Gene: Prkdc (protein kinase, DNA activated, catalytic polypeptide) Mus musculus
Analyze
Symbol:
Prkdc
Name:
protein kinase, DNA activated, catalytic polypeptide
RGD ID:
1319073
MGI Page
MGI
Description:
Enables DNA-dependent protein kinase activity; double-stranded DNA binding activity; and enzyme binding activity. Involved in several processes, including regulation of hematopoietic stem cell differentiation; regulation of hemopoiesis; and regulation of protein metabolic process. Acts upstream of or within several processes, including DNA metabolic process; ectopic germ cell programmed cell death; and hemopoiesis. Located in nucleus. Is expressed in several structures, including central nervous system; liver; neural retina; and thymus primordium. Used to study Duchenne muscular dystrophy; severe combined immunodeficiency, autosomal recessive, T cell-negative, B cell-negative, Nk cell-positive; and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in immunodeficiency 26. Orthologous to human PRKDC (protein kinase, DNA-activated, catalytic subunit).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AI326420; AU019811; DNA; DNA-; DNA-dependent protein kinase catalytic subunit; DNA-PK catalytic subunit; DNA-PKcs; DNAPDcs; DNAPK; DNPK1; DOX; DOXNPH; doxorubicin nephropathy; dxn; dxnph; HYRC1; p460; scid; severe combined immunodeficiency; slip; XRCC; XRCC7
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRKDC (protein kinase, DNA-activated, catalytic subunit) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Prkdc (protein kinase, DNA-activated, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prkdc (protein kinase, DNA-activated, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRKDC (protein kinase, DNA-activated, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRKDC (protein kinase, DNA-activated, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prkdc (protein kinase, DNA-activated, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRKDC (protein kinase, DNA-activated, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRKDC (protein kinase, DNA-activated, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prkdc (protein kinase, DNA-activated, catalytic subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Prkdc (protein kinase, DNA-activated, catalytic subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PRKDC (protein kinase, DNA-activated, catalytic subunit)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prkdc (protein kinase, DNA-activated, catalytic subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Xenopus tropicalis (tropical clawed frog):
prkdc
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 15,455,698 - 15,660,103 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 15,455,730 - 15,660,099 (+) Ensembl GRCm39 Ensembl GRCm38 16 15,637,444 - 15,842,239 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 15,637,866 - 15,842,235 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 15,637,959 - 15,842,332 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 15,551,467 - 15,755,813 (+) NCBI MGSCv36 mm8 Celera 16 16,214,291 - 16,413,213 (+) NCBI Celera Cytogenetic Map 16 A2 NCBI cM Map 16 10.09 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Prkdc Mouse breast cancer ISO RGD:1319072 8554872 ClinVar Annotator: match by term: Malignant tumor of breast ClinVar PMID:25741868|PMID:28492532 Prkdc Mouse immunodeficiency 26 ISO RGD:1319072 8554872 ClinVar Annotator: match by term: PRKDC-related condition | ClinVar Annotator: match by term: Severe combined more ... ClinVar PMID:16199547|PMID:17576681|PMID:19075392|PMID:23722905|PMID:25640679|PMID:25741868|PMID:25842288|PMID:26122175|PMID:28492532|PMID:29987844|PMID:30121298|PMID:30778343|PMID:37580814|PMID:9536098 Prkdc Mouse microcephaly ISO RGD:1319072 8554872 ClinVar Annotator: match by term: Microcephaly ClinVar PMID:25741868
Only show annotations with direct experimental evidence (0 objects hidden)
Prkdc Mouse (+)-schisandrin B multiple interactions ISO RGD:1308982 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PRKDC mRNA] CTD PMID:31150632 Prkdc Mouse (-)-alpha-phellandrene decreases expression EXP 6480464 alpha phellandrene results in decreased expression of PRKDC protein CTD PMID:24861204 Prkdc Mouse (-)-demecolcine decreases expression ISO RGD:1319072 6480464 Demecolcine results in decreased expression of PRKDC mRNA CTD PMID:23649840 Prkdc Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRKDC mRNA CTD PMID:36331819 Prkdc Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of PRKDC mRNA CTD PMID:22206623 Prkdc Mouse 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile decreases expression ISO RGD:1308982 6480464 Citalopram results in decreased expression of PRKDC mRNA CTD PMID:28467792 Prkdc Mouse 1-chloro-2,4-dinitrobenzene affects binding ISO RGD:1319072 6480464 Dinitrochlorobenzene binds to PRKDC protein CTD PMID:32991956 Prkdc Mouse 1-nitropyrene increases expression ISO RGD:1319072 6480464 1-nitropyrene results in increased expression of PRKDC protein CTD PMID:28633978 Prkdc Mouse 17beta-estradiol decreases expression ISO RGD:1319072 6480464 Estradiol results in decreased expression of PRKDC mRNA CTD PMID:15223131 Prkdc Mouse 17beta-estradiol multiple interactions ISO RGD:1319072 6480464 [Estradiol co-treated with Norethindrone Acetate] results in increased expression of PRKDC mRNA CTD PMID:22217510 Prkdc Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PRKDC mRNA CTD PMID:39298647 Prkdc Mouse 17beta-estradiol increases expression ISO RGD:1319072 6480464 Estradiol results in increased expression of PRKDC mRNA CTD PMID:16514628|PMID:23019147|PMID:31614463 Prkdc Mouse 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:1319072 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of PRKDC protein CTD PMID:22233939 Prkdc Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1319072 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of PRKDC protein CTD PMID:31675489 Prkdc Mouse 2,2',4,4'-Tetrabromodiphenyl ether affects response to substance ISO RGD:1319072 6480464 PRKDC protein affects the susceptibility to 2,2',4,4'-tetrabromodiphenyl ether CTD PMID:22233939 Prkdc Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1308982 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRKDC mRNA CTD PMID:32109520|PMID:33387578 Prkdc Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO RGD:1308982 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of PRKDC mRNA CTD PMID:32109520 Prkdc Mouse 2,4,6-tribromophenol decreases expression ISO RGD:1319072 6480464 2,4,6-tribromophenol results in decreased expression of PRKDC mRNA CTD PMID:31675489 Prkdc Mouse 2,6-dimethoxyphenol multiple interactions ISO RGD:1319072 6480464 [Furaldehyde co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of PRKDC protein; [Sodium Chloride more ... CTD PMID:38598786 Prkdc Mouse 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1319072 6480464 tetrabromobisphenol A results in decreased expression of PRKDC protein CTD PMID:31675489 Prkdc Mouse 3-aminobenzamide multiple interactions ISO RGD:1319072 6480464 3-aminobenzamide inhibits the reaction [Capsaicin results in increased phosphorylation of and results in increased activity more ... CTD PMID:22226932 Prkdc Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1319072 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Prkdc Mouse 3-Nitrofluoranthene increases expression ISO RGD:1319072 6480464 3-nitrofluoranthene results in increased expression of PRKDC protein CTD PMID:28633978 Prkdc Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of PRKDC mRNA CTD PMID:39298647 Prkdc Mouse 4,4'-sulfonyldiphenol increases expression ISO RGD:1319072 6480464 bisphenol S results in increased expression of PRKDC protein CTD PMID:34186270 Prkdc Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of PRKDC gene CTD PMID:31683443 Prkdc Mouse 4-amino-1,8-naphthalimide affects response to substance EXP 6480464 PRKDC protein affects the susceptibility to 4-amino-1,8-naphthalimide CTD PMID:16556909 Prkdc Mouse 4-amino-1,8-naphthalimide multiple interactions EXP 6480464 PRKDC protein affects the reaction [4-amino-1,8-naphthalimide results in decreased activity of PARP1 protein] CTD PMID:16556909 Prkdc Mouse 4-hydroxynon-2-enal decreases expression ISO RGD:1319072 6480464 4-hydroxy-2-nonenal results in decreased expression of PRKDC mRNA CTD PMID:12419474 Prkdc Mouse 4-nitrophenol increases expression EXP 6480464 4-nitrophenol results in increased expression of PRKDC mRNA CTD PMID:34673133 Prkdc Mouse 5-aza-2'-deoxycytidine affects methylation ISO RGD:1319072 6480464 Decitabine affects the methylation of PRKDC gene CTD PMID:17630775 Prkdc Mouse 5-fluorouracil multiple interactions ISO RGD:1319072 6480464 PRKDC mRNA results in increased susceptibility to [Fluorouracil co-treated with Cisplatin]; TP53 protein affects the more ... CTD PMID:15016801|PMID:18546291 Prkdc Mouse 7,12-dimethyltetraphene decreases expression EXP 6480464 9,10-Dimethyl-1,2-benzanthracene results in decreased expression of PRKDC mRNA CTD PMID:25448685 Prkdc Mouse 7,12-dimethyltetraphene multiple interactions EXP 6480464 9,10-Dimethyl-1,2-benzanthracene inhibits the reaction [A gene mutant form results in decreased expression of PRKDC mRNA] CTD PMID:25448685 Prkdc Mouse 7,12-dimethyltetraphene increases expression EXP 6480464 9,10-Dimethyl-1,2-benzanthracene results in increased expression of PRKDC protein CTD PMID:25448685 Prkdc Mouse acrolein multiple interactions ISO RGD:1319072 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Prkdc Mouse afimoxifene decreases expression ISO RGD:1319072 6480464 afimoxifene results in decreased expression of PRKDC mRNA CTD PMID:16514628 Prkdc Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PRKDC mRNA CTD PMID:19770486 Prkdc Mouse Aflatoxin B2 alpha affects methylation ISO RGD:1319072 6480464 aflatoxin B2 affects the methylation of PRKDC intron CTD PMID:30157460 Prkdc Mouse all-trans-retinoic acid decreases expression ISO RGD:1319072 6480464 Tretinoin results in decreased expression of PRKDC mRNA CTD PMID:15498508|PMID:33167477 Prkdc Mouse alpha-phellandrene decreases expression EXP 6480464 alpha phellandrene results in decreased expression of PRKDC protein CTD PMID:24861204 Prkdc Mouse alpha-pinene multiple interactions ISO RGD:1319072 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Prkdc Mouse amphetamine decreases expression ISO RGD:1308982 6480464 Amphetamine results in decreased expression of PRKDC mRNA CTD PMID:30779732 Prkdc Mouse aphidicolin multiple interactions ISO RGD:1319072 6480464 Caffeine promotes the reaction [Aphidicolin promotes the reaction [PRKDC protein results in increased phosphorylation of more ... CTD PMID:18158334 Prkdc Mouse arecoline decreases expression ISO RGD:1319072 6480464 Arecoline results in decreased expression of PRKDC mRNA CTD PMID:17682004 Prkdc Mouse aristolochic acid A decreases expression ISO RGD:1319072 6480464 aristolochic acid I results in decreased expression of PRKDC mRNA CTD PMID:33212167 Prkdc Mouse arsane increases response to substance ISO RGD:1319072 6480464 PRKDC mRNA results in increased susceptibility to Arsenic CTD PMID:17976673 Prkdc Mouse arsane multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased secretion of PRKDC more ... CTD PMID:37527016 Prkdc Mouse arsane increases expression ISO RGD:1319072 6480464 Arsenic results in increased expression of PRKDC protein CTD PMID:19818359 Prkdc Mouse arsane decreases expression ISO RGD:1319072 6480464 Arsenic results in decreased expression of PRKDC mRNA; Arsenic results in decreased expression of PRKDC more ... CTD PMID:21332098 Prkdc Mouse arsane multiple interactions ISO RGD:1319072 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:21332098|PMID:39836092 Prkdc Mouse arsenic atom decreases expression ISO RGD:1319072 6480464 Arsenic results in decreased expression of PRKDC mRNA; Arsenic results in decreased expression of PRKDC more ... CTD PMID:21332098 Prkdc Mouse arsenic atom multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased secretion of PRKDC more ... CTD PMID:37527016 Prkdc Mouse arsenic atom increases expression ISO RGD:1319072 6480464 Arsenic results in increased expression of PRKDC protein CTD PMID:19818359 Prkdc Mouse arsenic atom increases response to substance ISO RGD:1319072 6480464 PRKDC mRNA results in increased susceptibility to Arsenic CTD PMID:17976673 Prkdc Mouse arsenic atom multiple interactions ISO RGD:1319072 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:21332098|PMID:39836092 Prkdc Mouse arsenite(3-) increases activity ISO RGD:1319072 6480464 arsenite results in increased activity of PRKDC protein CTD PMID:22366412 Prkdc Mouse arsenite(3-) multiple interactions ISO RGD:1319072 6480464 [[[arsenite results in increased activity of PRKDC protein] which results in increased phosphorylation of and more ... CTD PMID:22366412|PMID:32406909 Prkdc Mouse atrazine decreases expression ISO RGD:1319072 6480464 Atrazine results in decreased expression of PRKDC mRNA CTD PMID:22378314 Prkdc Mouse benzene increases expression ISO RGD:1319072 6480464 Benzene results in increased expression of PRKDC mRNA CTD PMID:20036648 Prkdc Mouse benzene increases expression EXP 6480464 Benzene metabolite results in increased expression of PRKDC mRNA CTD PMID:23940708 Prkdc Mouse benzene affects expression ISO RGD:1319072 6480464 Benzene affects the expression of PRKDC mRNA CTD PMID:16188086 Prkdc Mouse benzo[a]pyrene decreases methylation ISO RGD:1319072 6480464 Benzo(a)pyrene results in decreased methylation of PRKDC 3' UTR CTD PMID:27901495 Prkdc Mouse benzo[a]pyrene affects methylation ISO RGD:1319072 6480464 Benzo(a)pyrene affects the methylation of PRKDC intron CTD PMID:30157460 Prkdc Mouse benzo[a]pyrene decreases expression ISO RGD:1319072 6480464 Benzo(a)pyrene results in decreased expression of PRKDC mRNA CTD PMID:20064835|PMID:20106945|PMID:21632981 Prkdc Mouse benzo[a]pyrene multiple interactions EXP 6480464 PRKDC protein affects the susceptibility to [Caffeine co-treated with Benzo(a)pyrene]; PRKDC protein affects the susceptibility more ... CTD PMID:20888899 Prkdc Mouse benzo[e]pyrene decreases methylation ISO RGD:1319072 6480464 benzo(e)pyrene results in decreased methylation of PRKDC intron CTD PMID:30157460 Prkdc Mouse beta-lapachone decreases expression ISO RGD:1319072 6480464 beta-lapachone results in decreased expression of PRKDC mRNA CTD PMID:38218311 Prkdc Mouse biphenyl-4-amine multiple interactions ISO RGD:1319072 6480464 TP53 protein inhibits the reaction [4-biphenylamine results in decreased expression of PRKDC mRNA] CTD PMID:32905825 Prkdc Mouse biphenyl-4-amine decreases expression ISO RGD:1319072 6480464 4-biphenylamine results in decreased expression of PRKDC mRNA CTD PMID:32905825 Prkdc Mouse bisphenol A increases expression ISO RGD:1319072 6480464 bisphenol A results in increased expression of PRKDC mRNA; bisphenol A results in increased expression more ... CTD PMID:15223131|PMID:34186270|PMID:37567409 Prkdc Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRKDC mRNA CTD PMID:38074096 Prkdc Mouse bisphenol A decreases expression ISO RGD:1308982 6480464 bisphenol A results in decreased expression of PRKDC mRNA CTD PMID:30816183 Prkdc Mouse bisphenol A increases expression ISO RGD:1308982 6480464 bisphenol A results in increased expression of PRKDC mRNA CTD PMID:27208089 Prkdc Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRKDC mRNA CTD PMID:26063408|PMID:33221593 Prkdc Mouse bisphenol A multiple interactions ISO RGD:1319072 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:23227178|PMID:28628672 Prkdc Mouse bisphenol A affects binding ISO RGD:1319072 6480464 bisphenol A binds to PRKDC protein CTD PMID:23227178 Prkdc Mouse Bisphenol A diglycidyl ether affects splicing EXP 6480464 bisphenol A diglycidyl ether affects the splicing of PRKDC mRNA CTD PMID:36464114 Prkdc Mouse bisphenol AF affects splicing EXP 6480464 bisphenol AF affects the splicing of PRKDC mRNA CTD PMID:36464114 Prkdc Mouse bisphenol AF increases expression ISO RGD:1319072 6480464 bisphenol AF results in increased expression of PRKDC protein CTD PMID:34186270 Prkdc Mouse Bisphenol B increases expression ISO RGD:1319072 6480464 bisphenol B results in increased expression of PRKDC protein CTD PMID:34186270 Prkdc Mouse bisphenol F multiple interactions ISO RGD:1319072 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Prkdc Mouse bortezomib decreases expression ISO RGD:1319072 6480464 Bortezomib results in decreased expression of PRKDC mRNA CTD PMID:20977926 Prkdc Mouse bortezomib multiple interactions ISO RGD:1319072 6480464 [CASP8 protein results in increased activity of CASP3 protein] affects the reaction [Bortezomib results in more ... CTD PMID:12393500 Prkdc Mouse bortezomib increases cleavage ISO RGD:1319072 6480464 Bortezomib results in increased cleavage of PRKDC protein CTD PMID:12393500 Prkdc Mouse bromoacetate increases expression ISO RGD:1319072 6480464 bromoacetate results in increased expression of PRKDC mRNA CTD PMID:19753638 Prkdc Mouse butanal decreases expression ISO RGD:1319072 6480464 butyraldehyde results in decreased expression of PRKDC mRNA CTD PMID:26079696 Prkdc Mouse cadmium dichloride decreases expression ISO RGD:1319072 6480464 Cadmium Chloride results in decreased expression of PRKDC mRNA CTD PMID:38568856 Prkdc Mouse caffeine multiple interactions ISO RGD:1319072 6480464 Caffeine promotes the reaction [Aphidicolin promotes the reaction [PRKDC protein results in increased phosphorylation of more ... CTD PMID:18158334 Prkdc Mouse caffeine affects phosphorylation ISO RGD:1319072 6480464 Caffeine affects the phosphorylation of PRKDC protein CTD PMID:35688186 Prkdc Mouse caffeine multiple interactions EXP 6480464 PRKDC protein affects the susceptibility to [Caffeine co-treated with Benzo(a)pyrene] CTD PMID:20888899 Prkdc Mouse capsaicin increases phosphorylation ISO RGD:1319072 6480464 Capsaicin results in increased phosphorylation of PRKDC protein CTD PMID:22226932 Prkdc Mouse capsaicin multiple interactions ISO RGD:1319072 6480464 3-aminobenzamide inhibits the reaction [Capsaicin results in increased phosphorylation of and results in increased activity more ... CTD PMID:22226932 Prkdc Mouse casticin decreases expression ISO RGD:1319072 6480464 casticin results in decreased expression of PRKDC protein CTD PMID:29098808 Prkdc Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of PRKDC mRNA CTD PMID:37019170 Prkdc Mouse chromium atom increases activity ISO RGD:1319072 6480464 Chromium results in increased activity of PRKDC protein CTD PMID:18602874 Prkdc Mouse chromium atom multiple interactions ISO RGD:1319072 6480464 PRKDC protein promotes the reaction [Chromium results in increased stability of and results in increased more ... CTD PMID:18602874 Prkdc Mouse cisplatin multiple interactions EXP 6480464 Cisplatin promotes the reaction [PRKDC protein binds to EGFR protein]; PRKDC protein mutant form promotes more ... CTD PMID:21266349|PMID:21324906 Prkdc Mouse cisplatin increases expression ISO RGD:1319072 6480464 Cisplatin results in increased expression of PRKDC mRNA CTD PMID:25450742 Prkdc Mouse cisplatin increases response to substance EXP 6480464 PRKDC protein mutant form results in increased susceptibility to Cisplatin CTD PMID:21324906 Prkdc Mouse cisplatin multiple interactions ISO RGD:1319072 6480464 [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of PRKDC mRNA; more ... CTD PMID:18546291|PMID:30871063 Prkdc Mouse citalopram decreases expression ISO RGD:1308982 6480464 Citalopram results in decreased expression of PRKDC mRNA CTD PMID:28467792 Prkdc Mouse clofibrate multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of PRKDC mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Prkdc Mouse cobalt dichloride decreases expression ISO RGD:1319072 6480464 cobaltous chloride results in decreased expression of PRKDC mRNA CTD PMID:19320972|PMID:19376846 Prkdc Mouse copper atom multiple interactions ISO RGD:1319072 6480464 [Chelating Agents binds to Copper] which results in decreased expression of PRKDC mRNA CTD PMID:30911355 Prkdc Mouse copper(0) multiple interactions ISO RGD:1319072 6480464 [Chelating Agents binds to Copper] which results in decreased expression of PRKDC mRNA CTD PMID:30911355 Prkdc Mouse coumarin increases phosphorylation ISO RGD:1319072 6480464 coumarin results in increased phosphorylation of PRKDC protein CTD PMID:35688186 Prkdc Mouse coumestrol multiple interactions ISO RGD:1319072 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PRKDC mRNA CTD PMID:19167446 Prkdc Mouse coumestrol increases expression ISO RGD:1319072 6480464 Coumestrol results in increased expression of PRKDC mRNA CTD PMID:19167446 Prkdc Mouse curcumin multiple interactions ISO RGD:1319072 6480464 Curcumin inhibits the reaction [Arsenic results in decreased expression of PRKDC mRNA]; Curcumin inhibits the more ... CTD PMID:21332098 Prkdc Mouse curcumin decreases expression ISO RGD:1319072 6480464 Curcumin results in decreased expression of PRKDC mRNA CTD PMID:17596214 Prkdc Mouse deguelin decreases expression ISO RGD:1319072 6480464 deguelin results in decreased expression of PRKDC mRNA CTD PMID:22227970 Prkdc Mouse dexamethasone multiple interactions ISO RGD:1319072 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Prkdc Mouse Dibutyl phosphate affects expression ISO RGD:1319072 6480464 di-n-butylphosphoric acid affects the expression of PRKDC mRNA CTD PMID:37042841 Prkdc Mouse dibutyl phthalate increases expression ISO RGD:1308982 6480464 Dibutyl Phthalate results in increased expression of PRKDC mRNA CTD PMID:21266533 Prkdc Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PRKDC mRNA CTD PMID:17361019|PMID:21266533 Prkdc Mouse dichlorvos increases expression ISO RGD:1308982 6480464 Dichlorvos results in increased expression of PRKDC mRNA; Dichlorvos results in increased expression of PRKDC more ... CTD PMID:24369695 Prkdc Mouse dichlorvos multiple interactions ISO RGD:1308982 6480464 TEMPOL-H inhibits the reaction [Dichlorvos results in increased expression of PRKDC mRNA] CTD PMID:24369695 Prkdc Mouse dicrotophos increases expression ISO RGD:1319072 6480464 dicrotophos results in increased expression of PRKDC mRNA CTD PMID:28302478 Prkdc Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PRKDC mRNA CTD PMID:30529165 Prkdc Mouse doxorubicin multiple interactions ISO RGD:1319072 6480464 Doxorubicin promotes the reaction [PRKDC protein results in increased phosphorylation of PRKDC protein]; IC486241 inhibits more ... CTD PMID:18508926|PMID:21567185 Prkdc Mouse doxorubicin decreases expression ISO RGD:1319072 6480464 Doxorubicin results in decreased expression of PRKDC mRNA CTD PMID:36634904 Prkdc Mouse doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of PRKDC mRNA CTD PMID:25896364 Prkdc Mouse endosulfan decreases expression ISO RGD:1308982 6480464 Endosulfan results in decreased expression of PRKDC mRNA CTD PMID:29391264 Prkdc Mouse Enterolactone multiple interactions ISO RGD:1319072 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PRKDC mRNA CTD PMID:19167446 Prkdc Mouse enzyme inhibitor multiple interactions ISO RGD:1319072 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Prkdc Mouse etoposide increases phosphorylation ISO RGD:1319072 6480464 Etoposide results in increased phosphorylation of PRKDC protein CTD PMID:17441964 Prkdc Mouse etoposide multiple interactions ISO RGD:1319072 6480464 PRKDC protein promotes the reaction [Etoposide results in increased phosphorylation of SP1 protein] CTD PMID:17441964 Prkdc Mouse folic acid affects expression ISO RGD:1319072 6480464 Folic Acid affects the expression of PRKDC mRNA CTD PMID:16361273 Prkdc Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of PRKDC mRNA CTD PMID:25629700 Prkdc Mouse FR900359 increases phosphorylation ISO RGD:1319072 6480464 FR900359 results in increased phosphorylation of PRKDC protein CTD PMID:37730182 Prkdc Mouse fulvestrant decreases expression ISO RGD:1319072 6480464 fulvestrant results in decreased expression of PRKDC mRNA CTD PMID:16514628 Prkdc Mouse furan decreases expression ISO RGD:1308982 6480464 furan results in decreased expression of PRKDC mRNA CTD PMID:22507866 Prkdc Mouse furfural multiple interactions ISO RGD:1319072 6480464 [Furaldehyde co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of PRKDC protein; [Sodium Chloride more ... CTD PMID:38598786 Prkdc Mouse gallic acid decreases expression ISO RGD:1319072 6480464 Gallic Acid results in decreased expression of PRKDC mRNA CTD PMID:21887735 Prkdc Mouse glyphosate decreases expression ISO RGD:1319072 6480464 Glyphosate results in decreased expression of PRKDC mRNA CTD PMID:31295307 Prkdc Mouse hydrogen peroxide affects expression ISO RGD:1319072 6480464 Hydrogen Peroxide affects the expression of PRKDC mRNA CTD PMID:21179406 Prkdc Mouse hydroquinone increases expression ISO RGD:1319072 6480464 hydroquinone results in increased expression of PRKDC mRNA; hydroquinone results in increased expression of PRKDC more ... CTD PMID:20036648 Prkdc Mouse hydroquinone increases expression EXP 6480464 hydroquinone results in increased expression of PRKDC mRNA CTD PMID:23940708 Prkdc Mouse indometacin multiple interactions ISO RGD:1319072 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Prkdc Mouse irinotecan increases phosphorylation ISO RGD:1319072 6480464 Irinotecan results in increased phosphorylation of PRKDC protein CTD PMID:17441964|PMID:21221710 Prkdc Mouse irinotecan multiple interactions ISO RGD:1319072 6480464 IC486241 inhibits the reaction [Irinotecan results in increased phosphorylation of PRKDC protein] CTD PMID:21221710 Prkdc Mouse ivermectin decreases expression ISO RGD:1319072 6480464 Ivermectin results in decreased expression of PRKDC protein CTD PMID:32959892 Prkdc Mouse josamycin affects response to substance ISO RGD:1319072 6480464 PRKDC protein affects the susceptibility to Josamycin CTD PMID:31915244 Prkdc Mouse lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of PRKDC mRNA CTD PMID:20542052 Prkdc Mouse lipopolysaccharide multiple interactions ISO RGD:1319072 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of PRKDC mRNA CTD PMID:35877022 Prkdc Mouse lycopene decreases expression ISO RGD:1319072 6480464 lycopene results in decreased expression of PRKDC mRNA CTD PMID:16886892 Prkdc Mouse manganese atom multiple interactions ISO RGD:1319072 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Prkdc Mouse manganese(0) multiple interactions ISO RGD:1319072 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Prkdc Mouse manganese(II) chloride multiple interactions ISO RGD:1319072 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Prkdc Mouse methapyrilene decreases methylation ISO RGD:1319072 6480464 Methapyrilene results in decreased methylation of PRKDC intron CTD PMID:30157460 Prkdc Mouse monocrotaline multiple interactions EXP 6480464 [Monocrotaline co-treated with Rifampin co-treated with Phenytoin co-treated with PRKDC gene mutant form] results in more ... CTD PMID:21224054 Prkdc Mouse motexafin gadolinium increases expression ISO RGD:1319072 6480464 motexafin gadolinium results in increased expression of PRKDC mRNA CTD PMID:16357179 Prkdc Mouse myristicin decreases expression ISO RGD:1319072 6480464 myristicin results in decreased expression of PRKDC mRNA CTD PMID:24792648 Prkdc Mouse N-acetyl-L-cysteine increases expression ISO RGD:1319072 6480464 Acetylcysteine results in increased expression of PRKDC protein CTD PMID:31715134 Prkdc Mouse N-acetyl-L-cysteine multiple interactions ISO RGD:1319072 6480464 Acetylcysteine inhibits the reaction [usnic acid results in increased expression of PRKDC protein] CTD PMID:31715134 Prkdc Mouse nickel atom increases expression ISO RGD:1319072 6480464 Nickel results in increased expression of PRKDC mRNA CTD PMID:24768652|PMID:25583101 Prkdc Mouse nickel dichloride affects expression ISO RGD:1308982 6480464 nickel chloride affects the expression of PRKDC mRNA CTD PMID:22546817 Prkdc Mouse nickel dichloride increases expression ISO RGD:1319072 6480464 nickel chloride results in increased expression of PRKDC protein CTD PMID:28472268 Prkdc Mouse ochratoxin A increases expression ISO RGD:1308982 6480464 ochratoxin A results in increased expression of PRKDC mRNA CTD PMID:23358140 Prkdc Mouse ouabain decreases expression ISO RGD:1319072 6480464 Ouabain results in decreased expression of PRKDC protein CTD PMID:31436044 Prkdc Mouse oxaliplatin multiple interactions ISO RGD:1308982 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PRKDC mRNA CTD PMID:25729387 Prkdc Mouse ozone multiple interactions ISO RGD:1319072 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Prkdc Mouse paracetamol multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of PRKDC mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Prkdc Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of PRKDC mRNA CTD PMID:29540258 Prkdc Mouse paracetamol decreases expression ISO RGD:1319072 6480464 Acetaminophen results in decreased expression of PRKDC mRNA CTD PMID:21420995 Prkdc Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRKDC mRNA CTD PMID:36331819 Prkdc Mouse phenol increases expression ISO RGD:1319072 6480464 Phenol results in increased expression of PRKDC; Phenol results in increased expression of PRKDC mRNA; more ... CTD PMID:20036648|PMID:20096274 Prkdc Mouse phenol affects localization ISO RGD:1319072 6480464 Phenol affects the localization of PRKDC protein CTD PMID:20096274 Prkdc Mouse phenytoin multiple interactions EXP 6480464 [Monocrotaline co-treated with Rifampin co-treated with Phenytoin co-treated with PRKDC gene mutant form] results in more ... CTD PMID:21224054 Prkdc Mouse phosphoramide mustard affects expression ISO RGD:1308982 6480464 phosphoramide mustard affects the expression of PRKDC mRNA; phosphoramide mustard affects the expression of PRKDC more ... CTD PMID:25497287 Prkdc Mouse phosphoramide mustard increases expression ISO RGD:1308982 6480464 phosphoramide mustard results in increased expression of PRKDC mRNA CTD PMID:26708502 Prkdc Mouse pifithrin-alpha hydrobromide multiple interactions ISO RGD:1319072 6480464 pifithrin inhibits the reaction [Capsaicin results in increased phosphorylation of PRKDC protein] CTD PMID:22226932 Prkdc Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of PRKDC mRNA; PPARA protein promotes more ... CTD PMID:17950772|PMID:20059764|PMID:20813756 Prkdc Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PRKDC mRNA CTD PMID:17950772|PMID:18301758|PMID:20059764|PMID:20813756|PMID:23811191 Prkdc Mouse quercetin decreases expression ISO RGD:1319072 6480464 Quercetin results in decreased expression of PRKDC mRNA CTD PMID:20596804 Prkdc Mouse quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of PRKDC mRNA CTD PMID:25862958 Prkdc Mouse raloxifene decreases expression ISO RGD:1319072 6480464 Raloxifene Hydrochloride results in decreased expression of PRKDC mRNA CTD PMID:16514628 Prkdc Mouse resveratrol decreases expression ISO RGD:1308982 6480464 Resveratrol results in decreased expression of PRKDC mRNA CTD PMID:33775663 Prkdc Mouse resveratrol multiple interactions ISO RGD:1319072 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PRKDC mRNA CTD PMID:23557933 Prkdc Mouse rifampicin multiple interactions EXP 6480464 [Monocrotaline co-treated with Rifampin co-treated with Phenytoin co-treated with PRKDC gene mutant form] results in more ... CTD PMID:21224054 Prkdc Mouse SB 431542 multiple interactions ISO RGD:1319072 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of PRKDC more ... CTD PMID:37664457 Prkdc Mouse serpentine asbestos multiple interactions EXP 6480464 PRKDC affects the reaction [Asbestos, Serpentine results in increased expression of CCL2 protein]; PRKDC affects more ... CTD PMID:16571779|PMID:17200189 Prkdc Mouse sodium arsenite increases expression ISO RGD:1319072 6480464 sodium arsenite results in increased expression of PRKDC mRNA CTD PMID:28595984 Prkdc Mouse sodium arsenite multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased secretion of PRKDC more ... CTD PMID:37527016 Prkdc Mouse sodium arsenite multiple interactions ISO RGD:1319072 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Prkdc Mouse sodium arsenite decreases expression ISO RGD:1319072 6480464 sodium arsenite results in decreased expression of PRKDC mRNA CTD PMID:38568856 Prkdc Mouse sodium chloride multiple interactions ISO RGD:1319072 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of PRKDC protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 Prkdc Mouse tamibarotene decreases expression ISO RGD:1319072 6480464 tamibarotene results in decreased expression of PRKDC mRNA CTD PMID:15498508 Prkdc Mouse tamibarotene affects expression ISO RGD:1319072 6480464 tamibarotene affects the expression of PRKDC mRNA CTD PMID:15498508 Prkdc Mouse tetrachloromethane multiple interactions ISO RGD:1308982 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PRKDC mRNA] CTD PMID:31150632 Prkdc Mouse tetrachloromethane decreases expression ISO RGD:1308982 6480464 Carbon Tetrachloride results in decreased expression of PRKDC mRNA CTD PMID:31150632 Prkdc Mouse thioacetamide decreases expression ISO RGD:1308982 6480464 Thioacetamide results in decreased expression of PRKDC mRNA CTD PMID:34492290 Prkdc Mouse thiram decreases expression ISO RGD:1319072 6480464 Thiram results in decreased expression of PRKDC mRNA CTD PMID:38568856 Prkdc Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of PRKDC gene CTD PMID:35295148 Prkdc Mouse topotecan decreases expression ISO RGD:1308982 6480464 Topotecan results in decreased expression of PRKDC mRNA CTD PMID:25729387 Prkdc Mouse topotecan multiple interactions ISO RGD:1308982 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of PRKDC mRNA CTD PMID:25729387 Prkdc Mouse trichloroethene decreases expression ISO RGD:1308982 6480464 Trichloroethylene results in decreased expression of PRKDC mRNA CTD PMID:33387578 Prkdc Mouse trichostatin A increases expression ISO RGD:1319072 6480464 trichostatin A results in increased expression of PRKDC mRNA CTD PMID:24935251 Prkdc Mouse triphenyl phosphate affects expression ISO RGD:1319072 6480464 triphenyl phosphate affects the expression of PRKDC mRNA CTD PMID:37042841 Prkdc Mouse trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of PRKDC mRNA CTD PMID:35537566 Prkdc Mouse tungsten decreases expression EXP 6480464 Tungsten results in decreased expression of PRKDC mRNA CTD PMID:30912803 Prkdc Mouse urethane decreases expression ISO RGD:1319072 6480464 Urethane results in decreased expression of PRKDC mRNA CTD PMID:28818685 Prkdc Mouse usnic acid increases expression ISO RGD:1319072 6480464 usnic acid results in increased expression of PRKDC protein CTD PMID:31715134 Prkdc Mouse usnic acid multiple interactions ISO RGD:1319072 6480464 Acetylcysteine inhibits the reaction [usnic acid results in increased expression of PRKDC protein] CTD PMID:31715134 Prkdc Mouse valproic acid affects expression ISO RGD:1319072 6480464 Valproic Acid affects the expression of PRKDC mRNA CTD PMID:25979313 Prkdc Mouse valproic acid increases expression ISO RGD:1319072 6480464 Valproic Acid results in increased expression of PRKDC mRNA CTD PMID:29154799 Prkdc Mouse vinclozolin increases expression ISO RGD:1308982 6480464 vinclozolin results in increased expression of PRKDC mRNA CTD PMID:23034163|PMID:23555832 Prkdc Mouse vincristine increases expression ISO RGD:1319072 6480464 Vincristine results in increased expression of PRKDC mRNA CTD PMID:23649840 Prkdc Mouse vorinostat decreases expression ISO RGD:1319072 6480464 vorinostat results in decreased expression of PRKDC protein CTD PMID:20531243 Prkdc Mouse wortmannin multiple interactions EXP 6480464 PRKDC protein affects the susceptibility to [wortmannin co-treated with Benzo(a)pyrene] CTD PMID:20888899 Prkdc Mouse zinc acetate increases expression ISO RGD:1319072 6480464 Zinc Acetate results in increased expression of PRKDC mRNA CTD PMID:16357179
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
Prkdc Mouse abnormal B cell differentiation IAGP 5509061 MGI PMID:9768755 Prkdc Mouse abnormal B cell physiology IEA 5509061 MGI Prkdc Mouse abnormal brain morphology IAGP 5509061 MGI PMID:17920451 Prkdc Mouse abnormal brainstem morphology IAGP 5509061 MGI PMID:17920451 Prkdc Mouse abnormal CD4-positive T cell differentiation IEA 5509061 MGI Prkdc Mouse abnormal CD4-positive, alpha beta T cell morphology IAGP 5509061 MGI PMID:10725754 Prkdc Mouse abnormal CD4-positive, alpha beta T cell morphology IAGP 5509061 MGI PMID:8094405 Prkdc Mouse abnormal CD8-positive, alpha beta T cell morphology IAGP 5509061 MGI PMID:8094405 Prkdc Mouse abnormal CD8-positive, alpha-beta T cell differentiation IEA 5509061 MGI Prkdc Mouse abnormal cerebellar cortex morphology IAGP 5509061 MGI PMID:17920451 Prkdc Mouse abnormal cerebellum morphology IAGP 5509061 MGI PMID:17920451 Prkdc Mouse abnormal chromosome morphology IAGP 5509061 MGI PMID:12897131 Prkdc Mouse abnormal circulating protein level IAGP 5509061 MGI PMID:7541529 Prkdc Mouse abnormal class switch recombination IAGP 5509061 MGI PMID:19450527 Prkdc Mouse abnormal class switch recombination IAGP 5509061 MGI PMID:22761313 Prkdc Mouse abnormal colon morphology IAGP 5509061 MGI PMID:9990036 Prkdc Mouse abnormal complement pathway IAGP 5509061 MGI PMID:8806787 Prkdc Mouse abnormal complement pathway IAGP 5509061 MGI PMID:7995938 Prkdc Mouse abnormal DNA repair IAGP 5509061 MGI PMID:21482716 Prkdc Mouse abnormal double-positive T cell morphology IAGP 5509061 MGI PMID:8094405 Prkdc Mouse abnormal glucose homeostasis IAGP 5509061 MGI PMID:18563383 Prkdc Mouse abnormal granulocyte morphology IAGP 5509061 MGI PMID:8806787 Prkdc Mouse abnormal hematopoietic stem cell physiology IAGP 5509061 MGI PMID:21482716 Prkdc Mouse abnormal hematopoietic system morphology/development IAGP 5509061 MGI PMID:22773809 Prkdc Mouse abnormal hippocampus morphology IAGP 5509061 MGI PMID:17920451 Prkdc Mouse abnormal homeostasis IAGP 5509061 MGI PMID:17920451 Prkdc Mouse abnormal humoral immune response IAGP 5509061 MGI PMID:6823332 Prkdc Mouse abnormal immune system morphology IAGP 5509061 MGI PMID:22773809 Prkdc Mouse abnormal immune system organ morphology IAGP 5509061 MGI PMID:15879151 Prkdc Mouse abnormal immune system physiology IEA 5509061 MGI Prkdc Mouse abnormal immunoglobulin heavy chain V(D)J recombination IAGP 5509061 MGI PMID:9990036 Prkdc Mouse abnormal immunoglobulin heavy chain V(D)J recombination IAGP 5509061 MGI PMID:9768755 Prkdc Mouse abnormal immunoglobulin light chain V-J recombination IAGP 5509061 MGI PMID:9768755 Prkdc Mouse abnormal immunoglobulin V(D)J recombination IAGP 5509061 MGI PMID:21482716 Prkdc Mouse abnormal intestinal epithelium morphology IAGP 5509061 MGI PMID:11884426 Prkdc Mouse abnormal intromission IAGP 5509061 MGI PMID:17478551 Prkdc Mouse abnormal kidney morphology IAGP 5509061 MGI PMID:15699352 Prkdc Mouse abnormal large intestine crypts of Lieberkuhn morphology IAGP 5509061 MGI PMID:9990036 Prkdc Mouse abnormal level of surface class II molecules IAGP 5509061 MGI PMID:8806787 Prkdc Mouse abnormal lymph node B cell domain morphology IAGP 5509061 MGI PMID:8806787 Prkdc Mouse abnormal lymph node morphology IAGP 5509061 MGI PMID:8806787 Prkdc Mouse abnormal lymph node morphology IAGP 5509061 MGI PMID:9990036 Prkdc Mouse abnormal lymph node morphology IAGP 5509061 MGI PMID:15879151 Prkdc Mouse abnormal lymph node morphology IAGP 5509061 MGI PMID:7995938 Prkdc Mouse abnormal lymphocyte morphology IEA 5509061 MGI Prkdc Mouse abnormal motor learning IAGP 5509061 MGI PMID:17920451 Prkdc Mouse abnormal neutrophil morphology IAGP 5509061 MGI PMID:8806787 Prkdc Mouse abnormal NK cell physiology IAGP 5509061 MGI PMID:9103418 Prkdc Mouse abnormal NK cell physiology IAGP 5509061 MGI PMID:9834083 Prkdc Mouse abnormal NK cell physiology IAGP 5509061 MGI PMID:8806787 Prkdc Mouse abnormal pancreatic islet morphology IAGP 5509061 MGI PMID:23747725 Prkdc Mouse abnormal Peyer's patch morphology IAGP 5509061 MGI PMID:8806787 Prkdc Mouse abnormal professional antigen presenting cell morphology IAGP 5509061 MGI PMID:17662890 Prkdc Mouse abnormal response to transplant IAGP 5509061 MGI PMID:9103418 Prkdc Mouse abnormal response to transplant IAGP 5509061 MGI PMID:15308121 Prkdc Mouse abnormal response to transplant IAGP 5509061 MGI PMID:18785974 Prkdc Mouse abnormal response to transplant IAGP 5509061 MGI PMID:15879151 Prkdc Mouse abnormal response to transplant IAGP 5509061 MGI PMID:7995938 Prkdc Mouse abnormal response to transplant IAGP 5509061 MGI PMID:15591949 Prkdc Mouse abnormal response to transplant IAGP 5509061 MGI PMID:10809058 Prkdc Mouse abnormal response to transplant IAGP 5509061 MGI PMID:11777954 Prkdc Mouse abnormal single-positive T cell number IAGP 5509061 MGI PMID:8094405 Prkdc Mouse abnormal spermatogenesis IAGP 5509061 MGI PMID:17478551 Prkdc Mouse abnormal spleen morphology IAGP 5509061 MGI PMID:9990036 Prkdc Mouse abnormal spleen white pulp morphology IAGP 5509061 MGI PMID:6823332 Prkdc Mouse abnormal spleen white pulp morphology IAGP 5509061 MGI PMID:8806787 Prkdc Mouse abnormal spleen white pulp morphology IAGP 5509061 MGI PMID:7995938 Prkdc Mouse abnormal spleen white pulp morphology IAGP 5509061 MGI PMID:15879151 Prkdc Mouse abnormal splenic cell ratio IAGP 5509061 MGI PMID:15879151 Prkdc Mouse abnormal splenocyte morphology IAGP 5509061 MGI PMID:15308121 Prkdc Mouse abnormal striatum morphology IAGP 5509061 MGI PMID:17920451 Prkdc Mouse abnormal T cell differentiation IAGP 5509061 MGI PMID:8094405 Prkdc Mouse abnormal T cell differentiation IAGP 5509061 MGI PMID:9768755 Prkdc Mouse abnormal T cell number IAGP 5509061 MGI PMID:9768755 Prkdc Mouse abnormal T cell receptor alpha chain V-J recombination IAGP 5509061 MGI PMID:9768755 Prkdc Mouse abnormal T cell receptor beta chain V(D)J recombination IAGP 5509061 MGI PMID:9768756 Prkdc Mouse abnormal T cell receptor beta chain V(D)J recombination IAGP 5509061 MGI PMID:9768755 Prkdc Mouse abnormal T cell receptor beta chain V(D)J recombination IAGP 5509061 MGI PMID:9990036 Prkdc Mouse abnormal T cell receptor delta chain V(D)J recombination IAGP 5509061 MGI PMID:9990036 Prkdc Mouse abnormal T cell receptor delta chain V(D)J recombination IAGP 5509061 MGI PMID:9768755 Prkdc Mouse abnormal T cell receptor V(D)J recombination IAGP 5509061 MGI PMID:9768756 Prkdc Mouse abnormal thymus corticomedullary boundary morphology IAGP 5509061 MGI PMID:7995938 Prkdc Mouse abnormal thymus corticomedullary boundary morphology IAGP 5509061 MGI PMID:9768755 Prkdc Mouse abnormal thymus lobule morphology IAGP 5509061 MGI PMID:7995938 Prkdc Mouse abnormal thymus morphology IAGP 5509061 MGI PMID:10805749 Prkdc Mouse abnormal thymus morphology IAGP 5509061 MGI PMID:15879151 Prkdc Mouse abnormal thymus morphology IAGP 5509061 MGI PMID:8806787 Prkdc Mouse abnormal thymus morphology IAGP 5509061 MGI PMID:6823332 Prkdc Mouse abnormal vertebral column morphology IAGP 5509061 MGI PMID:17668421 Prkdc Mouse abnormal zygomatic bone morphology IAGP 5509061 MGI PMID:17920451 Prkdc Mouse absent B cells IAGP 5509061 MGI PMID:6823332 Prkdc Mouse absent CD4-positive, alpha-beta T cells IAGP 5509061 MGI PMID:17668421 Prkdc Mouse absent CD8-positive, alpha-beta T cells IAGP 5509061 MGI PMID:17668421 Prkdc Mouse absent lymphocyte IAGP 5509061 MGI PMID:9103418 Prkdc Mouse absent mature B cells IAGP 5509061 MGI PMID:9990036 Prkdc Mouse absent Peyer's patches IAGP 5509061 MGI PMID:6823332 Prkdc Mouse absent Peyer's patches IAGP 5509061 MGI PMID:9990036 Prkdc Mouse absent pre-B cells IAGP 5509061 MGI PMID:9768756 Prkdc Mouse absent pre-B cells IAGP 5509061 MGI PMID:6823332 Prkdc Mouse absent seminal vesicle IAGP 5509061 MGI PMID:7541529 Prkdc Mouse absent T cells IAGP 5509061 MGI PMID:17662890 Prkdc Mouse absent thymus cortex IAGP 5509061 MGI PMID:6823332 Prkdc Mouse absent thymus corticomedullary boundary IAGP 5509061 MGI PMID:9990036 Prkdc Mouse arrested B cell differentiation IAGP 5509061 MGI PMID:9768756 Prkdc Mouse arrested B cell differentiation IAGP 5509061 MGI PMID:21482716 Prkdc Mouse arrested B cell differentiation IAGP 5509061 MGI PMID:9768755 Prkdc Mouse arrested B cell differentiation IAGP 5509061 MGI PMID:9990036 Prkdc Mouse arrested B cell differentiation IAGP 5509061 MGI PMID:9103418 Prkdc Mouse arrested T cell differentiation IAGP 5509061 MGI PMID:9768756 Prkdc Mouse arrested T cell differentiation IAGP 5509061 MGI PMID:9768755 Prkdc Mouse arrested T cell differentiation IAGP 5509061 MGI PMID:9103418 Prkdc Mouse broad head IAGP 5509061 MGI PMID:17920451 Prkdc Mouse cecum inflammation IEA 5509061 MGI Prkdc Mouse centrally nucleated skeletal muscle fibers IAGP 5509061 MGI PMID:17668421 Prkdc Mouse colitis IEA 5509061 MGI Prkdc Mouse decreased alpha-beta T cell number IEA 5509061 MGI Prkdc Mouse decreased B cell number IAGP 5509061 MGI PMID:7995938 Prkdc Mouse decreased B cell number IAGP 5509061 MGI PMID:17668421 Prkdc Mouse decreased B cell number IAGP 5509061 MGI PMID:22761313 Prkdc Mouse decreased B cell number IAGP 5509061 MGI PMID:8806787 Prkdc Mouse decreased B cell proliferation IAGP 5509061 MGI PMID:6823332 Prkdc Mouse decreased B-1 B cell number IEA 5509061 MGI Prkdc Mouse decreased B-1a cell number IEA 5509061 MGI Prkdc Mouse decreased body size IAGP 5509061 MGI PMID:17478551 Prkdc Mouse decreased body weight IAGP 5509061 MGI PMID:17478551 Prkdc Mouse decreased bone marrow cell number IAGP 5509061 MGI PMID:7995938 Prkdc Mouse decreased bone marrow cell number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased CD4-positive, alpha-beta T cell number IAGP 5509061 MGI PMID:15879151 Prkdc Mouse decreased CD4-positive, alpha-beta T cell number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased CD4-positive, alpha-beta T cell number IAGP 5509061 MGI PMID:8806787 Prkdc Mouse decreased CD4-positive, alpha-beta T cell number IAGP 5509061 MGI PMID:7995938 Prkdc Mouse decreased CD8-positive, alpha-beta T cell number IAGP 5509061 MGI PMID:15879151 Prkdc Mouse decreased CD8-positive, alpha-beta T cell number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased CD8-positive, alpha-beta T cell number IAGP 5509061 MGI PMID:8806787 Prkdc Mouse decreased CD8-positive, alpha-beta T cell number IAGP 5509061 MGI PMID:7995938 Prkdc Mouse decreased CD8-positive, naive alpha-beta T cell number IEA 5509061 MGI Prkdc Mouse decreased circulating follicle stimulating hormone level IAGP 5509061 MGI PMID:17478551 Prkdc Mouse decreased circulating insulin level IAGP 5509061 MGI PMID:23747725 Prkdc Mouse decreased circulating luteinizing hormone level IAGP 5509061 MGI PMID:17478551 Prkdc Mouse decreased circulating testosterone level IAGP 5509061 MGI PMID:7541529 Prkdc Mouse decreased circulating testosterone level IAGP 5509061 MGI PMID:17478551 Prkdc Mouse decreased double-negative T cell number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased double-positive T cell number IAGP 5509061 MGI PMID:9768756 Prkdc Mouse decreased double-positive T cell number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased effector memory CD4-positive, alpha-beta T cell number IEA 5509061 MGI Prkdc Mouse decreased elongated spermatid number IAGP 5509061 MGI PMID:17478551 Prkdc Mouse decreased erythrocyte cell number IAGP 5509061 MGI PMID:7995938 Prkdc Mouse decreased erythrocyte cell number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased gamma-delta T cell number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased granulocyte number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased hematopoietic stem cell number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased IgG level IAGP 5509061 MGI PMID:6823332 Prkdc Mouse decreased IgG level IAGP 5509061 MGI PMID:22761313 Prkdc Mouse decreased IgM level IAGP 5509061 MGI PMID:9768755 Prkdc Mouse decreased IgM level IAGP 5509061 MGI PMID:22761313 Prkdc Mouse decreased immature B cell number IAGP 5509061 MGI PMID:15879151 Prkdc Mouse decreased immunoglobulin level IAGP 5509061 MGI PMID:7995938 Prkdc Mouse decreased immunoglobulin level IAGP 5509061 MGI PMID:15879151 Prkdc Mouse decreased immunoglobulin level IAGP 5509061 MGI PMID:8806787 Prkdc Mouse decreased immunoglobulin level IAGP 5509061 MGI PMID:6823332 Prkdc Mouse decreased incidence of tumors by ionizing radiation induction IAGP 5509061 MGI PMID:15879151 Prkdc Mouse decreased kidney weight IAGP 5509061 MGI PMID:7541529 Prkdc Mouse decreased leukocyte cell number IAGP 5509061 MGI PMID:6823332 Prkdc Mouse decreased leukocyte cell number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased leukocyte cell number IAGP 5509061 MGI PMID:15879151 Prkdc Mouse decreased level of surface class I molecules IAGP 5509061 MGI PMID:9103418 Prkdc Mouse decreased level of surface class I molecules IAGP 5509061 MGI PMID:7995938 Prkdc Mouse decreased liver weight IAGP 5509061 MGI PMID:7541529 Prkdc Mouse decreased lymphocyte cell number IAGP 5509061 MGI PMID:7995938 Prkdc Mouse decreased lymphocyte cell number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased lymphocyte cell number IAGP 5509061 MGI PMID:8806787 Prkdc Mouse decreased macrophage cell number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased mature B cell number IAGP 5509061 MGI PMID:15879151 Prkdc Mouse decreased mature B cell number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased mean corpuscular hemoglobin concentration IEA 5509061 MGI Prkdc Mouse decreased mean corpuscular volume IAGP 5509061 MGI PMID:15879151 Prkdc Mouse decreased mounting behavior IAGP 5509061 MGI PMID:17478551 Prkdc Mouse decreased NK cell number IAGP 5509061 MGI PMID:7995938 Prkdc Mouse decreased NK cell number IAGP 5509061 MGI PMID:15879151 Prkdc Mouse decreased NK T cell number IEA 5509061 MGI Prkdc Mouse decreased pancreatic beta cell number IAGP 5509061 MGI PMID:23747725 Prkdc Mouse decreased pre-B cell number IAGP 5509061 MGI PMID:7995938 Prkdc Mouse decreased pre-B cell number IAGP 5509061 MGI PMID:8806787 Prkdc Mouse decreased retroperitoneal fat pad weight IAGP 5509061 MGI PMID:17478551 Prkdc Mouse decreased single-positive T cell number IAGP 5509061 MGI PMID:9768755 Prkdc Mouse decreased spleen B cell follicle number IAGP 5509061 MGI PMID:15879151 Prkdc Mouse decreased spleen weight IAGP 5509061 MGI PMID:17478551 Prkdc Mouse decreased spleen white pulp amount IAGP 5509061 MGI PMID:9768755 Prkdc Mouse decreased splenocyte number IAGP 5509061 MGI PMID:31795137 Prkdc Mouse decreased susceptibility to autoimmune diabetes IAGP 5509061 MGI PMID:12525697 Prkdc Mouse decreased susceptibility to autoimmune diabetes IAGP 5509061 MGI PMID:12361980 Prkdc Mouse decreased susceptibility to bacterial infection IAGP 5509061 MGI PMID:15470055 Prkdc Mouse decreased susceptibility to graft versus host disease IAGP 5509061 MGI PMID:15591949 Prkdc Mouse decreased T cell number IAGP 5509061 MGI PMID:7995938 Prkdc Mouse decreased T cell number IAGP 5509061 MGI PMID:21482716 Prkdc Mouse decreased T cell number IAGP 5509061 MGI PMID:8806787 Prkdc Mouse decreased T cell proliferation IAGP 5509061 MGI PMID:6823332 Prkdc Mouse decreased telomere length IAGP 5509061 MGI PMID:12897131 Prkdc Mouse decreased testes secretion IAGP 5509061 MGI PMID:17478551 Prkdc Mouse decreased thymocyte apoptosis IAGP 5509061 MGI PMID:10677503 Prkdc Mouse decreased thymocyte number IAGP 5509061 MGI PMID:9768756 Prkdc Mouse decreased transforming growth factor beta level IAGP 5509061 MGI PMID:17668421 Prkdc Mouse decreased tumor incidence IAGP 5509061 MGI PMID:7541529 Prkdc Mouse decreased tumor incidence IAGP 5509061 MGI PMID:9584189 Prkdc Mouse decreased tumor incidence IAGP 5509061 MGI PMID:8339285 Prkdc Mouse diarrhea IEA 5509061 MGI Prkdc Mouse dilated renal tubule IAGP 5509061 MGI PMID:15699352 Prkdc Mouse enhanced humoral immune response IEA 5509061 MGI Prkdc Mouse enlarged mesenteric lymph nodes IEA 5509061 MGI Prkdc Mouse enophthalmos IAGP 5509061 MGI PMID:17920451 Prkdc Mouse extended life span IAGP 5509061 MGI PMID:17662890 Prkdc Mouse failure of copulatory plug deposition IAGP 5509061 MGI PMID:17478551 Prkdc Mouse failure of ejaculation IAGP 5509061 MGI PMID:17478551 Prkdc Mouse female infertility IAGP 5509061 MGI PMID:17920451 Prkdc Mouse glomerulosclerosis IAGP 5509061 MGI PMID:15699352 Prkdc Mouse hyperglycemia IAGP 5509061 MGI PMID:18563383 Prkdc Mouse hyperglycemia IAGP 5509061 MGI PMID:23747725 Prkdc Mouse hyperpigmentation IAGP 5509061 MGI PMID:21482716 Prkdc Mouse impaired complement classical pathway IAGP 5509061 MGI PMID:7995938 Prkdc Mouse impaired coordination IAGP 5509061 MGI PMID:17920451 Prkdc Mouse impaired exercise endurance IAGP 5509061 MGI PMID:17668421 Prkdc Mouse impaired humoral immune response IEA 5509061 MGI Prkdc Mouse impaired natural killer cell mediated cytotoxicity IAGP 5509061 MGI PMID:8806787 Prkdc Mouse impaired natural killer cell mediated cytotoxicity IAGP 5509061 MGI PMID:7995938 Prkdc Mouse impaired skeletal muscle contractility IAGP 5509061 MGI PMID:17668421 Prkdc Mouse increased alpha-beta T cell number IEA 5509061 MGI Prkdc Mouse increased B cell number IEA 5509061 MGI Prkdc Mouse increased B-1b cell number IEA 5509061 MGI Prkdc Mouse increased body weight IEA 5509061 MGI Prkdc Mouse increased bone marrow cell number IEA 5509061 MGI Prkdc Mouse increased CD4-positive, alpha-beta T cell number IEA 5509061 MGI Prkdc Mouse increased CD8-positive, alpha-beta T cell number IEA 5509061 MGI Prkdc Mouse increased cellular sensitivity to alkylating agents IAGP 5509061 MGI PMID:21482716 Prkdc Mouse increased cellular sensitivity to gamma-irradiation IAGP 5509061 MGI PMID:11280730 Prkdc Mouse increased cellular sensitivity to gamma-irradiation IAGP 5509061 MGI PMID:9768755 Prkdc Mouse increased cellular sensitivity to gamma-irradiation IAGP 5509061 MGI PMID:9990036 Prkdc Mouse increased cellular sensitivity to gamma-irradiation IAGP 5509061 MGI PMID:10805749 Prkdc Mouse increased cellular sensitivity to ionizing radiation IAGP 5509061 MGI PMID:9768756 Prkdc Mouse increased cellular sensitivity to ionizing radiation IAGP 5509061 MGI PMID:21482716 Prkdc Mouse increased cellular sensitivity to ultraviolet irradiation IAGP 5509061 MGI PMID:21482716 Prkdc Mouse increased cellular sensitivity to X-ray irradiation IAGP 5509061 MGI PMID:15879151 Prkdc Mouse increased central memory CD4-positive, alpha-beta T cell number IEA 5509061 MGI Prkdc Mouse increased central memory CD8 positive, alpha-beta T cell number IEA 5509061 MGI Prkdc Mouse increased circulating glucose level IAGP 5509061 MGI PMID:15308121 Prkdc Mouse increased circulating phosphate level IEA 5509061 MGI Prkdc Mouse increased double-negative T cell number IAGP 5509061 MGI PMID:9768755 Prkdc Mouse increased double-positive T cell number IAGP 5509061 MGI PMID:9768755 Prkdc Mouse increased effector memory CD4-positive, alpha-beta T cell number IEA 5509061 MGI Prkdc Mouse increased effector memory CD8-positive, alpha-beta T cell number IEA 5509061 MGI Prkdc Mouse increased eosinophil cell number IAGP 5509061 MGI PMID:8806787 Prkdc Mouse increased granulocyte number IAGP 5509061 MGI PMID:7995938 Prkdc Mouse increased granulocyte number IAGP 5509061 MGI PMID:8806787 Prkdc Mouse increased IgM level IEA 5509061 MGI Prkdc Mouse increased incidence of tumors by ionizing radiation induction IAGP 5509061 MGI PMID:12750251 Prkdc Mouse increased length of allograft survival IAGP 5509061 MGI PMID:6823332 Prkdc Mouse increased length of allograft survival IAGP 5509061 MGI PMID:7995938 Prkdc Mouse increased liver iron level IAGP 5509061 MGI PMID:9103418 Prkdc Mouse increased lung weight IAGP 5509061 MGI PMID:17478551 Prkdc Mouse increased macrophage cell number IAGP 5509061 MGI PMID:9103418 Prkdc Mouse increased macrophage cell number IAGP 5509061 MGI PMID:8806787 Prkdc Mouse increased macrophage cell number IAGP 5509061 MGI PMID:7995938 Prkdc Mouse increased mean corpuscular volume IAGP 5509061 MGI PMID:7995938 Prkdc Mouse increased monocyte cell number IAGP 5509061 MGI PMID:8806787 Prkdc Mouse increased mortality induced by gamma-irradiation IAGP 5509061 MGI PMID:10805749 Prkdc Mouse increased mortality induced by ionizing radiation IAGP 5509061 MGI PMID:21482716 Prkdc Mouse increased neutrophil cell number IAGP 5509061 MGI PMID:8806787 Prkdc Mouse increased NK cell number IAGP 5509061 MGI PMID:8806787 Prkdc Mouse increased NK cell number IAGP 5509061 MGI PMID:9768755 Prkdc Mouse increased physiological sensitivity to xenobiotic IAGP 5509061 MGI PMID:15699352 Prkdc Mouse increased plasma cell number IEA 5509061 MGI Prkdc Mouse increased plasmacytoid dendritic cell number IEA 5509061 MGI Prkdc Mouse increased sensitivity to induced cell death IAGP 5509061 MGI PMID:21482716 Prkdc Mouse increased skeletal muscle fiber diameter IAGP 5509061 MGI PMID:17668421 Prkdc Mouse increased small intestinal crypt cell apoptosis IAGP 5509061 MGI PMID:21482716 Prkdc Mouse increased susceptibility to autoimmune diabetes IAGP 5509061 MGI PMID:10725754 Prkdc Mouse increased susceptibility to autoimmune diabetes IAGP 5509061 MGI PMID:12525697 Prkdc Mouse increased susceptibility to autoimmune diabetes IAGP 5509061 MGI PMID:11120869 Prkdc Mouse increased susceptibility to infection IAGP 5509061 MGI PMID:8320959 Prkdc Mouse increased T cell derived lymphoma incidence IAGP 5509061 MGI PMID:9103418 Prkdc Mouse increased T cell derived lymphoma incidence IAGP 5509061 MGI PMID:9990036 Prkdc Mouse increased T cell derived lymphoma incidence IAGP 5509061 MGI PMID:7589844 Prkdc Mouse increased T cell derived lymphoma incidence IAGP 5509061 MGI PMID:7995938 Prkdc Mouse increased T cell derived lymphoma incidence IAGP 5509061 MGI PMID:15879151 Prkdc Mouse increased T cell derived lymphoma incidence IAGP 5509061 MGI PMID:6823332 Prkdc Mouse increased T cell number IEA 5509061 MGI Prkdc Mouse increased thymoma incidence IAGP 5509061 MGI PMID:9584189 Prkdc Mouse increased urine glycosaminoglycan level IAGP 5509061 MGI PMID:17920451 Prkdc Mouse increased urine protein level IAGP 5509061 MGI PMID:15699352 Prkdc Mouse interstitial pneumonia IEA 5509061 MGI Prkdc Mouse intestine polyps IAGP 5509061 MGI PMID:9990036 Prkdc Mouse liver inflammation IEA 5509061 MGI Prkdc Mouse lymph node hyperplasia IEA 5509061 MGI Prkdc Mouse lymph node hypoplasia IAGP 5509061 MGI PMID:6823332 Prkdc Mouse lymph node hypoplasia IAGP 5509061 MGI PMID:15879151 Prkdc Mouse lymphoid hypoplasia IAGP 5509061 MGI PMID:6823332 Prkdc Mouse male infertility IAGP 5509061 MGI PMID:17478551 Prkdc Mouse myeloid hyperplasia IEA 5509061 MGI Prkdc Mouse oligozoospermia IAGP 5509061 MGI PMID:17478551 Prkdc Mouse pallor IAGP 5509061 MGI PMID:21482716 Prkdc Mouse pancytopenia IAGP 5509061 MGI PMID:21482716 Prkdc Mouse postnatal lethality, incomplete penetrance IAGP 5509061 MGI PMID:21482716 Prkdc Mouse premature death IAGP 5509061 MGI PMID:9584189 Prkdc Mouse premature death IAGP 5509061 MGI PMID:21482716 Prkdc Mouse premature death IAGP 5509061 MGI PMID:15879151 Prkdc Mouse premature death IAGP 5509061 MGI PMID:7995938 Prkdc Mouse premature death IAGP 5509061 MGI PMID:6823332 Prkdc Mouse premature death IAGP 5509061 MGI PMID:9103418 Prkdc Mouse preneoplasia IAGP 5509061 MGI PMID:9990036 Prkdc Mouse pup cannibalization IAGP 5509061 MGI PMID:17920451 Prkdc Mouse reduced fertility IAGP 5509061 MGI PMID:17668421 Prkdc Mouse rough coat IAGP 5509061 MGI PMID:17920451 Prkdc Mouse salivary gland inflammation IAGP 5509061 MGI PMID:7957574 Prkdc Mouse short snout IAGP 5509061 MGI PMID:17920451 Prkdc Mouse skeletal muscle fiber degeneration IAGP 5509061 MGI PMID:17668421 Prkdc Mouse skeletal muscle fibrosis IAGP 5509061 MGI PMID:17668421 Prkdc Mouse slow postnatal weight gain IAGP 5509061 MGI PMID:21482716 Prkdc Mouse small ears IAGP 5509061 MGI PMID:17920451 Prkdc Mouse small lymph nodes IAGP 5509061 MGI PMID:15879151 Prkdc Mouse small lymph nodes IAGP 5509061 MGI PMID:9768755 Prkdc Mouse small lymph nodes IAGP 5509061 MGI PMID:9990036 Prkdc Mouse small lymphoid organs IAGP 5509061 MGI PMID:6823332 Prkdc Mouse small lymphoid organs IAGP 5509061 MGI PMID:21482716 Prkdc Mouse small Peyer's patches IAGP 5509061 MGI PMID:8806787 Prkdc Mouse small Peyer's patches IAGP 5509061 MGI PMID:9990036 Prkdc Mouse small salivary gland IAGP 5509061 MGI PMID:7541529 Prkdc Mouse small seminiferous tubules IAGP 5509061 MGI PMID:17478551 Prkdc Mouse small spleen IAGP 5509061 MGI PMID:9990036 Prkdc Mouse small thymus IAGP 5509061 MGI PMID:6823332 Prkdc Mouse small thymus IAGP 5509061 MGI PMID:9990036 Prkdc Mouse small thymus IAGP 5509061 MGI PMID:8806787 Prkdc Mouse spleen hypoplasia IAGP 5509061 MGI PMID:15879151 Prkdc Mouse spleen hypoplasia IAGP 5509061 MGI PMID:9768755 Prkdc Mouse spleen hypoplasia IAGP 5509061 MGI PMID:8806787 Prkdc Mouse spleen hypoplasia IAGP 5509061 MGI PMID:7995938 Prkdc Mouse stomach inflammation IAGP 5509061 MGI PMID:10878379 Prkdc Mouse thrombocytopenia IAGP 5509061 MGI PMID:21482716 Prkdc Mouse thymus cyst IAGP 5509061 MGI PMID:8806787 Prkdc Mouse thymus cyst IAGP 5509061 MGI PMID:7995938 Prkdc Mouse thymus cyst IAGP 5509061 MGI PMID:6823332 Prkdc Mouse thymus cyst IAGP 5509061 MGI PMID:15879151 Prkdc Mouse thymus hypoplasia IAGP 5509061 MGI PMID:9990036 Prkdc Mouse thymus hypoplasia IAGP 5509061 MGI PMID:9768755
(+)-schisandrin B (ISO) (-)-alpha-phellandrene (EXP) (-)-demecolcine (ISO) (1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-nitropyrene (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4,6-tribromophenol (ISO) 2,6-dimethoxyphenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-aminobenzamide (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-Nitrofluoranthene (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-amino-1,8-naphthalimide (EXP) 4-hydroxynon-2-enal (ISO) 4-nitrophenol (EXP) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 7,12-dimethyltetraphene (EXP) acrolein (ISO) afimoxifene (ISO) aflatoxin B1 (EXP) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) alpha-phellandrene (EXP) alpha-pinene (ISO) amphetamine (ISO) aphidicolin (ISO) arecoline (ISO) aristolochic acid A (ISO) arsane (EXP,ISO) arsenic atom (EXP,ISO) arsenite(3-) (ISO) atrazine (ISO) benzene (EXP,ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) biphenyl-4-amine (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (EXP) bisphenol AF (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) bortezomib (ISO) bromoacetate (ISO) butanal (ISO) cadmium dichloride (ISO) caffeine (EXP,ISO) capsaicin (ISO) casticin (ISO) chlorpyrifos (EXP) chromium atom (ISO) cisplatin (EXP,ISO) citalopram (ISO) clofibrate (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) coumarin (ISO) coumestrol (ISO) curcumin (ISO) deguelin (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dichlorvos (ISO) dicrotophos (ISO) dioxygen (EXP) doxorubicin (EXP,ISO) endosulfan (ISO) Enterolactone (ISO) enzyme inhibitor (ISO) etoposide (ISO) folic acid (EXP,ISO) FR900359 (ISO) fulvestrant (ISO) furan (ISO) furfural (ISO) gallic acid (ISO) glyphosate (ISO) hydrogen peroxide (ISO) hydroquinone (EXP,ISO) indometacin (ISO) irinotecan (ISO) ivermectin (ISO) josamycin (ISO) lead diacetate (EXP) lipopolysaccharide (ISO) lycopene (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) monocrotaline (EXP) motexafin gadolinium (ISO) myristicin (ISO) N-acetyl-L-cysteine (ISO) nickel atom (ISO) nickel dichloride (ISO) ochratoxin A (ISO) ouabain (ISO) oxaliplatin (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (EXP) phenol (ISO) phenytoin (EXP) phosphoramide mustard (ISO) pifithrin-alpha hydrobromide (ISO) pirinixic acid (EXP) quercetin (EXP,ISO) raloxifene (ISO) resveratrol (ISO) rifampicin (EXP) SB 431542 (ISO) serpentine asbestos (EXP) sodium arsenite (EXP,ISO) sodium chloride (ISO) tamibarotene (ISO) tetrachloromethane (ISO) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) topotecan (ISO) trichloroethene (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) trovafloxacin (EXP) tungsten (EXP) urethane (ISO) usnic acid (ISO) valproic acid (ISO) vinclozolin (ISO) vincristine (ISO) vorinostat (ISO) wortmannin (EXP) zinc acetate (ISO)
Biological Process
activation of innate immune response (IEA,ISO) B cell lineage commitment (IMP) brain development (IGI) cellular response to insulin stimulus (IEA,ISO) chromatin remodeling (IEA) DNA damage response (ISO,ISS) double-strand break repair (IBA,IMP,ISO) double-strand break repair via nonhomologous end joining (IMP,NAS) ectopic germ cell programmed cell death (IMP) heart development (IGI) immature B cell differentiation (IMP) immunoglobulin production (ISO) immunoglobulin V(D)J recombination (IBA,IMP) innate immune response (IEA) intrinsic apoptotic signaling pathway in response to DNA damage (IBA,IMP) lymphocyte differentiation (IMP) maturation of 5.8S rRNA (ISO,ISS) mitotic G1 DNA damage checkpoint signaling (ISO,ISS) negative regulation of apoptotic process (IEA,ISO) negative regulation of cellular senescence (IEA,ISO) negative regulation of cGAS/STING signaling pathway (IEA,ISO) negative regulation of immunoglobulin production (IEA,ISO) negative regulation of protein phosphorylation (IMP) negative regulation of response to gamma radiation (IEA,ISO) peptidyl-serine phosphorylation (ISO,ISS) peptidyl-threonine phosphorylation (ISO,ISS) positive regulation of apoptotic process (IMP) positive regulation of developmental growth (IEA,ISO) positive regulation of double-strand break repair via nonhomologous end joining (ISO,ISS) positive regulation of erythrocyte differentiation (IMP) positive regulation of fibroblast proliferation (IEA,ISO) positive regulation of immune system process (ISO) positive regulation of lymphocyte differentiation (IMP) positive regulation of platelet formation (IMP) positive regulation of transcription by RNA polymerase II (IEA,ISO) positive regulation of translation (IMP) pro-B cell differentiation (IMP) protein destabilization (IDA) protein phosphorylation (ISO) regulation of circadian rhythm (IMP) regulation of epithelial cell proliferation (IEA,ISO) regulation of hematopoietic stem cell differentiation (IMP) regulation of smooth muscle cell proliferation (ISO,ISS) response to activity (IEA,ISO) response to gamma radiation (IMP) response to ionizing radiation (IMP) rhythmic process (IEA) small-subunit processome assembly (ISO,ISS) somitogenesis (IGI) spleen development (IEA,ISO) T cell differentiation in thymus (IMP) T cell lineage commitment (IMP) T cell receptor V(D)J recombination (IMP) telomere capping (IEA,ISO) telomere maintenance (IBA,IMP) thymus development (IEA,ISO) V(D)J recombination (IGI)
Cellular Component
chromatin (IEA,ISO) cytosol (IEA) DNA-dependent protein kinase complex (ISO) DNA-dependent protein kinase-DNA ligase 4 complex (ISO,ISS) nonhomologous end joining complex (ISO,ISS) nucleolus (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IBA,IDA,ISO) protein-containing complex (ISO) protein-DNA complex (IEA,ISO) small-subunit processome (ISO,ISS) transcription regulator complex (IEA,ISO)
Mammalian Phenotype
abnormal B cell differentiation (IAGP) abnormal B cell physiology (IEA) abnormal brain morphology (IAGP) abnormal brainstem morphology (IAGP) abnormal CD4-positive T cell differentiation (IEA) abnormal CD4-positive, alpha beta T cell morphology (IAGP) abnormal CD8-positive, alpha beta T cell morphology (IAGP) abnormal CD8-positive, alpha-beta T cell differentiation (IEA) abnormal cerebellar cortex morphology (IAGP) abnormal cerebellum morphology (IAGP) abnormal chromosome morphology (IAGP) abnormal circulating protein level (IAGP) abnormal class switch recombination (IAGP) abnormal colon morphology (IAGP) abnormal complement pathway (IAGP) abnormal DNA repair (IAGP) abnormal double-positive T cell morphology (IAGP) abnormal glucose homeostasis (IAGP) abnormal granulocyte morphology (IAGP) abnormal hematopoietic stem cell physiology (IAGP) abnormal hematopoietic system morphology/development (IAGP) abnormal hippocampus morphology (IAGP) abnormal homeostasis (IAGP) abnormal humoral immune response (IAGP) abnormal immune system morphology (IAGP) abnormal immune system organ morphology (IAGP) abnormal immune system physiology (IEA) abnormal immunoglobulin heavy chain V(D)J recombination (IAGP) abnormal immunoglobulin light chain V-J recombination (IAGP) abnormal immunoglobulin V(D)J recombination (IAGP) abnormal intestinal epithelium morphology (IAGP) abnormal intromission (IAGP) abnormal kidney morphology (IAGP) abnormal large intestine crypts of Lieberkuhn morphology (IAGP) abnormal level of surface class II molecules (IAGP) abnormal lymph node B cell domain morphology (IAGP) abnormal lymph node morphology (IAGP) abnormal lymphocyte morphology (IEA) abnormal motor learning (IAGP) abnormal neutrophil morphology (IAGP) abnormal NK cell physiology (IAGP) abnormal pancreatic islet morphology (IAGP) abnormal Peyer's patch morphology (IAGP) abnormal professional antigen presenting cell morphology (IAGP) abnormal response to transplant (IAGP) abnormal single-positive T cell number (IAGP) abnormal spermatogenesis (IAGP) abnormal spleen morphology (IAGP) abnormal spleen white pulp morphology (IAGP) abnormal splenic cell ratio (IAGP) abnormal splenocyte morphology (IAGP) abnormal striatum morphology (IAGP) abnormal T cell differentiation (IAGP) abnormal T cell number (IAGP) abnormal T cell receptor alpha chain V-J recombination (IAGP) abnormal T cell receptor beta chain V(D)J recombination (IAGP) abnormal T cell receptor delta chain V(D)J recombination (IAGP) abnormal T cell receptor V(D)J recombination (IAGP) abnormal thymus corticomedullary boundary morphology (IAGP) abnormal thymus lobule morphology (IAGP) abnormal thymus morphology (IAGP) abnormal vertebral column morphology (IAGP) abnormal zygomatic bone morphology (IAGP) absent B cells (IAGP) absent CD4-positive, alpha-beta T cells (IAGP) absent CD8-positive, alpha-beta T cells (IAGP) absent lymphocyte (IAGP) absent mature B cells (IAGP) absent Peyer's patches (IAGP) absent pre-B cells (IAGP) absent seminal vesicle (IAGP) absent T cells (IAGP) absent thymus cortex (IAGP) absent thymus corticomedullary boundary (IAGP) arrested B cell differentiation (IAGP) arrested T cell differentiation (IAGP) broad head (IAGP) cecum inflammation (IEA) centrally nucleated skeletal muscle fibers (IAGP) colitis (IEA) decreased alpha-beta T cell number (IEA) decreased B cell number (IAGP) decreased B cell proliferation (IAGP) decreased B-1 B cell number (IEA) decreased B-1a cell number (IEA) decreased body size (IAGP) decreased body weight (IAGP) decreased bone marrow cell number (IAGP) decreased CD4-positive, alpha-beta T cell number (IAGP) decreased CD8-positive, alpha-beta T cell number (IAGP) decreased CD8-positive, naive alpha-beta T cell number (IEA) decreased circulating follicle stimulating hormone level (IAGP) decreased circulating insulin level (IAGP) decreased circulating luteinizing hormone level (IAGP) decreased circulating testosterone level (IAGP) decreased double-negative T cell number (IAGP) decreased double-positive T cell number (IAGP) decreased effector memory CD4-positive, alpha-beta T cell number (IEA) decreased elongated spermatid number (IAGP) decreased erythrocyte cell number (IAGP) decreased gamma-delta T cell number (IAGP) decreased granulocyte number (IAGP) decreased hematopoietic stem cell number (IAGP) decreased IgG level (IAGP) decreased IgM level (IAGP) decreased immature B cell number (IAGP) decreased immunoglobulin level (IAGP) decreased incidence of tumors by ionizing radiation induction (IAGP) decreased kidney weight (IAGP) decreased leukocyte cell number (IAGP) decreased level of surface class I molecules (IAGP) decreased liver weight (IAGP) decreased lymphocyte cell number (IAGP) decreased macrophage cell number (IAGP) decreased mature B cell number (IAGP) decreased mean corpuscular hemoglobin concentration (IEA) decreased mean corpuscular volume (IAGP) decreased mounting behavior (IAGP) decreased NK cell number (IAGP) decreased NK T cell number (IEA) decreased pancreatic beta cell number (IAGP) decreased pre-B cell number (IAGP) decreased retroperitoneal fat pad weight (IAGP) decreased single-positive T cell number (IAGP) decreased spleen B cell follicle number (IAGP) decreased spleen weight (IAGP) decreased spleen white pulp amount (IAGP) decreased splenocyte number (IAGP) decreased susceptibility to autoimmune diabetes (IAGP) decreased susceptibility to bacterial infection (IAGP) decreased susceptibility to graft versus host disease (IAGP) decreased T cell number (IAGP) decreased T cell proliferation (IAGP) decreased telomere length (IAGP) decreased testes secretion (IAGP) decreased thymocyte apoptosis (IAGP) decreased thymocyte number (IAGP) decreased transforming growth factor beta level (IAGP) decreased tumor incidence (IAGP) diarrhea (IEA) dilated renal tubule (IAGP) enhanced humoral immune response (IEA) enlarged mesenteric lymph nodes (IEA) enophthalmos (IAGP) extended life span (IAGP) failure of copulatory plug deposition (IAGP) failure of ejaculation (IAGP) female infertility (IAGP) glomerulosclerosis (IAGP) hyperglycemia (IAGP) hyperpigmentation (IAGP) impaired complement classical pathway (IAGP) impaired coordination (IAGP) impaired exercise endurance (IAGP) impaired humoral immune response (IEA) impaired natural killer cell mediated cytotoxicity (IAGP) impaired skeletal muscle contractility (IAGP) increased alpha-beta T cell number (IEA) increased B cell number (IEA) increased B-1b cell number (IEA) increased body weight (IEA) increased bone marrow cell number (IEA) increased CD4-positive, alpha-beta T cell number (IEA) increased CD8-positive, alpha-beta T cell number (IEA) increased cellular sensitivity to alkylating agents (IAGP) increased cellular sensitivity to gamma-irradiation (IAGP) increased cellular sensitivity to ionizing radiation (IAGP) increased cellular sensitivity to ultraviolet irradiation (IAGP) increased cellular sensitivity to X-ray irradiation (IAGP) increased central memory CD4-positive, alpha-beta T cell number (IEA) increased central memory CD8 positive, alpha-beta T cell number (IEA) increased circulating glucose level (IAGP) increased circulating phosphate level (IEA) increased double-negative T cell number (IAGP) increased double-positive T cell number (IAGP) increased effector memory CD4-positive, alpha-beta T cell number (IEA) increased effector memory CD8-positive, alpha-beta T cell number (IEA) increased eosinophil cell number (IAGP) increased granulocyte number (IAGP) increased IgM level (IEA) increased incidence of tumors by ionizing radiation induction (IAGP) increased length of allograft survival (IAGP) increased liver iron level (IAGP) increased lung weight (IAGP) increased macrophage cell number (IAGP) increased mean corpuscular volume (IAGP) increased monocyte cell number (IAGP) increased mortality induced by gamma-irradiation (IAGP) increased mortality induced by ionizing radiation (IAGP) increased neutrophil cell number (IAGP) increased NK cell number (IAGP) increased physiological sensitivity to xenobiotic (IAGP) increased plasma cell number (IEA) increased plasmacytoid dendritic cell number (IEA) increased sensitivity to induced cell death (IAGP) increased skeletal muscle fiber diameter (IAGP) increased small intestinal crypt cell apoptosis (IAGP) increased susceptibility to autoimmune diabetes (IAGP) increased susceptibility to infection (IAGP) increased T cell derived lymphoma incidence (IAGP) increased T cell number (IEA) increased thymoma incidence (IAGP) increased urine glycosaminoglycan level (IAGP) increased urine protein level (IAGP) interstitial pneumonia (IEA) intestine polyps (IAGP) liver inflammation (IEA) lymph node hyperplasia (IEA) lymph node hypoplasia (IAGP) lymphoid hypoplasia (IAGP) male infertility (IAGP) myeloid hyperplasia (IEA) oligozoospermia (IAGP) pallor (IAGP) pancytopenia (IAGP) postnatal lethality, incomplete penetrance (IAGP) premature death (IAGP) preneoplasia (IAGP) pup cannibalization (IAGP) reduced fertility (IAGP) rough coat (IAGP) salivary gland inflammation (IAGP) short snout (IAGP) skeletal muscle fiber degeneration (IAGP) skeletal muscle fibrosis (IAGP) slow postnatal weight gain (IAGP) small ears (IAGP) small lymph nodes (IAGP) small lymphoid organs (IAGP) small Peyer's patches (IAGP) small salivary gland (IAGP) small seminiferous tubules (IAGP) small spleen (IAGP) small thymus (IAGP) spleen hypoplasia (IAGP) stomach inflammation (IAGP) thrombocytopenia (IAGP) thymus cyst (IAGP) thymus hypoplasia (IAGP)
Prkdc Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 15,455,698 - 15,660,103 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 15,455,730 - 15,660,099 (+) Ensembl GRCm39 Ensembl GRCm38 16 15,637,444 - 15,842,239 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 15,637,866 - 15,842,235 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 15,637,959 - 15,842,332 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 15,551,467 - 15,755,813 (+) NCBI MGSCv36 mm8 Celera 16 16,214,291 - 16,413,213 (+) NCBI Celera Cytogenetic Map 16 A2 NCBI cM Map 16 10.09 NCBI
PRKDC Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 47,773,111 - 47,960,136 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 47,773,111 - 47,960,178 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 48,685,672 - 48,872,696 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 48,848,222 - 49,035,296 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 48,848,221 - 49,035,296 NCBI Celera 8 44,671,051 - 44,858,151 (-) NCBI Celera Cytogenetic Map 8 q11.21 NCBI HuRef 8 44,148,581 - 44,335,706 (-) NCBI HuRef CHM1_1 8 48,738,053 - 48,925,105 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 48,149,356 - 48,336,384 (-) NCBI T2T-CHM13v2.0
Prkdc Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 98,544,952 - 98,762,499 (-) NCBI GRCr8 mRatBN7.2 11 85,040,790 - 85,258,357 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 85,040,792 - 85,257,952 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 93,767,902 - 93,984,974 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 86,429,067 - 86,646,132 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 85,482,663 - 85,699,739 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 89,293,547 - 89,510,948 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 89,293,696 - 89,510,871 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 92,347,175 - 92,565,022 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 86,951,420 - 87,169,229 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 86,992,362 - 87,209,825 (-) NCBI Celera 11 83,781,535 - 83,998,574 (-) NCBI Celera Cytogenetic Map 11 q23 NCBI
Prkdc Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955454 7,733,978 - 7,890,867 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955454 7,733,697 - 7,890,896 (-) NCBI ChiLan1.0 ChiLan1.0
PRKDC Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 63,407,112 - 63,593,508 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 39,100,871 - 39,287,251 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 44,201,391 - 44,386,803 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 41,593,022 - 41,778,299 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 41,593,029 - 41,778,299 (-) Ensembl panpan1.1 panPan2
PRKDC Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 29 24,904 - 243,926 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 29 35,007 - 243,895 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 29 449,958 - 669,362 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 29 20,665 - 241,975 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 29 22,025 - 241,944 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 29 20,944 - 240,298 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 29 218,160 - 435,150 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 29 285,564 - 503,393 (-) NCBI UU_Cfam_GSD_1.0
Prkdc Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 79,533,069 - 79,697,823 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936590 4,722,873 - 4,890,156 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936590 4,722,914 - 4,887,615 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRKDC Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 79,687,375 - 79,846,656 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 79,687,375 - 79,850,146 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 87,185,946 - 87,343,690 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRKDC Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 43,915,226 - 44,119,547 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 43,914,636 - 44,119,541 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 97,968,963 - 98,158,648 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prkdc
.
Predicted Target Of
Count of predictions: 111 Count of miRNA genes: 90 Interacting mature miRNAs: 105 Transcripts: ENSMUST00000023352, ENSMUST00000182134 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301970 Heal11_m wound healing/regeneration 11 (mouse) Not determined 16 1 24263853 Mouse 26884376 Skwq4_m skull length QTL 4, 5 week (mouse) 16 8417864 90896888 Mouse 1301841 Lrnx9_m learning-contextual 9 (mouse) Not determined 16 12225360 46225471 Mouse 4142460 Nilac10_m nicotine induced locomotor activity 10 (mouse) Not determined 16 7136906 29225471 Mouse 38501069 Tip4_m tuberculosis immunophenotype 4, IFN-g level (mouse) 16 4317864 44520363 Mouse 1302106 Rapop1_m radiation-induced apoptosis 1 (mouse) Not determined 16 3780779 15731053 Mouse 26884432 Zlq7_m zygomatic length QTL 7, 10 week (mouse) 16 3817864 64620363 Mouse 1300632 Loca2_m locomotor activity 2 (mouse) Not determined 16 1 22500574 Mouse 1301086 Lprm5_m lymphoproliferation modifier 5 (mouse) Not determined 16 11848824 45848923 Mouse 27226768 Tibl9_m tibia length 9, 5 week (mouse) 16 3317864 51420363 Mouse 1301443 Mopkd2_m modifier of polycystic kidney disease progression 2 (mouse) Not determined 16 4646314 38646414 Mouse 10043978 Obq35_m obesity QTL 35 (mouse) Not determined 16 9881631 43881631 Mouse 1301575 Tanidd3_m tally ho associated non-insulin dependednt diabetes mellitus 3 (mouse) Not determined 16 1 22897739 Mouse 15092082 Igly9_m IgG glycosylation 9, GP17b (mouse) 16 14775223 20103513 Mouse 1357763 Lp1_m lymphocyte proliferation 1 (mouse) Not determined 16 6542979 65466552 Mouse 1301384 Dice1_m determination of interleukin 4 commitment 1 (mouse) Not determined 16 1 28434358 Mouse 1300943 Skts9_m skin tumor susceptibility 9 (mouse) Not determined 16 5775252 39775440 Mouse 10402497 Lmr23_m leishmaniasis resistance 23 (mouse) Not determined 16 1 29674200 Mouse 10412289 Ppsl_m plasma P-selectin levels (mouse) Not determined 16 1 30814572 Mouse 4141468 Nhdlq10_m non-HDL QTL 10 (mouse) Not determined 16 1 24263853 Mouse 1300656 Bgeq15_m body growth early QTL 15 (mouse) Not determined 16 5775252 39775440 Mouse 4142236 Pstc4_m periosteal circumference 4 (mouse) Not determined 16 15522909 49523112 Mouse 1301559 Bbaa19_m B.burgdorferi-associated arthritis 19 (mouse) Not determined 16 1 30066977 Mouse 11251724 Ewc6_m ethanol withdrawal and consumption 6 (mouse) 16 8226052 42226052 Mouse 1300987 Skull23_m skull morphology 23 (mouse) Not determined 16 5775252 39775440 Mouse 1301945 Skl7_m skeletal size (tail length) 7 (mouse) Not determined 16 5775252 39775440 Mouse 4141010 Bbq1_m brain and behavior QTL 1 (mouse) Not determined 16 6477009 35021216 Mouse 10045614 Rapop6_m radiation-induced apoptosis 6 (mouse) Not determined 16 14802921 48803032 Mouse 27095908 Scvln7_m sacral vertebrae length 2, 5 week (mouse) 16 3317864 39820362 Mouse 4141060 Pbwg19_m postnatal body weight growth 19 (mouse) Not determined 16 1 20780888 Mouse 10043879 Adip25_m adiposity 25 (mouse) Not determined 16 1 22520318 Mouse 27226785 Feml12_m femur length 12, 5 week (mouse) 16 3317864 64620363 Mouse
RH136293
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 16 15,841,895 - 15,842,093 UniSTS GRCm38 MGSCv37 16 15,841,988 - 15,842,186 UniSTS GRCm37 Celera 16 16,412,869 - 16,413,067 UniSTS Cytogenetic Map 16 B1 UniSTS
RH136614
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 10 74,863,278 - 74,863,478 UniSTS GRCm38 GRCm38 16 15,736,447 - 15,736,646 UniSTS GRCm38 MGSCv37 10 74,326,023 - 74,326,223 UniSTS GRCm37 MGSCv37 16 15,736,540 - 15,736,739 UniSTS GRCm37 Celera 16 16,314,791 - 16,314,990 UniSTS Celera 10 75,913,613 - 75,913,813 UniSTS Cytogenetic Map 10 B5.3 UniSTS Cytogenetic Map 16 B1 UniSTS Cytogenetic Map 10 C2 UniSTS cM Map 10 39.0 UniSTS
RH131824
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 16 15,841,994 - 15,842,176 UniSTS GRCm38 MGSCv37 16 15,842,087 - 15,842,269 UniSTS GRCm37 Celera 16 16,412,968 - 16,413,150 UniSTS Cytogenetic Map 16 B1 UniSTS
AI326420
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 16 15,841,932 - 15,842,023 UniSTS GRCm38 MGSCv37 16 15,842,025 - 15,842,116 UniSTS GRCm37 Celera 16 16,412,906 - 16,412,997 UniSTS Cytogenetic Map 16 B1 UniSTS Whitehead/MRC_RH 16 123.99 UniSTS
06.MMHAP95FRB9.seq
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 16 15,699,438 - 15,699,589 UniSTS GRCm38 MGSCv37 16 15,699,531 - 15,699,682 UniSTS GRCm37 Celera 16 16,277,768 - 16,277,919 UniSTS Cytogenetic Map 16 B1 UniSTS Whitehead_YAC 16 UniSTS
D87521
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 16 15,842,071 - 15,842,176 UniSTS GRCm38 MGSCv37 16 15,842,164 - 15,842,269 UniSTS GRCm37 Celera 16 16,413,045 - 16,413,150 UniSTS Cytogenetic Map 16 B1 UniSTS Whitehead/MRC_RH 16 122.18 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000023352 ⟹ ENSMUSP00000023352
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 16 15,455,753 - 15,660,099 (+) Ensembl GRCm38.p6 Ensembl 16 15,637,889 - 15,842,235 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000182134
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 16 15,455,730 - 15,502,613 (+) Ensembl GRCm38.p6 Ensembl 16 15,637,866 - 15,684,749 (+) Ensembl
RefSeq Acc Id:
NM_011159 ⟹ NP_035289
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 16 15,455,730 - 15,660,103 (+) NCBI GRCm38 16 15,637,866 - 15,842,239 (+) NCBI MGSCv37 16 15,637,959 - 15,842,332 (+) RGD Celera 16 16,214,291 - 16,413,213 (+) RGD cM Map 16 ENTREZGENE
Sequence:
ATGCGCGAAGCGGTGCCGGCGTGATGGCGGAGGAGGGAACCGGCGTACGGTGTTGGCTACTGCAGCTGCAGGAGTTCCTGTCCGCAGCAGACCGCTGCAGTGCTGCCGGGGCCAGTTACCAGCTGATT
hide sequence
RefSeq Acc Id:
XM_006521861 ⟹ XP_006521924
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 16 15,455,698 - 15,627,532 (+) NCBI GRCm38 16 15,637,444 - 15,809,668 (+) NCBI
Sequence:
AGGGAAGAGCTGGCTAGAGTGCTGAGACGCGCATGCGCGAAGCGGTGCCGGCGTGATGGCGGAG
hide sequence
RefSeq Acc Id:
XM_017316892 ⟹ XP_017172381
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 16 15,455,698 - 15,625,889 (+) NCBI GRCm38 16 15,637,444 - 15,808,027 (+) NCBI
Sequence:
AGGGAAGAGCTGGCTAGAGTGCTGAGACGCGCATGCGCGAAGCGGTGCCGGCGTGATGGCGGAGGAGGGAACCGGCGTACGGTGTTGGCTACTGCAGCTGCAGGAGTTCCTGTCCGCAGCAGACCGCT
hide sequence
RefSeq Acc Id:
NP_035289 ⟸ NM_011159
- UniProtKB:
Q8C2A7 (UniProtKB/Swiss-Prot), Q3V2W8 (UniProtKB/Swiss-Prot), Q307W9 (UniProtKB/Swiss-Prot), P97928 (UniProtKB/Swiss-Prot), O88187 (UniProtKB/Swiss-Prot), E9QN15 (UniProtKB/Swiss-Prot), Q9Z341 (UniProtKB/Swiss-Prot), P97313 (UniProtKB/Swiss-Prot)
- Sequence:
MAEEGTGVRCWLLQLQEFLSAADRCSAAGASYQLIRSLGQECVLSTSSAVQALQISLVFSRDFGLLVFIRKSLSIEDFRDCREEALKFLCVFLEKIDQKVMHYSLDIKNTCTSVYTKDRTAKCKIPAL
hide sequence
RefSeq Acc Id:
XP_006521924 ⟸ XM_006521861
- Peptide Label:
isoform X1
- Sequence:
MAEEGTGVRCWLLQLQEFLSAADRCSAAGASYQLIRSLGQECVLSTSSAVQALQISLVFSRDFG
hide sequence
RefSeq Acc Id:
XP_017172381 ⟸ XM_017316892
- Peptide Label:
isoform X2
- Sequence:
MAEEGTGVRCWLLQLQEFLSAADRCSAAGASYQLIRSLGQECVLSTSSAVQALQISLVFSRDFG
hide sequence
Ensembl Acc Id:
ENSMUSP00000023352 ⟸ ENSMUST00000023352
RGD ID: 6827382 Promoter ID: MM_KWN:20228 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: NM_008565, NM_011159, UC007YHS.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 16 15,637,301 - 15,638,067 (+) MPROMDB
RGD ID: 8685536 Promoter ID: EPDNEW_M20799 Type: multiple initiation site Name: Prkdc_1 Description: Mus musculus protein kinase, DNA activated, catalytic polypeptide, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 16 15,637,866 - 15,637,926 EPDNEW
