased methylation of DNAJC6 promoter CTD PMID:35295148 Dnajc6 Mouse trichostatin A increases expression ISO DNAJC6 (Homo sapiens) 6480464 trichostatin A results in increased expression of DNAJC6 mRNA CTD PMID:24935251 and PMID:26705709 Dnajc6 Mouse triclosan increases methylation ISO DNAJC6 (Homo sapiens) 6480464 Triclosan results in increased methylation of DNAJC6 gene CTD PMID:34523531 Dnajc6 Mouse triphenyl phosphate affects expression ISO DNAJC6 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of DNAJC6 mRNA CTD PMID:37042841 Dnajc6 Mouse Triptolide decreases expression ISO Dnajc6 (Rattus norvegicus) 6480464 triptolide results in decreased expression of DNAJC6 protein CTD PMID:32519852 Dnajc6 Mouse urethane increases expression ISO DNAJC6 (Homo sapiens) 6480464 Urethane results in increased expression of DNAJC6 mRNA CTD PMID:28818685 Dnajc6 Mouse valproic acid increases expression ISO DNAJC6 (Homo sapiens) 6480464 Valproic Acid results in increased expression of DNAJC6 mRNA CTD PMID:23179753 more ... Dnajc6 Mouse valproic acid multiple interactions ISO DNAJC6 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DNAJC6 mRNA CTD PMID:27188386 Dnajc6 Mouse vancomycin increases expression EXP 6480464 Vancomycin results in increased expression of DNAJC6 mRNA CTD PMID:18930951
Imported Annotations - KEGG (archival)
1,1-dichloroethene (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 3,4-methylenedioxymethamphetamine (EXP) 3-chloropropane-1,2-diol (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (EXP) alpha-Zearalanol (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) Brodifacoum (ISO) carbamazepine (ISO) chenodeoxycholic acid (ISO) coumarin (ISO) cyclosporin A (ISO) deoxycholic acid (ISO) diclofenac (ISO) dorsomorphin (ISO) doxorubicin (ISO) ethanol (EXP) formaldehyde (ISO) FR900359 (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) hexadecanoic acid (ISO) lead(0) (ISO) leflunomide (ISO) lipopolysaccharide (ISO) mercury dibromide (ISO) methotrexate (EXP) nefazodone (ISO) paracetamol (ISO) PCB138 (EXP) perfluorooctanoic acid (ISO) phenobarbital (EXP) phenylmercury acetate (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sirolimus (ISO) sodium arsenite (EXP,ISO) Soman (ISO) sunitinib (ISO) testosterone (ISO) titanium dioxide (EXP) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) Triptolide (ISO) urethane (ISO) valproic acid (ISO) vancomycin (EXP)
1.
Synaptojanin 1 mutation in Parkinson's disease brings further insight into the neuropathological mechanisms.
Drouet V and Lesage S, Biomed Res Int. 2014;2014:289728. doi: 10.1155/2014/289728. Epub 2014 Sep 16.
2.
Impaired intracellular trafficking defines early Parkinson's disease.
Hunn BH, etal., Trends Neurosci. 2015 Mar;38(3):178-88. doi: 10.1016/j.tins.2014.12.009. Epub 2015 Jan 29.
3.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
Okazaki N, etal., DNA Res 2003 Feb 28;10(1):35-48.
6.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Synaptic vesicle endocytosis.
Saheki Y and De Camilli P, Cold Spring Harb Perspect Biol. 2012 Sep 1;4(9):a005645. doi: 10.1101/cshperspect.a005645.
Dnajc6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 101,353,751 - 101,499,996 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 101,353,828 - 101,499,996 (+) Ensembl GRCm39 Ensembl GRCm38 4 101,496,648 - 101,642,799 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 101,496,631 - 101,642,799 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 101,169,253 - 101,315,404 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 101,048,526 - 101,140,731 (+) NCBI MGSCv36 mm8 Celera 4 99,840,177 - 99,986,461 (+) NCBI Celera Cytogenetic Map 4 C6 NCBI cM Map 4 46.89 NCBI
DNAJC6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 65,264,749 - 65,415,871 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 65,248,219 - 65,415,871 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 65,730,432 - 65,881,554 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 65,503,018 - 65,654,140 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 65,442,450 - 65,593,573 NCBI Celera 1 64,021,163 - 64,172,220 (+) NCBI Celera Cytogenetic Map 1 p31.3 NCBI HuRef 1 63,839,137 - 63,990,340 (+) NCBI HuRef CHM1_1 1 65,846,654 - 65,997,823 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 65,142,745 - 65,293,848 (+) NCBI T2T-CHM13v2.0
Dnajc6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 121,232,532 - 121,398,775 (+) NCBI GRCr8 mRatBN7.2 5 116,120,069 - 116,283,448 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 116,119,676 - 116,283,448 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 118,690,704 - 118,836,807 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 120,416,048 - 120,562,150 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 120,467,359 - 120,613,473 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 120,330,372 - 120,492,515 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 120,340,646 - 120,492,487 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 124,210,621 - 124,370,661 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 122,155,150 - 122,309,090 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 122,205,852 - 122,314,329 (+) NCBI Celera 5 114,661,979 - 114,806,295 (+) NCBI Celera Cytogenetic Map 5 q33 NCBI
Dnajc6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955423 25,269,466 - 25,377,641 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955423 25,269,459 - 25,382,664 (-) NCBI ChiLan1.0 ChiLan1.0
DNAJC6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 161,446,599 - 161,607,811 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 160,597,432 - 160,758,627 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 64,501,805 - 64,662,999 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 66,389,807 - 66,550,886 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 66,399,968 - 66,550,879 (+) Ensembl panpan1.1 panPan2
DNAJC6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 44,882,111 - 45,021,152 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 44,884,283 - 45,120,203 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 44,938,863 - 45,077,971 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 45,062,677 - 45,201,688 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 45,061,729 - 45,201,677 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 45,028,100 - 45,167,200 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 44,972,606 - 45,111,645 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 45,223,560 - 45,362,686 (-) NCBI UU_Cfam_GSD_1.0
Dnajc6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 78,372,295 - 78,520,601 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936692 2,741,632 - 2,834,078 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936692 2,788,477 - 2,836,094 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DNAJC6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 146,989,351 - 147,155,131 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 146,990,115 - 147,161,010 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 135,395,465 - 135,566,139 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DNAJC6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 67,661,187 - 67,824,822 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 67,660,680 - 67,809,086 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 49,732,881 - 49,896,207 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dnajc6
.
Predicted Target Of
Count of predictions: 7632 Count of miRNA genes: 731 Interacting mature miRNAs: 990 Transcripts: ENSMUST00000038207, ENSMUST00000094953, ENSMUST00000106929, ENSMUST00000106930, ENSMUST00000106933, ENSMUST00000146489, ENSMUST00000149047, ENSMUST00000154120 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
27226782 Tibl2_m tibia length 2, 5 week (mouse) 4 90888237 111257197 Mouse 13824982 Svwq1_m seminal vesicle weight QTL 1 (mouse) 4 89888237 118857197 Mouse 11532714 Sluc43_m susceptibility to lung cancer 43 (mouse) 4 46642108 123127211 Mouse 12904002 Opfaq9_m open field activity QTL 9 (mouse) 4 92975790 126975790 Mouse 4141623 W6q13_m weight 6 weeks QTL 13 (mouse) Not determined 88982069 140468203 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 1357726 Lnopy1_m lens opacity 1 (mouse) Not determined 4 85428838 119429037 Mouse 11532708 Sluc43i_m susceptibility to lung cancer 43i (mouse) 4 74444699 108444983 Mouse 11532707 Sluc43h_m susceptibility to lung cancer 43h (mouse) 4 74444699 108444983 Mouse 11532706 Sluc43c_m susceptibility to lung cancer 43c (mouse) 4 74444699 108444983 Mouse 27226770 Tibl11_m tibia length 11, 10 week (mouse) 4 88518237 108357197 Mouse 11532705 Sluc43b_m susceptibility to lung cancer 43b (mouse) 4 74444699 108444983 Mouse 1302044 Nss1_m NOD Sjogren's syndrome 1 (mouse) Not determined 4 71982069 105982216 Mouse 11532704 Sluc43a_m susceptibility to lung cancer 43a (mouse) 4 74444699 108444983 Mouse 14696687 Gdq1_m grooming duration QTL 1, males (mouse) 4 96888237 111857197 Mouse 27226766 Tibl17_m tibia length 17, 16 week (mouse) 4 88518237 108457197 Mouse 14696689 Gdq2_m grooming duration QTL 2, females (mouse) 4 100857197 124893793 Mouse 27226760 Feml19_m femur length 19, 16 week (mouse) 4 90888237 108457197 Mouse 4141093 W3q17_m weight 3 weeks QTL 17 (mouse) Not determined 88982069 140468203 Mouse 1302031 Bulb1_m bulb size 1 (mouse) Not determined 4 74033887 108034029 Mouse 27095939 Ulnl9_m ulna length 9, 16 week (mouse) 4 65318237 118857197 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 12904933 Edlmmq3_m extensor digitorum longus muscle mass QTL 3 (mouse) 4 81213991 115213991 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300918 Stheal4_m soft tissue heal 4 (mouse) Not determined 4 89969627 123969747 Mouse 1301556 Cd4vts1_m CD4 virgin T cell subset 1 (mouse) Not determined 4 85428838 119429037 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 27226801 Feml6_m femur length 6, 5 week (mouse) 4 87518237 103257197 Mouse 1302204 Spm1_m splenomegaly modifier (mouse) Not determined 4 82244395 116244582 Mouse 11532703 Sluc43g_m susceptibility to lung cancer 43g (mouse) 4 74444699 108444983 Mouse 11532702 Sluc43f_m susceptibility to lung cancer 43f (mouse) 4 74444699 108444983 Mouse 11532701 Sluc43e_m susceptibility to lung cancer 43e (mouse) 4 74444699 108444983 Mouse 1558948 Ath8_m atherosclerosis 8 (mouse) Not determined 4 45658442 105156995 Mouse 11532700 Sluc43d_m susceptibility to lung cancer 43d (mouse) 4 74444699 108444983 Mouse 11039517 Ltpr4_m Leishmania tropica response 4 (mouse) 4 79365751 113365867 Mouse 11039504 Ltpr4a_m Leishmania tropica response 4a (mouse) 4 79365751 113365867 Mouse 11039505 Ltpr4c_m Leishmania tropica response 4c (mouse) 4 79365751 113365867 Mouse 1301930 Papg1_m pulmonary adenoma progression 1 (mouse) Not determined 4 85781167 119781279 Mouse 1302057 Pgia27_m proteoglycan induced arthritis 27 (mouse) Not determined 4 70067227 104067464 Mouse 1301545 Gauc_m glucose area under curve (mouse) Not determined 4 76763107 110763305 Mouse 11039506 Ltpr4b_m Leishmania tropica response 4b (mouse) 4 79365751 113365867 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 27226787 Feml14_m femur length 14, 10 week (mouse) 4 84918237 107157197 Mouse 10412193 Plep_m plasma lepin levels (mouse) Not determined 4 74444699 108444983 Mouse 27095900 Scvln9_m sacral vertebrae length 2, 10 week (mouse) 4 68018237 107157197 Mouse 39128212 Lwq21_m liver weight QTL 21 (mouse) 4 88982069 140468203 Mouse 27226716 Metcl2_m metatarsal-calcaneal length 2, 5 week (mouse) 4 88118237 118557197 Mouse 1301847 Fecq2_m fecundity QTL 2 (mouse) Not determined 4 100071971 134072206 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 26884434 Zlq1_m zygomatic length QTL 1, 5 week (mouse) 4 53700000 103257197 Mouse 26884435 Zlq4_m zygomatic length QTL 4, 10 week (mouse) 4 85118237 104957197 Mouse 1300697 Sle2_m systemic lupus erythmatosus susceptibility 2 (mouse) Not determined 4 77957579 111957775 Mouse 1301597 Anxty_m anxiety (mouse) Not determined 4 74137574 128009280 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 4141549 W10q10_m weight 10 weeks QTL 10 (mouse) Not determined 88982069 140468203 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 26884431 Zlq8_m zygomatic length QTL 8, 16 week (mouse) 4 74718237 108357197 Mouse 12879897 Berr4_m berghei resistance locus 4 (mouse) 4 71982069 105982216 Mouse 4142047 Mvwf3_m modifier of von Willebrand factor 3 (mouse) Not determined 14010457 117072206 Mouse 1301106 Skts7_m skin tumor susceptibility 7 (mouse) Not determined 4 100071971 134072206 Mouse 1301233 Sbw2_m splenomegaly-NZB x NZW 2 (mouse) Not determined 4 94957579 128009280 Mouse 27226746 Metcl8_m metatarsal-calcaneal length 8, 10 week (mouse) 4 87518237 107157197 Mouse 27095924 Pglq2_m pelvic girdle length QTL 2, 5 week (mouse) 4 69118237 130727311 Mouse 27095927 Pglq7_m pelvic girdle length QTL 7, 10 week (mouse) 4 88118237 108357197 Mouse 27095921 Pglq12_m pelvic girdle length QTL 12, 16 week (mouse) 4 83118237 108357197 Mouse 27226739 Metcl14_m metatarsal-calcaneal length 14, 16 week (mouse) 4 87518237 108357197 Mouse 1301118 Bbaa23_m B.burgdorferi-associated arthritis 23 (mouse) Not determined 4 85781167 119781279 Mouse 11532738 Abd1_m autoimmune biliary disease 1 (mouse) 4 88982069 116271120 Mouse 15039368 Nmrs19_m NAFLD-associated magnetic resonance shift 19 (mouse) 4 90882780 124882780 Mouse 27095917 Scvln14_m sacral vertebrae length 2, 16 week (mouse) 4 68018237 130277062 Mouse 1301731 Cafq2_m caffeine metabolism QTL 2 (mouse) Not determined 4 94732255 128732454 Mouse 4141900 Skts-fp1_m skin tumor susceptibility in FVB and PWK 1 (mouse) Not determined 4 53550839 124055180 Mouse 1300966 Pabr2_m plasma apolipoprotein B (human) regulator 2 (mouse) Not determined 4 46332646 105801860 Mouse 12880433 Fgf23lq1_m FGF23 serum level QTL 1 (mouse) 4 101157197 135157197 Mouse 1300580 Lbw2_m lupus NZB x NZW 2 (mouse) Not determined 4 98545539 128009280 Mouse 1301739 Pitm2_m prion incubation time 2 (mouse) Not determined 4 71982069 105982216 Mouse 1301867 Idd11_m insulin dependent diabetes susceptibility 11 (mouse) Not determined 4 83604870 117605006 Mouse 26884449 Sklq2_m skull length QTL 2, 5 week (mouse) 4 36700000 128993793 Mouse 27226724 Tibw2_m tibia width 2, proximal, 10 week (mouse) 4 43000000 108357197 Mouse 27095905 Scvln3_m sacral vertebrae length 2, 5 week (mouse) 4 55600000 128993793 Mouse 11553870 Cmmm_m carcinoma modifier of MSM (mouse) 4 90590668 124590781 Mouse
BF393615
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 101,628,620 - 101,628,792 UniSTS GRCm38 MGSCv37 4 101,301,225 - 101,301,397 UniSTS GRCm37 Celera 4 99,972,282 - 99,972,454 UniSTS Cytogenetic Map 4 C6 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000038207 ⟹ ENSMUSP00000044251
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 101,365,068 - 101,499,996 (+) Ensembl GRCm38.p6 Ensembl 4 101,507,871 - 101,642,799 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000094953 ⟹ ENSMUSP00000092560
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 101,407,677 - 101,499,996 (+) Ensembl GRCm38.p6 Ensembl 4 101,550,480 - 101,642,799 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000106929 ⟹ ENSMUSP00000102542
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 101,365,197 - 101,499,995 (+) Ensembl GRCm38.p6 Ensembl 4 101,508,000 - 101,642,798 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000106930 ⟹ ENSMUSP00000102543
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 101,353,845 - 101,499,996 (+) Ensembl GRCm38.p6 Ensembl 4 101,496,648 - 101,642,799 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000106933 ⟹ ENSMUSP00000102546
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 101,407,791 - 101,499,979 (+) Ensembl GRCm38.p6 Ensembl 4 101,550,594 - 101,642,782 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000146489
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 101,365,227 - 101,456,301 (+) Ensembl GRCm38.p6 Ensembl 4 101,508,030 - 101,599,104 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000149047 ⟹ ENSMUSP00000119542
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 101,365,173 - 101,468,548 (+) Ensembl GRCm38.p6 Ensembl 4 101,507,976 - 101,611,351 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000154120 ⟹ ENSMUSP00000114840
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 101,353,828 - 101,475,751 (+) Ensembl GRCm38.p6 Ensembl 4 101,496,631 - 101,618,554 (+) Ensembl
RefSeq Acc Id:
NM_001164583 ⟹ NP_001158055
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 101,407,506 - 101,499,996 (+) NCBI GRCm38 4 101,550,594 - 101,642,799 (+) NCBI MGSCv37 4 101,169,253 - 101,315,404 (+) RGD Celera 4 99,840,177 - 99,986,461 (+) RGD cM Map 4 ENTREZGENE
Sequence:
TCTGTCCCGTCTTCCCCTCCCCCTTCCTTTCCCAGGTTGATTTTTTTTTCTTCCCCCTCTTCTCCGGGCTTGCCCATGAGCCTCCTCGGGAGCTACCGGAAAAAGACCAGCAGCGATGGTTATGAATC
hide sequence
RefSeq Acc Id:
NM_001164584 ⟹ NP_001158056
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 101,365,176 - 101,499,996 (+) NCBI GRCm38 4 101,507,976 - 101,642,799 (+) NCBI MGSCv37 4 101,169,253 - 101,315,404 (+) RGD Celera 4 99,840,177 - 99,986,461 (+) RGD cM Map 4 ENTREZGENE
Sequence:
TTCAGCATAAGCAAAATTATAACCCTGCACGCTGACTTGTATGCTATTATCATAGCCTGGCTGCTCCTGCGTTGAGGGACTTCGCCCCCGGGATCGCTGACTGTCTGTGAATGACAAATCCAAAGTCA
hide sequence
RefSeq Acc Id:
NM_001164585 ⟹ NP_001158057
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 101,365,176 - 101,499,996 (+) NCBI GRCm38 4 101,507,976 - 101,642,799 (+) NCBI MGSCv37 4 101,169,253 - 101,315,404 (+) RGD Celera 4 99,840,177 - 99,986,461 (+) RGD cM Map 4 ENTREZGENE
Sequence:
TTCAGCATAAGCAAAATTATAACCCTGCACGCTGACTTGTATGCTATTATCATAGCCTGGCTGC
hide sequence
RefSeq Acc Id:
NM_001355179 ⟹ NP_001342108
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 101,353,751 - 101,499,996 (+) NCBI GRCm38 4 101,496,648 - 101,642,799 (+) NCBI
Sequence:
GGGCGCACCAATGGGCGCGACCGAGGCCGGAGGCACTAAGAGCCGGAGGCTGCTGTCGGTGCTG
hide sequence
RefSeq Acc Id:
NM_001355180 ⟹ NP_001342109
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 101,365,176 - 101,499,996 (+) NCBI GRCm38 4 101,507,976 - 101,642,799 (+) NCBI
Sequence:
TTCAGCATAAGCAAAATTATAACCCTGCACGCTGACTTGTATGCTATTATCATAGCCTGGCTGC
hide sequence
RefSeq Acc Id:
NM_198412 ⟹ NP_940804
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 101,353,751 - 101,499,996 (+) NCBI GRCm38 4 101,496,648 - 101,642,799 (+) NCBI MGSCv37 4 101,169,253 - 101,315,404 (+) RGD Celera 4 99,840,177 - 99,986,461 (+) RGD cM Map 4 ENTREZGENE
Sequence:
GGGCGCACCAATGGGCGCGACCGAGGCCGGAGGCACTAAGAGCCGGAGGCTGCTGTCGGTGCTG
hide sequence
RefSeq Acc Id:
NP_940804 ⟸ NM_198412
- Peptide Label:
isoform c
- UniProtKB:
Q80TZ3 (UniProtKB/Swiss-Prot)
- Sequence:
MEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVSSYTKGDLDFTYVTSRIIVMSFPVDSVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHSRVSECSWPIRQAPSLHNL
hide sequence
RefSeq Acc Id:
NP_001158057 ⟸ NM_001164585
- Peptide Label:
isoform c
- UniProtKB:
Q80TZ3 (UniProtKB/Swiss-Prot)
- Sequence:
MEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVSSYTKGDLDFTYVTSRIIVMS
hide sequence
RefSeq Acc Id:
NP_001158056 ⟸ NM_001164584
- Peptide Label:
isoform b
- UniProtKB:
Q6P2K9 (UniProtKB/Swiss-Prot), B1B0B9 (UniProtKB/Swiss-Prot), Q8C7L9 (UniProtKB/Swiss-Prot), Q80TZ3 (UniProtKB/Swiss-Prot)
- Sequence:
MTNPKSGVAESAGLACSRAAAGENRMKDSENKGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVSSYTKGDLDFTYVTSRIIVMSFPVDSVDIGFRNQVDDIRSFLDSRHL
hide sequence
RefSeq Acc Id:
NP_001158055 ⟸ NM_001164583
- Peptide Label:
isoform a
- UniProtKB:
Q80TZ3 (UniProtKB/Swiss-Prot)
- Sequence:
MSLLGSYRKKTSSDGYESLQLVDSHGDSSARGAAAGTQRATAGAVRSPARQPPHRASTTDSSGA
hide sequence
RefSeq Acc Id:
NP_001342108 ⟸ NM_001355179
- Peptide Label:
isoform d
RefSeq Acc Id:
NP_001342109 ⟸ NM_001355180
- Peptide Label:
isoform c
Ensembl Acc Id:
ENSMUSP00000102542 ⟸ ENSMUST00000106929
Ensembl Acc Id:
ENSMUSP00000102543 ⟸ ENSMUST00000106930
Ensembl Acc Id:
ENSMUSP00000102546 ⟸ ENSMUST00000106933
Ensembl Acc Id:
ENSMUSP00000114840 ⟸ ENSMUST00000154120
Ensembl Acc Id:
ENSMUSP00000119542 ⟸ ENSMUST00000149047
Ensembl Acc Id:
ENSMUSP00000092560 ⟸ ENSMUST00000094953
Ensembl Acc Id:
ENSMUSP00000044251 ⟸ ENSMUST00000038207
RGD ID: 6883970 Promoter ID: EPDNEW_M5436 Type: initiation region Name: Dnajc6_2 Description: Mus musculus DnaJ heat shock protein family member C6 , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5438 EPDNEW_M5437 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 101,496,551 - 101,496,611 EPDNEW
RGD ID: 6883996 Promoter ID: EPDNEW_M5437 Type: initiation region Name: Dnajc6_3 Description: Mus musculus DnaJ heat shock protein family member C6 , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5436 EPDNEW_M5438 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 101,507,996 - 101,508,056 EPDNEW
RGD ID: 6883974 Promoter ID: EPDNEW_M5438 Type: single initiation site Name: Dnajc6_1 Description: Mus musculus DnaJ heat shock protein family member C6 , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M5436 EPDNEW_M5437 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 101,562,005 - 101,562,065 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-22
Dnajc6
DnaJ heat shock protein family (Hsp40) member C6
DnaJ (Hsp40) homolog, subfamily C, member 6
Symbol and/or name change
5135510 APPROVED
