Symbol:
Lrrk1
Name:
leucine-rich repeat kinase 1
RGD ID:
1317517
MGI Page
MGI
Description:
Predicted to enable identical protein binding activity and protein kinase activity. Acts upstream of or within several processes, including bone resorption; osteoclast development; and regulation of peptidyl-tyrosine phosphorylation. Predicted to be located in cytosol and mitochondrion. Predicted to be active in cytoplasm. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; hemolymphoid system; and sensory organ. Used to study osteopetrosis. Human ortholog(s) of this gene implicated in osteosclerotic metaphyseal dysplasia. Orthologous to human LRRK1 (leucine rich repeat kinase 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AW319595; C230002E15Rik; D130026O16Rik; expressed sequence AW319595; leucine-rich repeat serine/threonine-protein kinase 1; MGC28646; mKIAA1790
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LRRK1 (leucine rich repeat kinase 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Lrrk1 (leucine-rich repeat kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lrrk1 (leucine rich repeat kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LRRK1 (leucine rich repeat kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LRRK1 (leucine rich repeat kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lrrk1 (leucine rich repeat kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LRRK1 (leucine rich repeat kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LRRK1 (leucine rich repeat kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lrrk1 (leucine rich repeat kinase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Lrrk1 (leucine-rich repeat kinase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
LRRK1 (leucine rich repeat kinase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
lrrk1 (leucine-rich repeat kinase 1)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
lrk-1
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Lrrk
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
lrrk1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 65,908,493 - 66,038,089 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 65,876,660 - 66,038,098 (-) Ensembl GRCm39 Ensembl GRCm38 7 66,258,745 - 66,388,341 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 66,226,912 - 66,388,350 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 73,403,631 - 73,533,227 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 55,670,181 - 55,799,947 (-) NCBI MGSCv36 mm8 MGSCv36 7 66,137,695 - 66,267,291 (-) NCBI MGSCv36 mm8 Celera 7 63,712,568 - 63,843,036 (-) NCBI Celera Celera 7 59,723,311 - 59,724,078 (-) NCBI Celera Cytogenetic Map 7 C NCBI cM Map 7 35.57 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lrrk1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of LRRK1 mRNA CTD PMID:15652763 Lrrk1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Lrrk1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of LRRK1 mRNA CTD PMID:33387578 and PMID:34747641 Lrrk1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of LRRK1 mRNA CTD PMID:21570461 Lrrk1 Mouse 2,4-dinitrotoluene affects expression ISO Lrrk1 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of LRRK1 mRNA CTD PMID:21346803 Lrrk1 Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of LRRK1 mRNA CTD PMID:26251327 Lrrk1 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of LRRK1 mRNA CTD PMID:30951980 Lrrk1 Mouse 4,4'-sulfonyldiphenol increases methylation ISO LRRK1 (Homo sapiens) 6480464 bisphenol S results in increased methylation of LRRK1 gene CTD PMID:31601247 Lrrk1 Mouse 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of LRRK1 mRNA CTD PMID:30951980 Lrrk1 Mouse 6-propyl-2-thiouracil decreases expression ISO Lrrk1 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of LRRK1 mRNA CTD PMID:30047161 Lrrk1 Mouse acetamide increases expression ISO Lrrk1 (Rattus norvegicus) 6480464 acetamide results in increased expression of LRRK1 mRNA CTD PMID:31881176 Lrrk1 Mouse Aflatoxin B2 alpha decreases methylation ISO LRRK1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of LRRK1 intron CTD PMID:30157460 Lrrk1 Mouse all-trans-retinoic acid increases expression ISO Lrrk1 (Rattus norvegicus) 6480464 Tretinoin results in increased expression of LRRK1 mRNA CTD PMID:20488242 Lrrk1 Mouse all-trans-retinoic acid multiple interactions EXP 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of LRRK1 mRNA more ... CTD PMID:30951980 Lrrk1 Mouse all-trans-retinoic acid decreases expression ISO LRRK1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of LRRK1 mRNA CTD PMID:23724009 and PMID:33167477 Lrrk1 Mouse amitrole decreases expression ISO Lrrk1 (Rattus norvegicus) 6480464 Amitrole results in decreased expression of LRRK1 mRNA CTD PMID:30047161 Lrrk1 Mouse arsane affects methylation ISO LRRK1 (Homo sapiens) 6480464 Arsenic affects the methylation of LRRK1 gene CTD PMID:25304211 Lrrk1 Mouse arsenic atom affects methylation ISO LRRK1 (Homo sapiens) 6480464 Arsenic affects the methylation of LRRK1 gene CTD PMID:25304211 Lrrk1 Mouse arsenite(3-) multiple interactions ISO LRRK1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to LRRK1 mRNA] CTD PMID:32406909 Lrrk1 Mouse arsenous acid multiple interactions ISO LRRK1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to LRRK1 protein] CTD PMID:26598702 Lrrk1 Mouse arsenous acid increases expression ISO LRRK1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of LRRK1 mRNA CTD PMID:20458559 Lrrk1 Mouse atrazine decreases expression ISO Lrrk1 (Rattus norvegicus) 6480464 Atrazine results in decreased expression of LRRK1 mRNA CTD PMID:36841081 Lrrk1 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of LRRK1 mRNA CTD PMID:19770486 Lrrk1 Mouse benzo[a]pyrene increases methylation ISO LRRK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of LRRK1 5' UTR more ... CTD PMID:27901495 Lrrk1 Mouse benzo[a]pyrene affects methylation ISO LRRK1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of LRRK1 3' UTR CTD PMID:27901495 Lrrk1 Mouse benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of LRRK1 mRNA CTD PMID:27858113 Lrrk1 Mouse benzo[a]pyrene decreases expression ISO LRRK1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of LRRK1 mRNA CTD PMID:22316170 Lrrk1 Mouse benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of LRRK1 mRNA CTD PMID:27858113 Lrrk1 Mouse benzo[e]pyrene decreases methylation ISO LRRK1 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of LRRK1 intron CTD PMID:30157460 Lrrk1 Mouse beta-lapachone decreases expression ISO LRRK1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of LRRK1 mRNA CTD PMID:38218311 Lrrk1 Mouse bisphenol A increases methylation ISO Lrrk1 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of LRRK1 gene CTD PMID:28505145 Lrrk1 Mouse bisphenol A multiple interactions ISO LRRK1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of LRRK1 gene CTD PMID:31601247 Lrrk1 Mouse bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of LRRK1 mRNA CTD PMID:30951980 Lrrk1 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of LRRK1 mRNA CTD PMID:30951980 Lrrk1 Mouse bisphenol A decreases expression ISO Lrrk1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of LRRK1 mRNA CTD PMID:30816183 more ... Lrrk1 Mouse Bisphenol A diglycidyl ether affects splicing EXP 6480464 bisphenol A diglycidyl ether affects the splicing of LRRK1 mRNA CTD PMID:36464114 Lrrk1 Mouse bisphenol AF affects splicing EXP 6480464 bisphenol AF affects the splicing of LRRK1 mRNA CTD PMID:36464114 Lrrk1 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of LRRK1 mRNA CTD PMID:30951980 Lrrk1 Mouse bisphenol F multiple interactions EXP 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of LRRK1 mRNA CTD PMID:30951980 Lrrk1 Mouse butanal decreases expression ISO LRRK1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of LRRK1 mRNA CTD PMID:26079696 Lrrk1 Mouse C60 fullerene increases expression ISO Lrrk1 (Rattus norvegicus) 6480464 fullerene C60 results in increased expression of LRRK1 mRNA CTD PMID:19167457 Lrrk1 Mouse calcitriol increases expression ISO LRRK1 (Homo sapiens) 6480464 Calcitriol results in increased expression of LRRK1 mRNA CTD PMID:21592394 Lrrk1 Mouse calcitriol multiple interactions ISO LRRK1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of LRRK1 mRNA CTD PMID:21592394 Lrrk1 Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Lrrk1 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of LRRK1 mRNA CTD PMID:37019170 Lrrk1 Mouse chrysene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of LRRK1 mRNA CTD PMID:27858113 Lrrk1 Mouse cobalt dichloride decreases expression ISO Lrrk1 (Rattus norvegicus) 6480464 cobaltous chloride results in decreased expression of LRRK1 mRNA CTD PMID:24386269 Lrrk1 Mouse diarsenic trioxide multiple interactions ISO LRRK1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to LRRK1 protein] CTD PMID:26598702 Lrrk1 Mouse diarsenic trioxide increases expression ISO LRRK1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of LRRK1 mRNA CTD PMID:20458559 Lrrk1 Mouse Dibutyl phosphate affects expression ISO LRRK1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of LRRK1 mRNA CTD PMID:37042841 Lrrk1 Mouse dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of LRRK1 mRNA CTD PMID:21266533 Lrrk1 Mouse dorsomorphin multiple interactions ISO LRRK1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LRRK1 mRNA CTD PMID:27188386 Lrrk1 Mouse endosulfan decreases expression ISO Lrrk1 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of LRRK1 mRNA CTD PMID:29391264 Lrrk1 Mouse entinostat increases expression ISO LRRK1 (Homo sapiens) 6480464 entinostat results in increased expression of LRRK1 mRNA CTD PMID:26272509 Lrrk1 Mouse entinostat multiple interactions ISO LRRK1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LRRK1 mRNA CTD PMID:27188386 Lrrk1 Mouse fenamidone increases expression EXP 6480464 fenamidone results in increased expression of LRRK1 mRNA CTD PMID:27029645 Lrrk1 Mouse formaldehyde decreases expression ISO LRRK1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of LRRK1 mRNA CTD PMID:23649840 Lrrk1 Mouse fulvestrant multiple interactions ISO LRRK1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of LRRK1 gene CTD PMID:31601247 Lrrk1 Mouse gentamycin decreases expression ISO Lrrk1 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of LRRK1 mRNA CTD PMID:33387578 Lrrk1 Mouse lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of LRRK1 mRNA CTD PMID:22609695 Lrrk1 Mouse manganese(II) chloride increases expression ISO Lrrk1 (Rattus norvegicus) 6480464 manganese chloride results in increased expression of LRRK1 mRNA CTD PMID:28801915 Lrrk1 Mouse methapyrilene decreases methylation ISO LRRK1 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of LRRK1 intron CTD PMID:30157460 Lrrk1 Mouse methidathion decreases expression EXP 6480464 methidathion results in decreased expression of LRRK1 mRNA CTD PMID:34813904 Lrrk1 Mouse methimazole decreases expression ISO Lrrk1 (Rattus norvegicus) 6480464 Methimazole results in decreased expression of LRRK1 mRNA CTD PMID:30047161 Lrrk1 Mouse N-methyl-4-phenylpyridinium increases expression ISO Lrrk1 (Rattus norvegicus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of LRRK1 mRNA CTD PMID:28801915 Lrrk1 Mouse nickel sulfate increases expression ISO LRRK1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of LRRK1 mRNA CTD PMID:22714537 Lrrk1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of LRRK1 mRNA CTD PMID:17562736 Lrrk1 Mouse paracetamol decreases expression ISO Lrrk1 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of LRRK1 mRNA CTD PMID:33387578 Lrrk1 Mouse perfluorohexanesulfonic acid decreases expression ISO LRRK1 (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in decreased expression of LRRK1 mRNA CTD PMID:25812627 Lrrk1 Mouse perfluorooctane-1-sulfonic acid increases expression ISO LRRK1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of LRRK1 mRNA CTD PMID:25812627 Lrrk1 Mouse perfluorooctanoic acid increases expression ISO LRRK1 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of LRRK1 mRNA CTD PMID:25812627 Lrrk1 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of LRRK1 mRNA CTD PMID:20813756 and PMID:23811191 Lrrk1 Mouse pregnenolone 16alpha-carbonitrile decreases expression ISO Lrrk1 (Rattus norvegicus) 6480464 Pregnenolone Carbonitrile results in decreased expression of LRRK1 mRNA CTD PMID:30047161 Lrrk1 Mouse SB 431542 multiple interactions ISO LRRK1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of LRRK1 mRNA CTD PMID:27188386 Lrrk1 Mouse silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of LRRK1 mRNA CTD PMID:19073995 Lrrk1 Mouse silver atom increases expression EXP 6480464 Silver results in increased expression of LRRK1 mRNA CTD PMID:27131904 Lrrk1 Mouse silver(0) increases expression EXP 6480464 Silver results in increased expression of LRRK1 mRNA CTD PMID:27131904 Lrrk1 Mouse sodium arsenite decreases expression ISO LRRK1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of LRRK1 mRNA CTD PMID:38568856 Lrrk1 Mouse Soman increases expression ISO Lrrk1 (Rattus norvegicus) 6480464 Soman results in increased expression of LRRK1 mRNA CTD PMID:19281266 Lrrk1 Mouse sulfadimethoxine decreases expression ISO Lrrk1 (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of LRRK1 mRNA CTD PMID:30047161 Lrrk1 Mouse testosterone increases expression ISO LRRK1 (Homo sapiens) 6480464 Testosterone results in increased expression of LRRK1 mRNA CTD PMID:21592394 Lrrk1 Mouse testosterone multiple interactions ISO LRRK1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of LRRK1 mRNA CTD PMID:21592394 Lrrk1 Mouse tetrachloromethane decreases expression ISO Lrrk1 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of LRRK1 mRNA CTD PMID:31150632 Lrrk1 Mouse tetraphene decreases expression EXP 6480464 benz(a)anthracene results in decreased expression of LRRK1 mRNA CTD PMID:26377693 Lrrk1 Mouse tetraphene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of LRRK1 mRNA CTD PMID:27858113 Lrrk1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of LRRK1 gene CTD PMID:35295148 Lrrk1 Mouse triptonide decreases expression EXP 6480464 triptonide results in decreased expression of LRRK1 mRNA CTD PMID:33045310 Lrrk1 Mouse triptonide affects expression EXP 6480464 triptonide affects the expression of LRRK1 mRNA CTD PMID:33045310 Lrrk1 Mouse urethane decreases expression ISO LRRK1 (Homo sapiens) 6480464 Urethane results in decreased expression of LRRK1 mRNA CTD PMID:28818685 Lrrk1 Mouse valproic acid affects expression ISO LRRK1 (Homo sapiens) 6480464 Valproic Acid affects the expression of LRRK1 mRNA CTD PMID:25979313 Lrrk1 Mouse vinclozolin increases methylation ISO Lrrk1 (Rattus norvegicus) 6480464 vinclozolin results in increased methylation of LRRK1 gene CTD PMID:31079544
2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (ISO) acetamide (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (EXP,ISO) amitrole (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (EXP) benzo[e]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (EXP) bisphenol AF (EXP) bisphenol F (EXP) butanal (ISO) C60 fullerene (ISO) calcitriol (ISO) carbon nanotube (EXP) chlorpyrifos (EXP) chrysene (EXP) cobalt dichloride (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dorsomorphin (ISO) endosulfan (ISO) entinostat (ISO) fenamidone (EXP) formaldehyde (ISO) fulvestrant (ISO) gentamycin (ISO) lead diacetate (EXP) manganese(II) chloride (ISO) methapyrilene (ISO) methidathion (EXP) methimazole (ISO) N-methyl-4-phenylpyridinium (ISO) nickel sulfate (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (ISO) SB 431542 (ISO) silicon dioxide (EXP) silver atom (EXP) silver(0) (EXP) sodium arsenite (ISO) Soman (ISO) sulfadimethoxine (ISO) testosterone (ISO) tetrachloromethane (ISO) tetraphene (EXP) titanium dioxide (EXP) triptonide (EXP) urethane (ISO) valproic acid (ISO) vinclozolin (ISO)
Lrrk1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 65,908,493 - 66,038,089 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 65,876,660 - 66,038,098 (-) Ensembl GRCm39 Ensembl GRCm38 7 66,258,745 - 66,388,341 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 66,226,912 - 66,388,350 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 73,403,631 - 73,533,227 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 55,670,181 - 55,799,947 (-) NCBI MGSCv36 mm8 MGSCv36 7 66,137,695 - 66,267,291 (-) NCBI MGSCv36 mm8 Celera 7 63,712,568 - 63,843,036 (-) NCBI Celera Celera 7 59,723,311 - 59,724,078 (-) NCBI Celera Cytogenetic Map 7 C NCBI cM Map 7 35.57 NCBI
LRRK1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 100,919,357 - 101,078,257 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 100,919,327 - 101,078,257 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 101,459,562 - 101,618,462 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 99,276,983 - 99,427,840 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 99,380,194 - 99,427,834 NCBI Celera 15 77,872,799 - 78,023,725 (+) NCBI Celera Cytogenetic Map 15 q26.3 NCBI HuRef 15 77,581,355 - 77,732,446 (+) NCBI HuRef CHM1_1 15 101,300,443 - 101,451,610 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 98,673,894 - 98,832,884 (+) NCBI T2T-CHM13v2.0
Lrrk1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 129,254,815 - 129,390,217 (-) NCBI GRCr8 mRatBN7.2 1 119,844,360 - 119,972,885 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 119,845,146 - 119,979,734 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 127,837,758 - 127,964,722 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 135,009,201 - 135,136,173 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 127,819,030 - 127,946,556 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 127,166,866 - 127,301,053 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 127,166,431 - 127,292,090 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 128,248,473 - 128,372,456 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 120,695,657 - 120,836,324 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 120,773,221 - 120,921,758 (-) NCBI Celera 1 112,054,004 - 112,179,350 (-) NCBI Celera Cytogenetic Map 1 q22 NCBI
Lrrk1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 27,865,784 - 27,988,279 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 27,860,934 - 27,988,279 (+) NCBI ChiLan1.0 ChiLan1.0
LRRK1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 90,508,435 - 90,659,979 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 94,208,601 - 94,360,510 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 79,642,908 - 79,793,990 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 98,936,123 - 99,081,168 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 98,931,344 - 99,081,168 (+) Ensembl panpan1.1 panPan2
LRRK1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 40,003,299 - 40,122,326 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 40,004,557 - 40,122,320 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 42,692,357 - 42,816,723 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 40,394,683 - 40,519,058 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 40,377,843 - 40,513,734 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 39,927,716 - 40,048,483 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 40,164,544 - 40,288,876 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 40,366,423 - 40,490,768 (-) NCBI UU_Cfam_GSD_1.0
Lrrk1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 143,409,510 - 143,562,544 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936483 2,771,938 - 2,924,525 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936483 2,771,939 - 2,922,793 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LRRK1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 139,494,121 - 139,624,604 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 139,494,126 - 139,624,609 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 155,637,573 - 155,853,753 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LRRK1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 19,385,149 - 19,532,440 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 19,386,170 - 19,533,686 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 27,010,221 - 27,156,563 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lrrk1
.
Predicted Target Of
Count of predictions: 1888 Count of miRNA genes: 768 Interacting mature miRNAs: 966 Transcripts: ENSMUST00000015277, ENSMUST00000130438, ENSMUST00000131239, ENSMUST00000137181, ENSMUST00000145954, ENSMUST00000154893, ENSMUST00000167705 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
25314307 Mlh1fc2_m MLH1 foci count 2 (mouse) 7 6502999 133501729 Mouse 25314305 Vmm6_m variable multisystem mineralization 6, eye (mouse) 7 61849748 102749207 Mouse 27226778 Femd11_m femur midshaft diameter 11, 16 week (mouse) 7 56949748 134001729 Mouse 1357586 Mdmsc3_m modifier of muscularity 3 (mouse) Not determined 7 34447869 68448018 Mouse 38501068 Tip1_m tuberculosis immunophenotype 1, spleen CFU (mouse) 7 3602999 72549748 Mouse 11252140 Fdr1_m fat response to dietary restriction 1 (mouse) 7 41148820 75148965 Mouse 13506761 Tbthq1_m trabecular bone thickness QTL 1 (mouse) 7 62349748 67749748 Mouse 26884381 Bzwq2_m bi-zygomatic width QTL 2, 5 week (mouse) 7 65249748 96949207 Mouse 1301663 Skull9_m skull morphology 9 (mouse) Not determined 7 57326121 91326352 Mouse 10043926 Bw1n_m body weight 1 in NSY (mouse) Not determined 7 45161966 118693530 Mouse 1301383 Aem2_m anti-erythrocyte autoantibody modifier 2 (mouse) Not determined 7 64135424 98135653 Mouse 1300996 Aorls2_m aortic lesion size 2 (mouse) Not determined 7 32394532 66394681 Mouse 1301514 Rigs1_m radiation induced gastroschisis 1 (mouse) Not determined 7 36280015 92394346 Mouse 1300878 Skts1_m skin tumor susceptibility 1 (mouse) Not determined 7 37891386 71891582 Mouse 11565101 Tsve1_m variable short tail (Tsv) enhancer 1 (mouse) 7 55889508 87142720 Mouse 13208555 Lgth10_m body length 10 (mouse) 7 51649748 125599172 Mouse 26884408 Bzwq13_m bi-zygomatic width QTL 13, 16 week (mouse) 7 61749748 121399223 Mouse 1300791 Abbp3_m A/J and C57BL/6 blood pressure 3 (mouse) Not determined 7 39673887 103510010 Mouse 10402488 Dipa2_m drug induced psychomotor activation 2 (mouse) Not determined 7 38421548 72421684 Mouse 13432171 Rosd1_m rotarod saline difference 1 (mouse) 7 59194378 69004862 Mouse 10054064 Bwq11_m body weight QTL 11 (mouse) Not determined 7 51124954 85125093 Mouse 1357752 Tabw_m tally ho asscoiated body weight (mouse) Not determined 7 49193278 83193390 Mouse 10053685 Eae43_m experimental allergic encephalomyelitis susceptibility 43 (mouse) Not determined 7 51124954 85125093 Mouse 26884404 Huml1_m humerus length 1, 5 week (mouse) 7 30199425 108999207 Mouse 10045622 Heal20_m wound healing/regeneration 20 (mouse) Not determined 7 34316887 68317043 Mouse 1301158 Eae4_m susceptibility to experimental allergic encephalomyelitis 4 (mouse) Not determined 7 19147398 141919804 Mouse 12738423 Lfibq6_m liver fibrosis QTL 6 (mouse) 7 47694378 66704862 Mouse 10412199 Sst2_m susceptibility to tuberculosis 2 (mouse) Not determined 7 18728794 119485380 Mouse 26884440 Sklq4_m skull length QTL 4, 5 week (mouse) 7 65249748 126499172 Mouse 25823170 Hrsq7_m host response to SARS QTL 7, log titer (mouse) 7 54819589 116822815 Mouse 1301082 Bbaa16_m B.burgdorferi-associated arthritis 16 (mouse) Not determined 7 36280015 116416877 Mouse 1301465 Egrm3_m early growth rate (mouse) Not determined 7 57326121 91326352 Mouse 1300952 Hcs1_m hepatocarcinogenesis susceptibility 1 (mouse) Not determined 7 57326121 91326352 Mouse 1559000 Ossc1_m osteosarcoma susceptibility 1 (mouse) Not determined 7 34053025 68053223 Mouse 12792978 Fbmd3_m femoral bone mineral density 3, females only (mouse) 7 7050288 142367832 Mouse 4141805 Sle19_m systematic lupus erythematosus susceptibility 19 (mouse) Not determined 30032485 81135653 Mouse 4141929 Chlq18_m circulating hormone level QTL 18 (mouse) Not determined 7 41148820 75148965 Mouse 27226751 Femd5_m femur midshaft diameter 5, 10 week (mouse) 7 53249748 143153737 Mouse 1300722 Sle3_m systemic lupus erythmatosus susceptibility 3 (mouse) Not determined 7 3511728 87142720 Mouse 12880417 V125Dq5_m vitamin D active form serum level QTL 5 (mouse) 7 45249748 79249748 Mouse 12880418 V125Dq6_m vitamin D active form serum level QTL 6 (mouse) 7 52149748 86149748 Mouse 11532741 Tbrs5_m tuberculosis resistance 5 (mouse) 7 49159227 83235415 Mouse 1302141 Fcsa6_m femoral cross-sectional area 6 (mouse) Not determined 7 48384461 82384607 Mouse 13506750 Tbthq2_m trabecular bone thickness QTL 2 (mouse) 7 65659748 77549748 Mouse 27095916 Scvln15_m sacral vertebrae length 2, 16 week (mouse) 7 61749748 123699223 Mouse 11553865 Stmm1c_m skin tumor modifier of MSM 1c (mouse) 7 65788986 99788986 Mouse 11553866 Stmm1d_m skin tumor modifier of MSM 1d (mouse) 7 65788986 99788986 Mouse 25314302 Vmm2_m variable multisystem mineralization 2, heart (mouse) 7 47149748 74149748 Mouse 25314303 Vmm4_m variable multisystem mineralization 4, kidney (mouse) 7 37299425 87049208 Mouse 25314301 Vmm3_m variable multisystem mineralization 3, lung (mouse) 7 37299425 72049748 Mouse
AW319595
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 7 66,258,857 - 66,258,949 UniSTS GRCm38 MGSCv37 7 73,403,743 - 73,403,835 UniSTS GRCm37 Celera 7 59,723,421 - 59,723,513 UniSTS Cytogenetic Map 7 C UniSTS Whitehead/MRC_RH 7 863.11 UniSTS
D7Dcr28
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 7 66,340,062 - 66,340,165 UniSTS GRCm38 MGSCv37 7 73,484,948 - 73,485,051 UniSTS GRCm37 Celera 7 63,792,816 - 63,792,948 UniSTS Cytogenetic Map 7 C UniSTS cM Map 7 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000015277 ⟹ ENSMUSP00000015277
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 65,908,493 - 66,038,098 (-) Ensembl GRCm38.p6 Ensembl 7 66,258,745 - 66,388,350 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000130438
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 65,990,428 - 65,993,013 (-) Ensembl GRCm38.p6 Ensembl 7 66,340,680 - 66,343,265 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000131239
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 65,915,938 - 65,919,548 (-) Ensembl GRCm38.p6 Ensembl 7 66,266,190 - 66,269,800 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000137181
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 65,908,500 - 65,915,319 (-) Ensembl GRCm38.p6 Ensembl 7 66,258,752 - 66,265,571 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000145954 ⟹ ENSMUSP00000114938
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 65,908,932 - 65,931,965 (-) Ensembl GRCm38.p6 Ensembl 7 66,259,184 - 66,282,217 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000154893
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 65,991,418 - 66,038,055 (-) Ensembl GRCm38.p6 Ensembl 7 66,341,670 - 66,388,307 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000167705
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 65,876,660 - 65,912,218 (-) Ensembl GRCm38.p6 Ensembl 7 66,226,912 - 66,262,470 (-) Ensembl
RefSeq Acc Id:
NM_146191 ⟹ NP_666303
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 65,908,493 - 66,038,089 (-) NCBI GRCm38 7 66,258,745 - 66,388,341 (-) ENTREZGENE MGSCv37 7 73,403,631 - 73,533,227 (-) RGD Celera 7 59,723,311 - 59,724,078 (-) NCBI Celera 7 63,712,568 - 63,843,036 (-) RGD cM Map 7 ENTREZGENE
Sequence:
GGATTGAGGAAGTGCGTCTGGCCCCCGGCGGCCAGAGCATTGCAGGGCAGAGTACGGTAGGACCGGCAGGCCCCGGCCCTCTGATGTCGCCGATCCGCGGCTTCCAGACCCTGCCGCCGCAGGATGAG
hide sequence
RefSeq Acc Id:
XM_006540838 ⟹ XP_006540901
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 65,908,493 - 65,993,022 (-) NCBI GRCm38 7 66,258,745 - 66,343,280 (-) NCBI
Sequence:
CGGGACACTGATGGGGAACAGTGGTCTCCTTCACTCGTATCTTTCCACTCAGTGCAGTGCTTAG
hide sequence
RefSeq Acc Id:
XM_006540839 ⟹ XP_006540902
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 65,908,923 - 66,027,399 (-) NCBI GRCm38 7 66,258,745 - 66,377,658 (-) NCBI
Sequence:
GACCCAGATGTAGCTGGAAGGGCTATTTTACGCCGTGCATTCATGTGTGCTGTGTGTCTCTGCA
hide sequence
RefSeq Acc Id:
XM_006540840 ⟹ XP_006540903
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 65,908,923 - 65,947,499 (-) NCBI GRCm38 7 66,258,745 - 66,297,897 (-) NCBI
Sequence:
CCGGCTCCGTGGCCAGCTGCTCAGTGTTCCCTTGCTGGGCAAGAAAACACACCTTTCTCCCGTT
hide sequence
RefSeq Acc Id:
XM_006540841 ⟹ XP_006540904
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 65,908,493 - 66,038,055 (-) NCBI GRCm38 7 66,258,745 - 66,294,883 (-) NCBI
Sequence:
GAGCATTGCAGGGCAGAGTACGGTAGGACCGGCAGGCCCCGGCCCTCTGATGTCGCCGATCCGCGGCTTCCAGACCCTGCCGCCGCAGGATGAGCGTGTGTCTGCAGCGACATGACTAGGTGTCCGTG
hide sequence
RefSeq Acc Id:
XR_391340
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 65,912,356 - 65,993,029 (-) NCBI GRCm38 7 66,262,608 - 66,343,288 (-) NCBI
Sequence:
TCTGGAGCGGGACACTGATGGGGAACAGTGGTCTCCTTCACTCGTATCTTTCCACTCAGTGCAG
hide sequence
RefSeq Acc Id:
NP_666303 ⟸ NM_146191
- UniProtKB:
Q8R085 (UniProtKB/Swiss-Prot), Q8BVV2 (UniProtKB/Swiss-Prot), Q8BUY0 (UniProtKB/Swiss-Prot), Q8BU93 (UniProtKB/Swiss-Prot), Q8BKP3 (UniProtKB/Swiss-Prot), Q6ZPI4 (UniProtKB/Swiss-Prot), Q6NZF5 (UniProtKB/Swiss-Prot), Q6GQR9 (UniProtKB/Swiss-Prot), Q66JQ4 (UniProtKB/Swiss-Prot), Q3UHC2 (UniProtKB/Swiss-Prot), Q3U476 (UniProtKB/Swiss-Prot)
- Sequence:
MAGTSQRPPSMYWCVGTEGLAVCPGPAMETHNGAEDMGSKLSLPGGSSTVQCPSMEEIHTAYKQRNLSRARDLLRGVCEESESSQEKGQLLSIAAAHGDLETVQFLLTEKRVELPTEPTDDNPAVVAA
hide sequence
RefSeq Acc Id:
XP_006540902 ⟸ XM_006540839
- Peptide Label:
isoform X2
- Sequence:
MDQRRWNIPEGLQIPGAEDMGSKLSLPGGSSTVQCPSMEEIHTAYKQRNLSRARDLLRGVCEESESSQEKGQLLSIAAAHGDLETVQFLLTEKRVELPTEPTDDNPAVVAAHFGHAEVVRELLESLPG
hide sequence
RefSeq Acc Id:
XP_006540901 ⟸ XM_006540838
- Peptide Label:
isoform X1
- Sequence:
MPSRMAGGPQRYRSLLTGAFQDSLPNPQPCDVMGAEDMGSKLSLPGGSSTVQCPSMEEIHTAYKQRNLSRARDLLRGVCEESESSQEKGQLLSIAAAHGDLETVQFLLTEKRVELPTEPTDDNPAVVA
hide sequence
RefSeq Acc Id:
XP_006540903 ⟸ XM_006540840
- Peptide Label:
isoform X3
- Sequence:
MLEFPAFLSESLEVLCLNDNHLDAVPPSVCLLKNLSELYLGNNPGLRELPPELGQLGNLWQLDIEDLNISNVPAEVRKEGPKATLSFLRAQLRKAEKCKLMKMILVGPPRQGKSTLLEILQTGKAPQL
hide sequence
RefSeq Acc Id:
XP_006540904 ⟸ XM_006540841
- Peptide Label:
isoform X4
- Sequence:
MATVNQCFFTDKALYVVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLALCRSPSGSRATGFPDITFKHLHEISCKNLEGQEGLRQLIFHVTCNMKDVGSTI
hide sequence
Ensembl Acc Id:
ENSMUSP00000015277 ⟸ ENSMUST00000015277
Ensembl Acc Id:
ENSMUSP00000114938 ⟸ ENSMUST00000145954
RGD ID: 8664381 Promoter ID: EPDNEW_M10221 Type: multiple initiation site Name: Lrrk1_1 Description: Mus musculus leucine-rich repeat kinase 1 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 7 66,388,308 - 66,388,368 EPDNEW
RGD ID: 6841476 Promoter ID: MM_KWN:50951 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lung Transcripts: UC009HHC.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 7 73,409,886 - 73,410,386 (-) MPROMDB
RGD ID: 6841477 Promoter ID: MM_KWN:50954 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: MEF_B6 Transcripts: OTTMUST00000061380 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 7 73,488,061 - 73,488,561 (-) MPROMDB
RGD ID: 6841473 Promoter ID: MM_KWN:50956 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: ENSMUST00000077207, ENSMUST00000089025, OTTMUST00000061293, UC009HHG.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 7 73,533,156 - 73,534,162 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-21
Lrrk1
leucine-rich repeat kinase 1
AW319595
expressed sequence AW319595
Symbol and/or name change
5135510 APPROVED
2024-08-21
AW319595
expressed sequence AW319595
Lrrk1
leucine-rich repeat kinase 1
Symbol and/or name change
5135510 APPROVED
