Advanced Search (OLGA)

Gene: Rbm42 (RNA binding motif protein 42) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Rbm42

Name:

RNA binding motif protein 42

RGD ID:

1314659

MGI Page

MGI

Description:

Predicted to enable mRNA binding activity. Acts upstream of or within negative regulation of mRNA splicing, via spliceosome. Predicted to be located in cytoplasm. Predicted to be part of U4/U6 x U5 tri-snRNP complex. Is expressed in several structures, including genitourinary system; heart; liver; lung; and spleen. Orthologous to human RBM42 (RNA binding motif protein 42).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1700003D06Rik; 3100004P22Rik; RNA-binding motif protein 42; RNA-binding protein 42

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RBM42 (RNA binding motif protein 42)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Rbm42 (RNA binding motif protein 42)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rbm42 (RNA binding motif protein 42)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RBM42 (RNA binding motif protein 42)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RBM42 (RNA binding motif protein 42)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rbm42 (RNA binding motif protein 42)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RBM42 (RNA binding motif protein 42)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RBM42 (RNA binding motif protein 42)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rbm42 (RNA binding motif protein 42)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Rbm42 (RNA binding motif protein 42)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RBM42 (RNA binding motif protein 42)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rbm42 (RNA binding motif protein 42)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG2931	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rbm-42	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rbm42	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	30,340,420 - 30,349,653 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	30,340,424 - 30,349,742 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	30,640,995 - 30,650,228 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	30,640,999 - 30,650,317 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	31,426,014 - 31,435,247 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	30,349,761 - 30,358,925 (-)	NCBI		MGSCv36	mm8
Celera	7	25,232,827 - 25,242,063 (-)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	18.95	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rbm42	Mouse	Brugada syndrome 5		ISO	RBM42 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Brugada syndrome 5	ClinVar	PMID:28492532
Rbm42	Mouse	dystonia		ISO	RBM42 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dystonic disorder	ClinVar	PMID:32581362
Rbm42	Mouse	hereditary spastic paraplegia 75		ISO	RBM42 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia 75	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rbm42	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of RBM42 mRNA	CTD	PMID:21570461
Rbm42	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Rbm42 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in increased expression of RBM42 mRNA	CTD	PMID:33387578 and PMID:34747641
Rbm42	Mouse	4,4'-sulfonyldiphenol	increases expression	EXP		6480464	bisphenol S results in increased expression of RBM42 mRNA	CTD	PMID:39298647
Rbm42	Mouse	acrolein	multiple interactions	ISO	RBM42 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of RBM42 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of RBM42 mRNA	CTD	PMID:32699268
Rbm42	Mouse	alpha-pinene	multiple interactions	ISO	RBM42 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of RBM42 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of RBM42 mRNA	CTD	PMID:32699268
Rbm42	Mouse	antirheumatic drug	increases expression	ISO	RBM42 (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of RBM42 mRNA	CTD	PMID:24449571
Rbm42	Mouse	aristolochic acid A	increases expression	ISO	RBM42 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of RBM42 mRNA	CTD	PMID:33212167
Rbm42	Mouse	arsane	affects methylation	ISO	RBM42 (Homo sapiens)	6480464	Arsenic affects the methylation of RBM42 gene	CTD	PMID:25304211
Rbm42	Mouse	arsenic atom	affects methylation	ISO	RBM42 (Homo sapiens)	6480464	Arsenic affects the methylation of RBM42 gene	CTD	PMID:25304211
Rbm42	Mouse	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of RBM42 mRNA	CTD	PMID:22228805
Rbm42	Mouse	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RBM42 (Homo sapiens)	6480464	7 more ...	CTD	PMID:20018196
Rbm42	Mouse	beta-lapachone	increases expression	ISO	RBM42 (Homo sapiens)	6480464	beta-lapachone results in increased expression of RBM42 mRNA	CTD	PMID:38218311
Rbm42	Mouse	bisphenol A	increases expression	ISO	Rbm42 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of RBM42 mRNA	CTD	PMID:25181051
Rbm42	Mouse	bisphenol A	multiple interactions	ISO	RBM42 (Homo sapiens)	6480464	[[ginger extract results in increased abundance of Oils and Volatile] which co-treated with bisphenol A] affects the expression of RBM42 protein	CTD	PMID:33376534
Rbm42	Mouse	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of RBM42 mRNA	CTD	PMID:33221593
Rbm42	Mouse	C60 fullerene	decreases expression	ISO	Rbm42 (Rattus norvegicus)	6480464	fullerene C60 results in decreased expression of RBM42 mRNA	CTD	PMID:19167457
Rbm42	Mouse	cadmium dichloride	increases expression	ISO	RBM42 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of RBM42 mRNA	CTD	PMID:38568856
Rbm42	Mouse	cocaine	affects expression	ISO	Rbm42 (Rattus norvegicus)	6480464	Cocaine affects the expression of RBM42 mRNA	CTD	PMID:20187946
Rbm42	Mouse	copper(II) sulfate	increases expression	ISO	RBM42 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of RBM42 mRNA	CTD	PMID:19549813
Rbm42	Mouse	elemental selenium	increases expression	ISO	RBM42 (Homo sapiens)	6480464	Selenium results in increased expression of RBM42 mRNA	CTD	PMID:19244175
Rbm42	Mouse	finasteride	increases expression	ISO	Rbm42 (Rattus norvegicus)	6480464	Finasteride results in increased expression of RBM42 mRNA	CTD	PMID:24136188
Rbm42	Mouse	flutamide	increases expression	ISO	Rbm42 (Rattus norvegicus)	6480464	Flutamide results in increased expression of RBM42 mRNA	CTD	PMID:24136188
Rbm42	Mouse	folic acid	increases expression	EXP		6480464	Folic Acid results in increased expression of RBM42 mRNA	CTD	PMID:25629700
Rbm42	Mouse	hydrogen peroxide	affects expression	ISO	RBM42 (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of RBM42 mRNA	CTD	PMID:21179406
Rbm42	Mouse	ivermectin	decreases expression	ISO	RBM42 (Homo sapiens)	6480464	Ivermectin results in decreased expression of RBM42 protein	CTD	PMID:32959892
Rbm42	Mouse	lead(0)	decreases expression	ISO	RBM42 (Homo sapiens)	6480464	Lead results in decreased expression of RBM42 mRNA	CTD	PMID:19921347
Rbm42	Mouse	ozone	multiple interactions	ISO	RBM42 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of RBM42 mRNA more ...	CTD	PMID:32699268
Rbm42	Mouse	selenium atom	increases expression	ISO	RBM42 (Homo sapiens)	6480464	Selenium results in increased expression of RBM42 mRNA	CTD	PMID:19244175
Rbm42	Mouse	sodium arsenite	increases expression	ISO	RBM42 (Homo sapiens)	6480464	sodium arsenite results in increased expression of RBM42 mRNA	CTD	PMID:38568856
Rbm42	Mouse	sulindac	decreases expression	ISO	Rbm42 (Rattus norvegicus)	6480464	Sulindac results in decreased expression of RBM42 mRNA	CTD	PMID:24136188
Rbm42	Mouse	tetrachloroethene	decreases expression	EXP		6480464	Tetrachloroethylene results in decreased expression of RBM42 mRNA	CTD	PMID:28973375
Rbm42	Mouse	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of RBM42 mRNA	CTD	PMID:31919559
Rbm42	Mouse	thiram	increases expression	ISO	RBM42 (Homo sapiens)	6480464	Thiram results in increased expression of RBM42 mRNA	CTD	PMID:38568856
Rbm42	Mouse	titanium dioxide	decreases methylation	EXP		6480464	titanium dioxide results in decreased methylation of RBM42 gene	CTD	PMID:35295148
Rbm42	Mouse	titanium dioxide	increases methylation	EXP		6480464	titanium dioxide results in increased methylation of RBM42 gene	CTD	PMID:35295148
Rbm42	Mouse	triphenyl phosphate	affects expression	ISO	RBM42 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of RBM42 mRNA	CTD	PMID:37042841
Rbm42	Mouse	valproic acid	increases methylation	ISO	RBM42 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of RBM42 gene	CTD	PMID:29154799
Rbm42	Mouse	vinclozolin	increases expression	ISO	Rbm42 (Rattus norvegicus)	6480464	vinclozolin results in increased expression of RBM42 mRNA	CTD	PMID:23034163
Rbm42	Mouse	vitamin E	increases expression	ISO	RBM42 (Homo sapiens)	6480464	Vitamin E results in increased expression of RBM42 mRNA	CTD	PMID:19244175

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rbm42	Mouse	negative regulation of mRNA splicing, via spliceosome	acts_upstream_of_or_within	IMP		2290270	PMID:23636947	MGI	PMID:23636947

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rbm42	Mouse	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	2290270		UniProt	GO_REF:0000044
Rbm42	Mouse	U4/U6 x U5 tri-snRNP complex	part_of	ISO	UniProtKB:Q9BTD8	2290270		GO_Central	GO_REF:0000119
Rbm42	Mouse	U4/U6 x U5 tri-snRNP complex	part_of	IEA	UniProtKB:Q9BTD8 and ensembl:ENSP00000262633	2290270		Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rbm42	Mouse	mRNA binding	enables	IEA	InterPro:IPR050825	2290270		InterPro	GO_REF:0000002
Rbm42	Mouse	mRNA binding	enables	IBA	PANTHER:PTN002935362 more ...	2290270		GO_Central	GO_REF:0000033
Rbm42	Mouse	protein binding	enables	ISO	UniProtKB:P25788 and UniProtKB:P61978	9068941	PMID:35271311	IntAct	PMID:35271311
Rbm42	Mouse	protein binding	enables	ISO	UniProtKB:P86480 and UniProtKB:Q6ZRY4	9068941	PMID:32296183	IntAct	PMID:32296183
Rbm42	Mouse	protein binding	enables	ISO	UniProtKB:P61978	9068941	PMID:16189514 more ...	IntAct	PMID:16189514 more ...
Rbm42	Mouse	protein binding	enables	ISO	UniProtKB:P25788	9068941	PMID:25416956	IntAct	PMID:25416956

#	Reference Title	Reference Citation
1.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	MGDs mouse GO annotations	MGD data from the GO Consortium
3.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:10349636	PMID:11042159	PMID:11076861	PMID:12477932	PMID:15782199	PMID:16141072	PMID:16141073	PMID:19170760	PMID:21873635	PMID:23636947

Rbm42
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	30,340,420 - 30,349,653 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	30,340,424 - 30,349,742 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	30,640,995 - 30,650,228 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	30,640,999 - 30,650,317 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	31,426,014 - 31,435,247 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	30,349,761 - 30,358,925 (-)	NCBI		MGSCv36	mm8
Celera	7	25,232,827 - 25,242,063 (-)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	18.95	NCBI

RBM42
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	35,629,036 - 35,637,685 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	35,629,030 - 35,637,686 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	36,119,938 - 36,128,587 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	40,811,820 - 40,820,427 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	19	32,833,444 - 32,842,052 (+)	NCBI		Celera
Cytogenetic Map	19	q13.12	NCBI
HuRef	19	32,625,223 - 32,633,832 (+)	NCBI		HuRef
CHM1_1	19	36,121,512 - 36,130,119 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	38,173,991 - 38,182,639 (+)	NCBI		T2T-CHM13v2.0

Rbm42
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	95,026,050 - 95,036,020 (-)	NCBI		GRCr8
mRatBN7.2	1	85,898,618 - 85,908,569 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	85,898,625 - 85,908,573 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	91,314,846 - 91,324,699 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,781,017 - 99,790,871 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	93,073,133 - 93,082,985 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	89,099,296 - 89,109,248 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	89,099,277 - 89,109,230 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	90,254,914 - 90,264,857 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	85,692,754 - 85,702,684 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	85,770,869 - 85,780,753 (-)	NCBI
Celera	1	80,270,333 - 80,280,263 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

Rbm42
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	4,844,747 - 4,854,504 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	4,844,780 - 4,854,261 (+)	NCBI	ChiLan1.0	ChiLan1.0

RBM42
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	41,625,564 - 41,634,271 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	43,609,051 - 43,617,721 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	32,559,215 - 32,567,899 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	41,295,079 - 41,303,817 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	41,294,818 - 41,303,817 (+)	Ensembl	panpan1.1		panPan2

RBM42
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	116,978,132 - 116,985,845 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	116,971,365 - 116,985,796 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	116,383,343 - 116,391,065 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	117,581,376 - 117,589,098 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	117,581,172 - 117,589,073 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	117,144,359 - 117,152,078 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	116,768,265 - 116,775,987 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	117,824,179 - 117,831,897 (-)	NCBI		UU_Cfam_GSD_1.0

Rbm42
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	10,960,493 - 10,969,107 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936570	676,537 - 685,419 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936570	676,775 - 685,415 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RBM42
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	45,074,540 - 45,083,239 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	45,074,527 - 45,083,124 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	40,531,490 - 40,540,418 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RBM42
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	30,539,718 - 30,548,412 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	30,539,721 - 30,548,414 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	8,335,012 - 8,343,699 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rbm42
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	7,991,462 - 8,000,804 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	7,991,685 - 8,000,314 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Rbm42
533 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	450
Count of miRNA genes:	234
Interacting mature miRNAs:	243
Transcripts:	ENSMUST00000042726, ENSMUST00000108141, ENSMUST00000140550
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
25314307	Mlh1fc2_m	MLH1 foci count 2 (mouse)					7	6502999	133501729	Mouse
4141566	Femwf8_m	femur work to failure 8 (mouse)			Not determined			13032485	47032621	Mouse
1301969	Lbw5_m	lupus NZB x NZW 5 (mouse)			Not determined		7	26847615	60851775	Mouse
38501068	Tip1_m	tuberculosis immunophenotype 1, spleen CFU (mouse)					7	3602999	72549748	Mouse
25314314	Sccor1_m	synaptonemal complex length to mean MLH1 count ratio 1 (mouse)					7	13333925	47349748	Mouse
7394747	asp3_m	audiogenic seizure prone 3 (mouse)			Not determined		7	27305798	36842367	Mouse
12790989	Tgl6_m	triglyceride 6 (mouse)					7	27540549	61540549	Mouse
11522751	Cocia17_m	cocaine-induced activity, QTL 17 (mouse)					7	13135204	47135204	Mouse
12792978	Fbmd3_m	femoral bone mineral density 3, females only (mouse)					7	7050288	142367832	Mouse
4141805	Sle19_m	systematic lupus erythematosus susceptibility 19 (mouse)			Not determined			30032485	81135653	Mouse
1301572	Sluc30_m	susceptibility to lung cancer 30 (mouse)			Not determined		7	2431696	36431844	Mouse
1357699	Nhdlq6_m	non-HDL QTL 6 (mouse)			Not determined		7	9988867	43988984	Mouse
10449158	Eosn3_m	eosinophil differential 3 (mouse)					7	12480877	46480877	Mouse
1301709	Bdt4_m	bone density traits 4 (mouse)			Not determined		7	22888572	56888716	Mouse
1300722	Sle3_m	systemic lupus erythmatosus susceptibility 3 (mouse)			Not determined		7	3511728	87142720	Mouse
1301041	Prnr2_m	prion resistance 2 (mouse)			Not determined		7	18728794	39674033	Mouse
12904742	Litsq2_m	litter size QTL 2 (mouse)					7	22673887	56674033	Mouse
1301622	Eae12_m	susceptibility to experimental allergic encephalomyelitis 12 (mouse)			Not determined		7	19280015	53280104	Mouse
11354952	Pdcc1_m	plasmacytoid dentritic cell compartment 1 (mouse)					7	23066531	57066531	Mouse
10449139	Eosn1_m	eosinophil differential 1 (mouse)					7	12480877	46480877	Mouse
26884404	Huml1_m	humerus length 1, 5 week (mouse)					7	30199425	108999207	Mouse
1301052	Bhr6_m	bronchial hyperresponsiveness 6 (mouse)			Not determined		7	19842250	53842367	Mouse
1301158	Eae4_m	susceptibility to experimental allergic encephalomyelitis 4 (mouse)			Not determined		7	19147398	141919804	Mouse
10412199	Sst2_m	susceptibility to tuberculosis 2 (mouse)			Not determined		7	18728794	119485380	Mouse
1558893	Spir1_m	Streptococcus pneumoniae infection resistance 1 (mouse)			Not determined		7	10305798	44305936	Mouse
1559016	Drsi_m	DCC-related Spp1 induction (mouse)			Not determined		7	16637293	49159331	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_133693	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC167978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK005626	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK013929	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK151000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK180439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK182871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK183303	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK184262	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK185695	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK186252	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK186331	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK188004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK189364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK194325	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK197356	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK208148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK209948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK210537	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK211115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK211257	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK213483	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK213653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK215240	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK216265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK217622	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC009148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC011286	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC027372	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC039917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC057928	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY350471	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY551742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466593	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000042726 ⟹ ENSMUSP00000040005

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	7	30,340,426 - 30,349,742 (-)	Ensembl
GRCm38.p6 Ensembl	7	30,641,001 - 30,650,317 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000108141 ⟹ ENSMUSP00000103776

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	7	30,340,424 - 30,349,569 (-)	Ensembl
GRCm38.p6 Ensembl	7	30,640,999 - 30,650,144 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000140550

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	7	30,343,525 - 30,345,412 (-)	Ensembl
GRCm38.p6 Ensembl	7	30,644,100 - 30,645,987 (-)	Ensembl

RefSeq Acc Id:

NM_133693 ⟹ NP_598454

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	7	30,340,420 - 30,349,653 (-)	NCBI
GRCm38	7	30,640,995 - 30,650,228 (-)	ENTREZGENE
MGSCv37	7	31,426,014 - 31,435,247 (-)	RGD
Celera	7	25,232,827 - 25,242,063 (-)	RGD
cM Map	7		ENTREZGENE

Sequence:

show sequence

GTGGCCAAGTCTCAGCCCCTGTTCTTAAACTACGTCCTCACGCAGCGCATCCGTCGCGGTAGTCCATACGTCATCGGCCGGCTCCCACCCTGAGACGACAGGGACTCGACCGTAGAACCCGCTGCGGC
TGCTGGAAGGAGCGGTGAAGGCTATGGCATCAGCGATGGCCGGAGCAGGGCCGGCTCCGGGACTCCCGGTGGCGGGAGGGCCGGTGGTCCCGGGGCCTGGTGTCGGCATCCCGGGCAAGAGCGGCGAG
GAACGCTTGAAAGAAATGGAGGCGGAGATGGCCCTGTTTGAGCAAGAAGTATTGGGAGCTCCGGTGACCGGAATCCCAACTGCTGTGCCTGCGGTGCCCACGGTAGAAGCGATGCAGGTCCCCCCAGC
TCCTGTGATCCGCCCAATTATCGCCACCAACACATACCAACAGGTCCAACAGACTCTGGAGGCCAGGGCAGCTGCTGCAGCCACAGTTGTTCCTCCCATGGTGGGAGGCCCTCCTTTTGTGGGCCCAG
TTGGCTTTGGCCCTGCCGATCGTGGTCACCTGGACAGTCCTGAGGCTCGAGAGGCCATGTTCCTGAGGCGAGCAGCTGTGGCCCCTCAGAGGGCCCCTATCCTGCGTCCTGCCTTCGTCCCCCACGTG
CTACAGAGAGCAGATTCTGCCCTTTCCTCTGCAGCTGGTGGCCCCCGACCTATGGCCCTGAGGCCTCCACACCAGGCCCTGGTTGGACCCCCTCTGCCTGGGCCTCCTGGACCACCCATGATGCTGCC
ACCAATGGCTCGGGCACCTGGACCACCCCTGGGTTCTATGGCTGCTCTGAGACCTCCCCTGGAAGAGCCAGCAGCTCCACGAGAGCTAGGCCTAGGCCTTGGTTTGGGCCTGAAGGACAAGGAAGAGG
CAGTAGTGGCCGCAGCGGCTGGGCTGGAGGAAGCTAGCGCAGCAGTGGCAGTGGGGGCAGGAGGAGCCCCAGCTGGGCCTGCAGTCATTGGCCCCAGCCTCCCGCTGGCCCTCGCCATGCCCTTGCCT
GAGCCTGAGCCCTTGCCCCTCCCACTGGAGGTGGTACGTGGCCTGCTGCCTCCGCTGAGAATTCCTGAGCTCTTGTCTCTCCGTCCACGACCTCGGCCCCCTCGGCCTGAGCCTCCTCCTGGCCTCAT
GGCCCTAGAGGTGCCAGAGCCACTGGGTGAAGACAAGAAGAAAGGCAAGCCAGAGAAACTGAAACGCTGCATTCGCACAGCAGCGGGGAGCAGCTGGGAGGACCCCAGCCTGCTGGAGTGGGATGCCG
ATGACTTCCGGATCTTCTGCGGGGATCTGGGCAATGAGGTGAACGATGACATCTTGGCACGAGCCTTCAGCCGCTTCCCATCCTTCCTTAAGGCTAAGGTGATCCGTGACAAGCGCACAGGCAAAACC
AAGGGCTATGGCTTTGTCAGCTTCAAAGACCCCAGTGACTATGTGCGCGCCATGCGAGAGATGAATGGGAAGTATGTGGGCTCACGCCCCATCAAGCTTCGCAAAAGCATGTGGAAGGACCGGAACCT
GGATGTGGTCCGTAAGAAGCAGAAGGAAAAGAAAAAGTTGGGCCTCAGATAGGATCTGTGGCTAAGCACCCGCTCCCACCCGGCTGTGCGCTAGCTCCTTTCAACAGTTGTCCACTCGCCTGTCCCAA
AACCAGTTTCAATAAATTACCTTCATTTCCATCCCTG

hide sequence


Protein RefSeqs	NP_598454	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH09148	(Get FASTA)	NCBI Sequence Viewer
	AAH11286	(Get FASTA)	NCBI Sequence Viewer
	AAH27372	(Get FASTA)	NCBI Sequence Viewer
	AAH57928	(Get FASTA)	NCBI Sequence Viewer
	BAE30024	(Get FASTA)	NCBI Sequence Viewer
	EDL24001	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000040005
	ENSMUSP00000040005.7
GenBank Protein	Q91V81	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_598454 ⟸ NM_133693

- UniProtKB:

Q3UBE0 (UniProtKB/Swiss-Prot), Q91V81 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MASAMAGAGPAPGLPVAGGPVVPGPGVGIPGKSGEERLKEMEAEMALFEQEVLGAPVTGIPTAVPAVPTVEAMQVPPAPVIRPIIATNTYQQVQQTLEARAAAAATVVPPMVGGPPFVGPVGFGPADR
GHLDSPEAREAMFLRRAAVAPQRAPILRPAFVPHVLQRADSALSSAAGGPRPMALRPPHQALVGPPLPGPPGPPMMLPPMARAPGPPLGSMAALRPPLEEPAAPRELGLGLGLGLKDKEEAVVAAAAG
LEEASAAVAVGAGGAPAGPAVIGPSLPLALAMPLPEPEPLPLPLEVVRGLLPPLRIPELLSLRPRPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPSLLEWDADDFRIFCG
DLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR

hide sequence

Ensembl Acc Id:

ENSMUSP00000103776 ⟸ ENSMUST00000108141

Ensembl Acc Id:

ENSMUSP00000040005 ⟸ ENSMUST00000042726

Protein Domains

RRM

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q91V81-F1-model_v2	AlphaFold	Q91V81	1-478	view protein structure

RGD ID:

8663497

Promoter ID:

EPDNEW_M9779

Type:

initiation region

Name:

Haus5_2

Description:

Mus musculus HAUS augmin-like complex, subunit 5 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_M9782

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	7	30,650,115 - 30,650,175	EPDNEW

RGD ID:

8663499

Promoter ID:

EPDNEW_M9780

Type:

initiation region

Name:

Rbm42_1

Description:

Mus musculus RNA binding motif protein 42 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	7	30,650,137 - 30,650,197	EPDNEW

RGD ID:

6841908

Promoter ID:

MM_KWN:49846

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Brain

Transcripts:

OTTMUST00000064687

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	7	31,430,806 - 31,431,306 (-)	MPROMDB

RGD ID:

6840258

Promoter ID:

MM_KWN:49847

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Brain, Lung, MEF_B6

Transcripts:

UC009GFP.1

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	7	31,432,236 - 31,433,512 (-)	MPROMDB

RGD ID:

6840264

Promoter ID:

MM_KWN:49848

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

ENSMUST00000042726, ENSMUST00000108141, UC009GFQ.1, UC009GFR.1

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	7	31,435,041 - 31,435,541 (-)	MPROMDB

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000036733	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000042726	ENTREZGENE
	ENSMUST00000042726.14	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.70.330	UniProtKB/Swiss-Prot
InterPro	Nucleotide-bd_a/b_plait_sf	UniProtKB/Swiss-Prot
	RBD_domain_sf	UniProtKB/Swiss-Prot
	RBM42_RRM	UniProtKB/Swiss-Prot
	RRM-Poly(A)_Binding	UniProtKB/Swiss-Prot
	RRM_dom	UniProtKB/Swiss-Prot
KEGG Report	mmu:68035	UniProtKB/Swiss-Prot
MGD	MGI:1915285	ENTREZGENE
NCBI Gene	68035	ENTREZGENE
PANTHER	RNA-BINDING PROTEIN 42	UniProtKB/Swiss-Prot
	TRNA SELENOCYSTEINE 1-ASSOCIATED PROTEIN 1-RELATED-RELATED	UniProtKB/Swiss-Prot
Pfam	RRM_1	UniProtKB/Swiss-Prot
PhenoGen	Rbm42	PhenoGen
PROSITE	RRM	UniProtKB/Swiss-Prot
SMART	RRM	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54928	UniProtKB/Swiss-Prot
UniProt	D3YYW8_MOUSE	UniProtKB/TrEMBL
	Q3UBE0	ENTREZGENE
	Q91V81	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q3UBE0	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar