Symbol:
YAP1
Name:
Yes1 associated transcriptional regulator
RGD ID:
1314421
HGNC Page
HGNC:16262
Description:
Enables DNA-binding transcription factor binding activity; transcription cis-regulatory region binding activity; and transcription coregulator activity. Involved in several processes, including cellular response to gamma radiation; hippo signaling; and regulation of gene expression. Acts upstream of or within regulation of neurogenesis and regulation of stem cell proliferation. Located in several cellular components, including cytosol; mitochondrion; and nucleoplasm. Part of TEAD-YAP complex. Is active in nucleus. Implicated in uveal coloboma-cleft lip and palate-intellectual disability. Biomarker of colorectal cancer.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
65 kDa Yes-associated protein; COB1; transcriptional coactivator YAP1; YAP; YAP-1; YAP2; YAP65; Yes associated protein 1; Yes-associated protein 1; Yes-associated protein 1, 65kDa; yes-associated protein 2; yes-associated protein beta; yes-associated protein delta; yes-associated protein YAP65 homolog; YKI; yorkie homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Yap1 (yes-associated protein 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Yap1 (Yes1 associated transcriptional regulator) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Yap1 (Yes1 associated transcriptional regulator) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
YAP1 (Yes1 associated transcriptional regulator) NCBI
Ortholog
Canis lupus familiaris (dog):
YAP1 (Yes1 associated transcriptional regulator) HGNC
HomoloGene, NCBI
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Yap1 (Yes1 associated transcriptional regulator) NCBI
Ortholog
Sus scrofa (pig):
YAP1 (Yes1 associated transcriptional regulator) HGNC
Ensembl, NCBI, OrthoDB
Chlorocebus sabaeus (green monkey):
YAP1 (Yes1 associated transcriptional regulator) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Yap1 (Yes1 associated transcriptional regulator) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Yap1 (Yes1 associated transcriptional regulator)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Yap1 (yes-associated protein 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
yap1 (Yes-associated protein 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
yap-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|PANTHER)
Drosophila melanogaster (fruit fly):
yki
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
yap1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
yap1.L
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
yap1.S
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
YAP1P1
YAP1P2
YAP1P3
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 102,110,447 - 102,233,424 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 102,110,447 - 102,233,424 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 101,981,178 - 102,104,155 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 101,486,541 - 101,609,359 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 101,486,540 - 101,609,356 NCBI Celera 11 99,142,746 - 99,265,700 (+) NCBI Celera Cytogenetic Map 11 q22.1 NCBI HuRef 11 97,907,865 - 98,030,476 (+) NCBI HuRef CHM1_1 11 101,864,181 - 101,987,123 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
YAP1 Human (+)-schisandrin B multiple interactions ISO RGD:1306035 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of YAP1 mRNA] CTD PMID:31150632 YAP1 Human (1->4)-beta-D-glucan multiple interactions ISO RGD:1550378 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of YAP1 mRNA CTD PMID:36331819 YAP1 Human (20S)-ginsenoside Rg3 decreases expression EXP 6480464 ginsenoside Rg3 results in decreased expression of YAP1 mRNA CTD PMID:31916386 YAP1 Human 1,2-dimethylhydrazine increases expression ISO RGD:1550378 6480464 1,2-Dimethylhydrazine results in increased expression of YAP1 mRNA CTD PMID:22206623 YAP1 Human 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of YAP1 mRNA CTD PMID:22574217 YAP1 Human 17beta-estradiol increases expression ISO RGD:1550378 6480464 Estradiol results in increased expression of YAP1 mRNA CTD PMID:39298647 YAP1 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Cycloheximide] results in increased expression of YAP1 mRNA; YAP1 affects the reaction more ... CTD PMID:19684285|PMID:31536130|PMID:34403729 YAP1 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1306035 6480464 Tetrachlorodibenzodioxin results in decreased expression of YAP1 mRNA CTD PMID:33387578 YAP1 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1550378 6480464 Tetrachlorodibenzodioxin results in decreased expression of YAP1 mRNA CTD PMID:33956508 YAP1 Human 2,3,7,8-tetrachlorodibenzodioxine affects response to substance EXP 6480464 YAP1 affects the susceptibility to Tetrachlorodibenzodioxin CTD PMID:31536130 YAP1 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1550378 6480464 Tetrachlorodibenzodioxin affects the expression of YAP1 mRNA CTD PMID:21570461|PMID:36222588 YAP1 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of YAP1 mRNA CTD PMID:19684285 YAP1 Human 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO RGD:1306035 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of YAP1 mRNA CTD PMID:32109520 YAP1 Human 2,6-dimethoxyphenol multiple interactions EXP 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in increased expression of and affects the more ... CTD PMID:38598786 YAP1 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 YAP1 Human 4,4'-sulfonyldiphenol increases expression ISO RGD:1550378 6480464 bisphenol S results in increased expression of YAP1 mRNA CTD PMID:39298647 YAP1 Human 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of YAP1 protein CTD PMID:34186270 YAP1 Human acetamide decreases expression ISO RGD:1306035 6480464 acetamide results in decreased expression of YAP1 mRNA CTD PMID:31881176 YAP1 Human acetic acid [2-[[(5-nitro-2-thiazolyl)amino]-oxomethyl]phenyl] ester decreases expression EXP 6480464 nitazoxanide results in decreased expression of YAP1 protein CTD PMID:39084502 YAP1 Human aconitine increases expression ISO RGD:1306035 6480464 Aconitine results in increased expression of YAP1 protein CTD PMID:33236894 YAP1 Human acrolein multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 YAP1 Human aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of YAP1 mRNA CTD PMID:22100608 YAP1 Human alpha-pinene multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 YAP1 Human antirheumatic drug increases expression EXP 6480464 Antirheumatic Agents results in increased expression of YAP1 mRNA CTD PMID:24449571 YAP1 Human arsane affects localization ISO RGD:1550378 6480464 Arsenic affects the localization of YAP1 protein CTD PMID:23942117 YAP1 Human arsane affects localization EXP 6480464 Arsenic affects the localization of YAP1 protein CTD PMID:28524356 YAP1 Human arsane multiple interactions ISO RGD:1550378 6480464 Arsenic results in increased expression of and results in decreased phosphorylation of YAP1 protein CTD PMID:23942117 YAP1 Human arsenic atom multiple interactions ISO RGD:1550378 6480464 Arsenic results in increased expression of and results in decreased phosphorylation of YAP1 protein CTD PMID:23942117 YAP1 Human arsenic atom affects localization EXP 6480464 Arsenic affects the localization of YAP1 protein CTD PMID:28524356 YAP1 Human arsenic atom affects localization ISO RGD:1550378 6480464 Arsenic affects the localization of YAP1 protein CTD PMID:23942117 YAP1 Human arsenite(3-) multiple interactions EXP 6480464 arsenite inhibits the reaction [G3BP1 protein binds to YAP1 mRNA] CTD PMID:32406909 YAP1 Human belinostat multiple interactions EXP 6480464 belinostat results in decreased expression of and results in decreased phosphorylation of YAP1 protein CTD PMID:23671600 YAP1 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of YAP1 mRNA CTD PMID:20106945 YAP1 Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of YAP1 mRNA CTD PMID:19150397 YAP1 Human bisphenol A increases expression ISO RGD:1550378 6480464 bisphenol A results in increased expression of YAP1 mRNA CTD PMID:26063408 YAP1 Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of YAP1 protein CTD PMID:38326183 YAP1 Human bisphenol A multiple interactions EXP 6480464 YAP1 protein affects the reaction [bisphenol A results in decreased expression of GPX4 protein]; YAP1 more ... CTD PMID:38103660|PMID:38326183 YAP1 Human bisphenol A decreases expression ISO RGD:1550378 6480464 bisphenol A results in decreased expression of YAP1 protein CTD PMID:38103660|PMID:38326183 YAP1 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of YAP1 protein CTD PMID:37567409 YAP1 Human bisphenol A multiple interactions ISO RGD:1550378 6480464 Imatinib Mesylate inhibits the reaction [bisphenol A results in increased phosphorylation of YAP1 protein] CTD PMID:35219798 YAP1 Human bisphenol A increases phosphorylation ISO RGD:1550378 6480464 bisphenol A results in increased phosphorylation of YAP1 protein CTD PMID:35219798 YAP1 Human bisphenol A increases methylation ISO RGD:1306035 6480464 bisphenol A results in increased methylation of YAP1 gene CTD PMID:28505145 YAP1 Human bisphenol A decreases expression ISO RGD:1306035 6480464 bisphenol A results in decreased expression of YAP1 mRNA CTD PMID:25181051|PMID:34947998 YAP1 Human bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of YAP1 mRNA CTD PMID:25912373 YAP1 Human bisphenol F multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 YAP1 Human Brodifacoum decreases expression ISO RGD:1306035 6480464 bromfenacoum results in decreased expression of YAP1 protein CTD PMID:28903499 YAP1 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of YAP1 mRNA CTD PMID:38568856 YAP1 Human cadmium dichloride multiple interactions ISO RGD:1550378 6480464 Cadmium Chloride results in increased expression of and affects the localization of YAP1 protein CTD PMID:35027733 YAP1 Human cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in decreased activity of LATS1 protein] which results in decreased phosphorylation of more ... CTD PMID:35027733 YAP1 Human caffeine affects phosphorylation EXP 6480464 Caffeine affects the phosphorylation of YAP1 protein CTD PMID:35688186 YAP1 Human captan decreases expression ISO RGD:1550378 6480464 Captan results in decreased expression of YAP1 mRNA CTD PMID:31558096 YAP1 Human carbamazepine affects expression EXP 6480464 Carbamazepine affects the expression of YAP1 mRNA CTD PMID:25979313 YAP1 Human chlorpromazine multiple interactions EXP 6480464 Chlorpromazine results in decreased expression of and results in increased phosphorylation of and affects the more ... CTD PMID:30703373 YAP1 Human choline multiple interactions ISO RGD:1550378 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 YAP1 Human chrysene increases expression ISO RGD:1550378 6480464 chrysene results in increased expression of YAP1 mRNA CTD PMID:26377693 YAP1 Human cisplatin multiple interactions EXP 6480464 [Cisplatin co-treated with 2,5,7,8-tetramethyl-2R-(4R,8R,12-trimethyltridecyl)chroman-6-yloxy acetic acid] results in decreased phosphorylation of and affects the localization more ... CTD PMID:20947521|PMID:21214929|PMID:21274007 YAP1 Human cisplatin multiple interactions ISO RGD:1550378 6480464 Imatinib Mesylate inhibits the reaction [Cisplatin results in increased phosphorylation of YAP1 protein] CTD PMID:35219798 YAP1 Human cisplatin increases phosphorylation ISO RGD:1550378 6480464 Cisplatin results in increased phosphorylation of YAP1 protein CTD PMID:35219798 YAP1 Human cisplatin decreases response to substance EXP 6480464 YAP1 results in decreased susceptibility to Cisplatin CTD PMID:20947521 YAP1 Human cisplatin increases response to substance EXP 6480464 YAP1 protein results in increased susceptibility to Cisplatin CTD PMID:20729916 YAP1 Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of YAP1 protein modified form CTD PMID:21214929 YAP1 Human copper atom decreases phosphorylation EXP 6480464 Copper results in decreased phosphorylation of YAP1 protein CTD PMID:35027733 YAP1 Human copper(0) decreases phosphorylation EXP 6480464 Copper results in decreased phosphorylation of YAP1 protein CTD PMID:35027733 YAP1 Human copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of YAP1 mRNA CTD PMID:19549813 YAP1 Human coumarin affects phosphorylation EXP 6480464 coumarin affects the phosphorylation of YAP1 protein CTD PMID:35688186 YAP1 Human crocidolite asbestos increases expression EXP 6480464 Asbestos, Crocidolite results in increased expression of YAP1 mRNA CTD PMID:18687144 YAP1 Human Cuprizon affects expression ISO RGD:1306035 6480464 Cuprizone affects the expression of YAP1 mRNA CTD PMID:27523638 YAP1 Human cycloheximide multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Cycloheximide] results in increased expression of YAP1 mRNA CTD PMID:19684285 YAP1 Human cyclophosphamide multiple interactions ISO RGD:1306035 6480464 Cyclophosphamide results in decreased expression of and results in increased phosphorylation of YAP1 protein; Melatonin more ... CTD PMID:36154502 YAP1 Human deoxynivalenol decreases phosphorylation EXP 6480464 deoxynivalenol results in decreased phosphorylation of YAP1 protein CTD PMID:33890134 YAP1 Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 YAP1 Human dextran sulfate multiple interactions ISO RGD:1550378 6480464 [RASSF1 gene mutant form results in increased susceptibility to Dextran Sulfate] which results in increased more ... CTD PMID:24146755 YAP1 Human dibutyl phthalate decreases expression ISO RGD:1550378 6480464 Dibutyl Phthalate results in decreased expression of YAP1 mRNA CTD PMID:17361019 YAP1 Human dichloroacetic acid affects localization EXP 6480464 Dichloroacetic Acid affects the localization of YAP1 protein CTD PMID:33405312 YAP1 Human dichloroacetic acid multiple interactions EXP 6480464 YAP1 protein mutant form inhibits the reaction [Dichloroacetic Acid results in decreased expression of EPCAM more ... CTD PMID:33405312 YAP1 Human dioxygen multiple interactions ISO RGD:1550378 6480464 [[Oxygen deficiency co-treated with Blood Glucose deficiency] co-treated with [Oxygen co-treated with Blood Glucose]] results more ... CTD PMID:35307376 YAP1 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 YAP1 Human doxorubicin multiple interactions EXP 6480464 [Doxorubicin co-treated with 2,5,7,8-tetramethyl-2R-(4R,8R,12-trimethyltridecyl)chroman-6-yloxy acetic acid] results in decreased phosphorylation of and affects the localization more ... CTD PMID:21214929 YAP1 Human doxorubicin increases phosphorylation ISO RGD:1306035 6480464 Doxorubicin results in increased phosphorylation of YAP1 protein CTD PMID:35093381 YAP1 Human doxorubicin decreases response to substance ISO RGD:1306035 6480464 YAP1 protein results in decreased susceptibility to Doxorubicin CTD PMID:32434049 YAP1 Human doxorubicin multiple interactions ISO RGD:1306035 6480464 Doxorubicin inhibits the reaction [YAP1 protein binds to PRKN promoter]; Melatonin inhibits the reaction [Doxorubicin more ... CTD PMID:32434049|PMID:35093381 YAP1 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of YAP1 mRNA CTD PMID:29803840 YAP1 Human doxorubicin decreases expression ISO RGD:1306035 6480464 Doxorubicin results in decreased expression of YAP1 mRNA; Doxorubicin results in decreased expression of YAP1 more ... CTD PMID:32434049 YAP1 Human doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of YAP1 protein modified form CTD PMID:21214929 YAP1 Human ethanol increases expression ISO RGD:1550378 6480464 Ethanol results in increased expression of YAP1 mRNA CTD PMID:30319688 YAP1 Human ethyl methanesulfonate increases expression EXP 6480464 Ethyl Methanesulfonate results in increased expression of YAP1 mRNA CTD PMID:23649840 YAP1 Human Evodiamine decreases expression EXP 6480464 evodiamine results in decreased expression of YAP1 mRNA; evodiamine results in decreased expression of YAP1 more ... CTD PMID:32057900 YAP1 Human Evodiamine multiple interactions EXP 6480464 evodiamine results in increased phosphorylation of and affects the localization of YAP1 protein; XMU-MP-1 inhibits more ... CTD PMID:32057900 YAP1 Human fenofibrate affects localization ISO RGD:1550378 6480464 Fenofibrate affects the localization of YAP1 protein CTD PMID:39442682 YAP1 Human fenofibrate multiple interactions ISO RGD:1550378 6480464 Fenofibrate results in increased expression of and results in decreased phosphorylation of YAP1 protein CTD PMID:39442682 YAP1 Human fipronil increases expression ISO RGD:1306035 6480464 fipronil results in increased expression of YAP1 mRNA CTD PMID:34044035 YAP1 Human fisetin multiple interactions EXP 6480464 fisetin results in increased phosphorylation of and affects the localization of YAP1 protein CTD PMID:31044527 YAP1 Human folic acid multiple interactions ISO RGD:1550378 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 YAP1 Human fonofos increases methylation EXP 6480464 Fonofos results in increased methylation of YAP1 promoter CTD PMID:22847954 YAP1 Human formaldehyde increases expression EXP 6480464 Formaldehyde results in increased expression of YAP1 mRNA CTD PMID:23649840 YAP1 Human FR900359 affects phosphorylation EXP 6480464 FR900359 affects the phosphorylation of YAP1 protein CTD PMID:37730182 YAP1 Human fulvestrant increases methylation EXP 6480464 Fulvestrant results in increased methylation of YAP1 gene CTD PMID:31601247 YAP1 Human furan increases expression ISO RGD:1306035 6480464 furan results in increased expression of YAP1 protein CTD PMID:27371368 YAP1 Human furfural multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of more ... CTD PMID:38598786 YAP1 Human gemcitabine affects response to substance EXP 6480464 YAP1 protein affects the susceptibility to Gemcitabine CTD PMID:26894857 YAP1 Human gemcitabine multiple interactions EXP 6480464 Gemcitabine promotes the reaction [nuciferine results in decreased expression of and results in increased phosphorylation more ... CTD PMID:26894857|PMID:31627466 YAP1 Human gingerol multiple interactions EXP 6480464 [gingerol co-treated with YAP1 protein] results in increased phosphorylation of YAP1 protein; gingerol inhibits the more ... CTD PMID:32926756 YAP1 Human gingerol affects localization EXP 6480464 gingerol affects the localization of YAP1 protein CTD PMID:32926756 YAP1 Human glyphosate increases methylation ISO RGD:1306035 6480464 Glyphosate results in increased methylation of YAP1 gene CTD PMID:31011160 YAP1 Human hexadecanoic acid affects localization EXP 6480464 Palmitic Acid affects the localization of YAP1 protein CTD PMID:37117602 YAP1 Human ibuprofen multiple interactions ISO RGD:1550378 6480464 Ibuprofen results in decreased expression of and results in increased phosphorylation of YAP1 protein CTD PMID:37453669 YAP1 Human ibuprofen decreases expression ISO RGD:1550378 6480464 Ibuprofen results in decreased expression of YAP1 mRNA CTD PMID:37453669 YAP1 Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 YAP1 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of YAP1 protein CTD PMID:32959892 YAP1 Human jaspamide multiple interactions EXP 6480464 jasplakinolide results in decreased phosphorylation of and affects the localization of YAP1 protein; YAP1 protein more ... CTD PMID:24040060 YAP1 Human L-methionine multiple interactions ISO RGD:1550378 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 YAP1 Human lead diacetate affects expression ISO RGD:1306035 6480464 lead acetate affects the expression of YAP1 mRNA CTD PMID:21864555 YAP1 Human Licochalcone A multiple interactions EXP 6480464 XMU-MP-1 inhibits the reaction [licochalcone A results in increased expression of YAP1 protein modified form] CTD PMID:34845814 YAP1 Human Licochalcone A decreases expression EXP 6480464 licochalcone A results in decreased expression of YAP1 mRNA; licochalcone A results in decreased expression more ... CTD PMID:34845814 YAP1 Human limonin affects localization EXP 6480464 limonin affects the localization of YAP1 protein CTD PMID:30738134 YAP1 Human MeIQx decreases expression EXP 6480464 2-amino-3,8-dimethylimidazo(4,5-f)quinoxaline results in decreased expression of YAP1 mRNA CTD PMID:20816883 YAP1 Human melatonin multiple interactions ISO RGD:1306035 6480464 Melatonin inhibits the reaction [Cyclophosphamide results in decreased expression of and results in increased phosphorylation more ... CTD PMID:35093381|PMID:36154502 YAP1 Human methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of YAP1 mRNA CTD PMID:28001369 YAP1 Human mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of YAP1 mRNA CTD PMID:31351048 YAP1 Human mono(2-ethylhexyl) phthalate multiple interactions EXP 6480464 IRF1 protein promotes the reaction [mono-(2-ethylhexyl)phthalate results in increased expression of YAP1 mRNA]; IRF1 protein more ... CTD PMID:31351048 YAP1 Human N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions EXP 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [tcdA protein, Clostridium difficile results in decreased expression of YAP1 more ... CTD PMID:33251692 YAP1 Human N-nitrosodiethylamine multiple interactions ISO RGD:1550378 6480464 [1,4-bis(2-(3,5-dichloropyridyloxy))benzene co-treated with Diethylnitrosamine] results in increased expression of and affects the localization of YAP1 more ... CTD PMID:21391223 YAP1 Human ochratoxin A increases expression ISO RGD:1306035 6480464 ochratoxin A results in increased expression of YAP1 protein CTD PMID:31369848 YAP1 Human octreotide multiple interactions ISO RGD:1550378 6480464 Octreotide inhibits the reaction [[[Oxygen deficiency co-treated with Blood Glucose deficiency] co-treated with [Oxygen co-treated more ... CTD PMID:35307376 YAP1 Human oleic acid affects localization EXP 6480464 Oleic Acid affects the localization of YAP1 protein CTD PMID:37117602 YAP1 Human ozone multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 YAP1 Human panobinostat increases expression EXP 6480464 panobinostat results in increased expression of YAP1 mRNA CTD PMID:26272509 YAP1 Human panobinostat multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 YAP1 Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of YAP1 mRNA CTD PMID:21420995 YAP1 Human paracetamol decreases expression ISO RGD:1306035 6480464 Acetaminophen results in decreased expression of YAP1 mRNA CTD PMID:33387578 YAP1 Human paracetamol decreases response to substance ISO RGD:1550378 6480464 YAP1 gene mutant form results in decreased susceptibility to Acetaminophen CTD PMID:34546377 YAP1 Human paracetamol multiple interactions ISO RGD:1550378 6480464 Acetaminophen results in increased expression of and affects the localization of YAP1 protein; YAP1 gene more ... CTD PMID:34546377 YAP1 Human paraoxon decreases expression EXP 6480464 Paraoxon results in decreased expression of YAP1 mRNA CTD PMID:24413757 YAP1 Human parathion increases methylation EXP 6480464 Parathion results in increased methylation of YAP1 promoter CTD PMID:22847954 YAP1 Human pentachlorophenol increases expression ISO RGD:1550378 6480464 Pentachlorophenol results in increased expression of YAP1 mRNA CTD PMID:23892564 YAP1 Human perfluorobutanesulfonic acid multiple interactions ISO RGD:1550378 6480464 [perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with ammonium 2,3,3,3-tetrafluoro-2-(heptafluoropropoxy)-propanoate co-treated with perfluorobutanesulfonic acid] more ... CTD PMID:39141488 YAP1 Human perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1550378 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of YAP1 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819|PMID:39141488 YAP1 Human perfluorooctanoic acid multiple interactions ISO RGD:1550378 6480464 [perfluorooctanoic acid co-treated with perfluorooctane sulfonic acid co-treated with ammonium 2,3,3,3-tetrafluoro-2-(heptafluoropropoxy)-propanoate co-treated with perfluorobutanesulfonic acid] more ... CTD PMID:39141488 YAP1 Human perfluorooctanoic acid multiple interactions EXP 6480464 perfluorooctanoic acid results in increased expression of and results in decreased phosphorylation of YAP1 protein CTD PMID:35346789 YAP1 Human perfluorooctanoic acid increases expression ISO RGD:1550378 6480464 perfluorooctanoic acid results in increased expression of YAP1 mRNA CTD PMID:36152675 YAP1 Human phenylmercury acetate increases expression EXP 6480464 Phenylmercuric Acetate results in increased expression of YAP1 mRNA CTD PMID:26272509 YAP1 Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 YAP1 Human quartz multiple interactions ISO RGD:1550378 6480464 CAV1 protein modified form inhibits the reaction [Quartz affects the localization of YAP1 protein]; CAV1 more ... CTD PMID:36053221 YAP1 Human quartz affects expression ISO RGD:1550378 6480464 Quartz affects the expression of YAP1 protein CTD PMID:36053221 YAP1 Human quartz affects localization ISO RGD:1550378 6480464 Quartz affects the localization of YAP1 protein CTD PMID:36053221 YAP1 Human quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of YAP1 mRNA CTD PMID:21632981 YAP1 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 YAP1 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of YAP1 mRNA CTD PMID:28595984|PMID:38568856 YAP1 Human sodium chloride multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of more ... CTD PMID:38598786 YAP1 Human sorafenib decreases response to substance EXP 6480464 YAP1 protein results in decreased susceptibility to sorafenib CTD PMID:29698666 YAP1 Human sunitinib increases expression EXP 6480464 Sunitinib results in increased expression of YAP1 mRNA CTD PMID:31533062 YAP1 Human terbufos increases methylation EXP 6480464 terbufos results in increased methylation of YAP1 promoter CTD PMID:22847954 YAP1 Human tetrachloromethane multiple interactions ISO RGD:1306035 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of YAP1 mRNA] CTD PMID:31150632 YAP1 Human tetrachloromethane increases expression ISO RGD:1550378 6480464 Carbon Tetrachloride results in increased expression of YAP1 mRNA; Carbon Tetrachloride results in increased expression more ... CTD PMID:31919559|PMID:32996673|PMID:38992766 YAP1 Human tetrachloromethane multiple interactions ISO RGD:1550378 6480464 GANT 61 inhibits the reaction [Carbon Tetrachloride results in increased expression of YAP1 mRNA]; GANT more ... CTD PMID:32996673 YAP1 Human tetrachloromethane increases expression ISO RGD:1306035 6480464 Carbon Tetrachloride results in increased expression of YAP1 mRNA CTD PMID:31150632 YAP1 Human theophylline decreases expression EXP 6480464 Theophylline results in decreased expression of YAP1 mRNA CTD PMID:18951874 YAP1 Human thioacetamide increases expression ISO RGD:1306035 6480464 Thioacetamide results in increased expression of YAP1 mRNA CTD PMID:34492290 YAP1 Human titanium dioxide affects expression ISO RGD:1550378 6480464 titanium dioxide affects the expression of YAP1 mRNA CTD PMID:17656681 YAP1 Human titanium dioxide increases methylation ISO RGD:1550378 6480464 titanium dioxide results in increased methylation of YAP1 promoter CTD PMID:35295148 YAP1 Human titanium dioxide decreases methylation ISO RGD:1550378 6480464 titanium dioxide results in decreased methylation of YAP1 gene CTD PMID:35295148 YAP1 Human trichloroethene decreases expression ISO RGD:1550378 6480464 Trichloroethylene results in decreased expression of YAP1 mRNA CTD PMID:19448997 YAP1 Human trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of YAP1 mRNA CTD PMID:24935251|PMID:26272509 YAP1 Human trichostatin A multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 YAP1 Human triptonide decreases expression ISO RGD:1550378 6480464 triptonide results in decreased expression of YAP1 mRNA CTD PMID:33045310 YAP1 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of YAP1 mRNA CTD PMID:29154799 YAP1 Human valproic acid multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 YAP1 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of YAP1 mRNA CTD PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509 YAP1 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of YAP1 mRNA CTD PMID:25979313 YAP1 Human valproic acid decreases expression ISO RGD:1550378 6480464 Valproic Acid results in decreased expression of YAP1 mRNA CTD PMID:20546886|PMID:21427059 YAP1 Human vemurafenib affects localization EXP 6480464 vemurafenib affects the localization of YAP1 protein CTD PMID:26668268 YAP1 Human vemurafenib decreases response to substance EXP 6480464 YAP1 protein mutant form results in decreased susceptibility to vemurafenib CTD PMID:26668268 YAP1 Human vemurafenib multiple interactions EXP 6480464 [YAP1 protein mutant form results in decreased susceptibility to vemurafenib] inhibits the reaction [vemurafenib results more ... CTD PMID:26668268 YAP1 Human verteporfin decreases expression EXP 6480464 Verteporfin results in decreased expression of YAP1 protein CTD PMID:31494105 YAP1 Human verteporfin decreases activity EXP 6480464 Verteporfin results in decreased activity of YAP1 protein CTD PMID:34351699|PMID:34480788|PMID:34826200 YAP1 Human verteporfin multiple interactions ISO RGD:1306035 6480464 Verteporfin inhibits the reaction [Melatonin inhibits the reaction [Doxorubicin results in increased phosphorylation of YAP1 more ... CTD PMID:35093381 YAP1 Human verteporfin decreases expression ISO RGD:1306035 6480464 Verteporfin results in decreased expression of YAP1 protein CTD PMID:35093381 YAP1 Human verteporfin multiple interactions ISO RGD:1550378 6480464 Verteporfin inhibits the reaction [YAP1 protein binds to TEAD1 protein] CTD PMID:29893953 YAP1 Human verteporfin multiple interactions EXP 6480464 Verteporfin inhibits the reaction [AMOTL1 protein results in increased activity of YAP1 protein]; Verteporfin inhibits more ... CTD PMID:29725256|PMID:34480788|PMID:34826200 YAP1 Human vinclozolin decreases methylation ISO RGD:1306035 6480464 vinclozolin results in decreased methylation of YAP1 gene CTD PMID:30207508 YAP1 Human vinclozolin decreases expression ISO RGD:1550378 6480464 vinclozolin results in decreased expression of YAP1 mRNA CTD PMID:31601345|PMID:34182078|PMID:36642194 YAP1 Human vinclozolin multiple interactions ISO RGD:1550378 6480464 vinclozolin results in decreased expression of and results in increased phosphorylation of YAP1 protein CTD PMID:31601345|PMID:34182078|PMID:36642194 YAP1 Human wortmannin multiple interactions EXP 6480464 wortmannin promotes the reaction [Cisplatin results in increased expression of YAP1 protein modified form]; wortmannin more ... CTD PMID:21214929 YAP1 Human XMU-MP-1 decreases phosphorylation EXP 6480464 XMU-MP-1 results in decreased phosphorylation of YAP1 protein CTD PMID:35027733 YAP1 Human XMU-MP-1 multiple interactions EXP 6480464 XMU-MP-1 inhibits the reaction [evodiamine results in decreased expression of YAP1 mRNA]; XMU-MP-1 inhibits the more ... CTD PMID:31044527|PMID:32057900|PMID:34845814 YAP1 Human zearalenone increases expression ISO RGD:1550378 6480464 Zearalenone results in increased expression of YAP1 mRNA CTD PMID:30138655 YAP1 Human zearalenone increases phosphorylation ISO RGD:1550378 6480464 Zearalenone results in increased phosphorylation of YAP1 protein CTD PMID:30138655 YAP1 Human zinc atom multiple interactions EXP 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of YAP1 mRNA CTD PMID:18593933 YAP1 Human zinc dichloride multiple interactions EXP 6480464 zinc chloride results in decreased phosphorylation of and affects the localization of YAP1 protein CTD PMID:35027733 YAP1 Human zinc(0) multiple interactions EXP 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of YAP1 mRNA CTD PMID:18593933
Cellular Component
Only show annotations with direct experimental evidence (0 objects hidden)
YAP1 Human anchoring junction located_in IEA UniProtKB-KW:KW-0965 150520179 UniProt GO_REF:0000043 YAP1 Human bicellular tight junction located_in IEA UniProtKB-SubCell:SL-0265 150520179 UniProt GO_REF:0000044 YAP1 Human bicellular tight junction located_in IEA UniProtKB-KW:KW-0796 150520179 UniProt GO_REF:0000043 YAP1 Human cell junction located_in IDA 150520179 HPA GO_REF:0000052 YAP1 Human cell-cell junction located_in ISS UniProtKB:P46938 150520179 UniProt GO_REF:0000024 YAP1 Human cell-cell junction located_in IEA UniProtKB:P46938|ensembl:ENSMUSP00000069554 150520179 Ensembl GO_REF:0000107 YAP1 Human cytoplasm located_in IEA UniProtKB:P46938|ensembl:ENSMUSP00000069554 150520179 Ensembl GO_REF:0000107 YAP1 Human cytoplasm located_in IEA UniProtKB-SubCell:SL-0086 150520179 UniProt GO_REF:0000044 YAP1 Human cytoplasm located_in IEA UniProtKB-KW:KW-0963 150520179 UniProt GO_REF:0000043 YAP1 Human cytoplasm located_in IDA 150520179 PMID:17974916, PMID:18158288, PMID:21205866, PMID:25849865, PMID:29400695, PMID:31835537 UniProt PMID:17974916|PMID:18158288|PMID:21205866|PMID:25849865|PMID:29400695|PMID:31835537 YAP1 Human cytosol located_in IEA UniProtKB:P46938|ensembl:ENSMUSP00000069554 150520179 Ensembl GO_REF:0000107 YAP1 Human cytosol located_in TAS 150520179 Reactome Reactome:R-HSA-1254248|Reactome:R-HSA-1254251|Reactome:R-HSA-2028583|Reactome:R-HSA-2028598|Reactome:R-HSA-2028644|Reactome:R-HSA-2028724|Reactome:R-HSA-2032770|Reactome:R-HSA-2064406|Reactome:R-HSA-2064421|Reactome:R-HSA-9865176|Reactome:R-HSA-9865196|Reactome:R-HSA-9865226 YAP1 Human cytosol located_in IDA 150520179 PMID:30865227 FlyBase PMID:30865227 YAP1 Human female germ cell nucleus located_in IEA UniProtKB:P46938|ensembl:ENSMUSP00000069554 150520179 Ensembl GO_REF:0000107 YAP1 Human membrane located_in IEA UniProtKB:P46938|ensembl:ENSMUSP00000069554 150520179 Ensembl GO_REF:0000107 YAP1 Human membrane located_in IEA UniProtKB-KW:KW-0472 150520179 UniProt GO_REF:0000043 YAP1 Human mitochondrion located_in IDA 150520179 HPA GO_REF:0000052 YAP1 Human nucleoplasm located_in IDA 150520179 HPA GO_REF:0000052 YAP1 Human nucleoplasm located_in TAS 150520179 Reactome Reactome:R-HSA-1254248|Reactome:R-HSA-2032770|Reactome:R-HSA-2032775|Reactome:R-HSA-2064406|Reactome:R-HSA-8871260|Reactome:R-HSA-8871265|Reactome:R-HSA-8871266|Reactome:R-HSA-8951676|Reactome:R-HSA-8951695|Reactome:R-HSA-8956639|Reactome:R-HSA-8956649|Reactome:R-HSA-8956659|Reactome:R-HSA-8956676|Reactome:R-HSA-9618559|Reactome:R-HSA-9865176 YAP1 Human nucleus is_active_in IDA 150520179 PMID:35429439 UniProt PMID:35429439 YAP1 Human nucleus located_in ISO ComplexPortal:CPX-394 150520179 ComplexPortal GO_REF:0000114 YAP1 Human nucleus located_in IEA ARBA:ARBA00026330 150520179 UniProt GO_REF:0000117 YAP1 Human nucleus located_in IEA UniProtKB-KW:KW-0539 150520179 UniProt GO_REF:0000043 YAP1 Human nucleus located_in IEA UniProtKB-SubCell:SL-0191 150520179 UniProt GO_REF:0000044 YAP1 Human nucleus located_in IEA UniProtKB:P46938|ensembl:ENSMUSP00000069554 150520179 Ensembl GO_REF:0000107 YAP1 Human nucleus located_in IDA 150520179 PMID:17974916, PMID:18158288, PMID:18280240, PMID:20868367, PMID:21145499, PMID:21205866, PMID:25796446, PMID:25849865, PMID:28169360, PMID:29400695, PMID:30865227, PMID:31835537 FlyBase PMID:17974916|PMID:18158288|PMID:18280240|PMID:20868367|PMID:21145499|PMID:21205866|PMID:25796446|PMID:25849865|PMID:28169360|PMID:29400695|PMID:30865227|PMID:31835537 YAP1 Human plasma membrane located_in IDA 150520179 PMID:31835537 UniProt PMID:31835537 YAP1 Human plasma membrane located_in IEA UniProtKB-SubCell:SL-0039 150520179 UniProt GO_REF:0000044 YAP1 Human plasma membrane located_in IEA UniProtKB-KW:KW-1003 150520179 UniProt GO_REF:0000043 YAP1 Human TEAD-YAP complex part_of IDA 150520179 PMID:20123905, PMID:20368466 CAFA PMID:20123905|PMID:20368466 YAP1 Human TEAD-YAP complex part_of IEA UniProtKB:P46938|ensembl:ENSMUSP00000069554 150520179 Ensembl GO_REF:0000107 YAP1 Human TEAD-YAP complex part_of IPI 150520179 PMID:25384421 ComplexPortal PMID:25384421 YAP1 Human tight junction located_in ISO RGD:12276113 9068941 PMID:21205866 UniProt PMID:21205866 YAP1 Human transcription regulator complex part_of IEA UniProtKB:P46938|ensembl:ENSMUSP00000069554 150520179 Ensembl GO_REF:0000107
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
YAP1 Human chromatin binding enables IEA UniProtKB:P46938|ensembl:ENSMUSP00000069554 150520179 Ensembl GO_REF:0000107 YAP1 Human DNA-binding transcription factor binding enables IPI UniProtKB:P28347 150520179 PMID:20123905 CAFA PMID:20123905 YAP1 Human proline-rich region binding enables IEA UniProtKB:P46938|ensembl:ENSMUSP00000069554 150520179 Ensembl GO_REF:0000107 YAP1 Human protein binding enables IPI UniProtKB:O15169|UniProtKB:O35625|UniProtKB:P35222|UniProtKB:Q9Y297 150520179 PMID:24976009 IntAct PMID:24976009 YAP1 Human protein binding enables IPI UniProtKB:P35222 150520179 PMID:21376238, PMID:22234184, PMID:36959122 IntAct PMID:21376238|PMID:22234184|PMID:36959122 YAP1 Human protein binding ISO RGD:631347 9068941 RGD PMID:31298560|REF_RGD_ID:401793755 YAP1 Human protein binding enables IPI UniProtKB:P31946|UniProtKB:P62258|UniProtKB:P63104 150520179 PMID:36931259 IntAct PMID:36931259 YAP1 Human protein binding enables IPI UniProtKB:A3RM21 150520179 PMID:37100772 IntAct PMID:37100772 YAP1 Human protein binding enables IPI UniProtKB:O95835|UniProtKB:P28347|UniProtKB:P31946|UniProtKB:P62258|UniProtKB:P63104|UniProtKB:Q15599|UniProtKB:Q15678|UniProtKB:Q969T9 150520179 PMID:24255178 IntAct PMID:24255178 YAP1 Human protein binding enables IPI UniProtKB:O15350|UniProtKB:O95835|UniProtKB:Q8IV31|UniProtKB:Q96G27|UniProtKB:Q96PN7|UniProtKB:Q9BZD6|UniProtKB:Q9H3D4|UniProtKB:Q9P2Y5 150520179 PMID:35044719 IntAct PMID:35044719 YAP1 Human protein binding enables IPI UniProtKB:O15350|UniProtKB:Q96PN7|UniProtKB:Q9BZD6|UniProtKB:Q9P2Y5 150520179 PMID:37219487 IntAct PMID:37219487 YAP1 Human protein binding enables IPI UniProtKB:O15350-1|UniProtKB:Q9H3D4 150520179 PMID:11278685 IntAct PMID:11278685 YAP1 Human protein binding enables IPI UniProtKB:Q15678 150520179 PMID:22525271, PMID:22948661 UniProt PMID:22525271|PMID:22948661 YAP1 Human protein binding enables IPI UniProtKB:Q15561 150520179 PMID:24525233, PMID:26592798 IntAct PMID:24525233|PMID:26592798 YAP1 Human protein binding enables IPI UniProtKB:P62491 150520179 PMID:28468127 IntAct PMID:28468127 YAP1 Human protein binding enables IPI UniProtKB:Q15599 150520179 PMID:16166090, PMID:27173435 IntAct PMID:16166090|PMID:27173435 YAP1 Human protein binding enables IPI UniProtKB:Q15562 150520179 PMID:20368466 IntAct PMID:20368466 YAP1 Human protein binding enables IPI UniProtKB:P28347|UniProtKB:Q92841 150520179 PMID:24581491 IntAct PMID:24581491 YAP1 Human protein binding enables IPI UniProtKB:Q16621 150520179 PMID:9305852 BHF-UCL PMID:9305852 YAP1 Human protein binding enables IPI UniProtKB:Q02750 150520179 PMID:24211253 IntAct PMID:24211253 YAP1 Human protein binding enables IPI UniProtKB:P28347|UniProtKB:Q13131|UniProtKB:Q15561 150520179 PMID:25751140 IntAct PMID:25751140 YAP1 Human protein binding enables IPI UniProtKB:P28347 150520179 PMID:24882516, PMID:26258633 IntAct PMID:24882516|PMID:26258633 YAP1 Human protein binding enables IPI UniProtKB:O15105 150520179 PMID:22921829 IntAct PMID:22921829 YAP1 Human protein binding enables IPI UniProtKB:P97764 150520179 PMID:7644498, PMID:9202023 UniProt PMID:7644498|PMID:9202023 YAP1 Human protein binding enables IPI UniProtKB:O95835|UniProtKB:Q9NRM7 150520179 PMID:18158288 UniProt PMID:18158288 YAP1 Human protein binding enables IPI UniProtKB:Q4VCS5-1|UniProtKB:Q8IY63|UniProtKB:Q9Y2J4 150520179 PMID:21187284 UniProt PMID:21187284 YAP1 Human protein binding enables IPI UniProtKB:P63104 150520179 PMID:15161933, PMID:25670079, PMID:28514442 IntAct PMID:15161933|PMID:25670079|PMID:28514442 YAP1 Human protein binding enables IPI UniProtKB:P31946 150520179 PMID:17974916, PMID:19439659, PMID:20048001 IntAct PMID:17974916|PMID:19439659|PMID:20048001 YAP1 Human protein binding enables IPI UniProtKB:O14544 150520179 PMID:25180228 IntAct PMID:25180228 YAP1 Human protein binding enables IPI UniProtKB:O95835|UniProtKB:P28347 150520179 PMID:22863277 IntAct PMID:22863277 YAP1 Human protein binding enables IPI UniProtKB:O15350|UniProtKB:Q01196 150520179 PMID:18280240 UniProt PMID:18280240 YAP1 Human protein binding enables IPI UniProtKB:O14669 150520179 PMID:17502622 IntAct PMID:17502622 YAP1 Human protein binding enables IPI UniProtKB:O14578 150520179 PMID:30865227 FlyBase PMID:30865227 YAP1 Human protein binding enables IPI UniProtKB:P28347|UniProtKB:Q15561|UniProtKB:Q15562|UniProtKB:Q99594 150520179 PMID:18579750 UniProt PMID:18579750 YAP1 Human protein binding enables IPI UniProtKB:Q14160 150520179 PMID:30126976 IntAct PMID:30126976 YAP1 Human protein binding enables IPI UniProtKB:Q15797 150520179 PMID:19914168 IntAct PMID:19914168 YAP1 Human protein binding enables IPI UniProtKB:Q13625-2 150520179 PMID:11278422 IntAct PMID:11278422 YAP1 Human protein binding enables IPI UniProtKB:Q15562-2 150520179 PMID:32296183 IntAct PMID:32296183 YAP1 Human protein binding enables IPI UniProtKB:P08237,UniProtKB:P28347 150520179 PMID:25796446 CAFA PMID:25796446 YAP1 Human protein binding enables IPI UniProtKB:Q9BZD6 150520179 PMID:23873930 IntAct PMID:23873930 YAP1 Human protein binding enables IPI UniProtKB:O14669|UniProtKB:O15105|UniProtKB:O15350|UniProtKB:O95835|UniProtKB:Q01196|UniProtKB:Q13635|UniProtKB:Q15303|UniProtKB:Q15678|UniProtKB:Q969T9|UniProtKB:Q96G27 150520179 PMID:25283809 IntAct PMID:25283809 YAP1 Human protein binding enables IPI UniProtKB:O95835|UniProtKB:P31946|UniProtKB:P62258|UniProtKB:Q15678|UniProtKB:Q969T9 150520179 PMID:24366813 IntAct PMID:24366813 YAP1 Human protein binding enables IPI UniProtKB:O95835|UniProtKB:P28347|UniProtKB:P62258|UniProtKB:Q13131|UniProtKB:Q15561|UniProtKB:Q15562|UniProtKB:Q15678|UniProtKB:Q5EG47|UniProtKB:Q969T9 150520179 PMID:25751139 IntAct PMID:25751139 YAP1 Human protein binding enables IPI UniProtKB:P32926,UniProtKB:P61981,UniProtKB:Q13835 150520179 PMID:31835537 UniProt PMID:31835537 YAP1 Human protein binding enables IPI UniProtKB:P28347|UniProtKB:Q15562 150520179 PMID:35140242 IntAct PMID:35140242 YAP1 Human protein binding enables IPI UniProtKB:P35222|UniProtKB:Q99593 150520179 PMID:23245941 IntAct PMID:23245941 YAP1 Human protein binding enables IPI UniProtKB:P12931 150520179 PMID:25731159 UniProt PMID:25731159 YAP1 Human protein binding enables IPI UniProtKB:P31946|UniProtKB:P63104|UniProtKB:Q15561|UniProtKB:Q15562|UniProtKB:Q15599|UniProtKB:Q15678|UniProtKB:Q9BZD6|UniProtKB:Q9Y297 150520179 PMID:33961781 IntAct PMID:33961781 YAP1 Human protein binding enables IPI UniProtKB:P31946|UniProtKB:P62258 150520179 PMID:35271311 IntAct PMID:35271311 YAP1 Human protein binding enables IPI UniProtKB:Q4VCS5|UniProtKB:Q9Y2J4 150520179 PMID:21205866 UniProt PMID:21205866 YAP1 Human protein binding enables IPI UniProtKB:Q9Y297 150520179 PMID:21900206 IntAct PMID:21900206 YAP1 Human RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IEA UniProtKB:P46938|ensembl:ENSMUSP00000069554 150520179 Ensembl GO_REF:0000107 YAP1 Human transcription cis-regulatory region binding enables IDA 150520179 PMID:18280240 UniProt PMID:18280240 YAP1 Human transcription coactivator activity enables IMP 150520179 PMID:20123905 CAFA PMID:20123905 YAP1 Human transcription coactivator activity enables IDA 150520179 PMID:16772533, PMID:18158288, PMID:18280240, PMID:20368466, PMID:25796446, PMID:27380321 UniProt PMID:16772533|PMID:18158288|PMID:18280240|PMID:20368466|PMID:25796446|PMID:27380321 YAP1 Human transcription coactivator activity enables IBA FB:FBgn0034970|MGI:103262|MGI:1917649|PANTHER:PTN000427153|UniProtKB:P46937|UniProtKB:Q9GZV5|ZFIN:ZDB-GENE-030131-9710 150520179 GO_Central GO_REF:0000033 YAP1 Human transcription coactivator activity enables IEA UniProtKB:P46938|ensembl:ENSMUSP00000069554 150520179 Ensembl GO_REF:0000107 YAP1 Human transcription coregulator activity enables IDA 150520179 PMID:18158288 UniProt PMID:18158288 YAP1 Human transcription corepressor activity enables IDA 150520179 PMID:18158288 UniProt PMID:18158288 YAP1 Human transcription corepressor activity enables IBA PANTHER:PTN002705112|UniProtKB:P46937 150520179 GO_Central GO_REF:0000033
Imported Annotations - PID (archival)
(+)-schisandrin B (ISO) (1->4)-beta-D-glucan (ISO) (20S)-ginsenoside Rg3 (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,6-dimethoxyphenol (EXP) 3-isobutyl-1-methyl-7H-xanthine (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) acetamide (ISO) acetic acid [2-[[(5-nitro-2-thiazolyl)amino]-oxomethyl]phenyl] ester (EXP) aconitine (ISO) acrolein (EXP) aflatoxin B1 (EXP) alpha-pinene (EXP) antirheumatic drug (EXP) arsane (EXP,ISO) arsenic atom (EXP,ISO) arsenite(3-) (EXP) belinostat (EXP) benzo[a]pyrene (EXP) benzo[a]pyrene diol epoxide I (EXP) bisphenol A (EXP,ISO) bisphenol AF (EXP) bisphenol F (EXP) Brodifacoum (ISO) cadmium dichloride (EXP,ISO) caffeine (EXP) captan (ISO) carbamazepine (EXP) chlorpromazine (EXP) choline (ISO) chrysene (ISO) cisplatin (EXP,ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (EXP) coumarin (EXP) crocidolite asbestos (EXP) Cuprizon (ISO) cycloheximide (EXP) cyclophosphamide (ISO) deoxynivalenol (EXP) dexamethasone (EXP) dextran sulfate (ISO) dibutyl phthalate (ISO) dichloroacetic acid (EXP) dioxygen (ISO) dorsomorphin (EXP) doxorubicin (EXP,ISO) ethanol (ISO) ethyl methanesulfonate (EXP) Evodiamine (EXP) fenofibrate (ISO) fipronil (ISO) fisetin (EXP) folic acid (ISO) fonofos (EXP) formaldehyde (EXP) FR900359 (EXP) fulvestrant (EXP) furan (ISO) furfural (EXP) gemcitabine (EXP) gingerol (EXP) glyphosate (ISO) hexadecanoic acid (EXP) ibuprofen (ISO) indometacin (EXP) ivermectin (EXP) jaspamide (EXP) L-methionine (ISO) lead diacetate (ISO) Licochalcone A (EXP) limonin (EXP) MeIQx (EXP) melatonin (ISO) methylmercury chloride (EXP) mono(2-ethylhexyl) phthalate (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP) N-nitrosodiethylamine (ISO) ochratoxin A (ISO) octreotide (ISO) oleic acid (EXP) ozone (EXP) panobinostat (EXP) paracetamol (EXP,ISO) paraoxon (EXP) parathion (EXP) pentachlorophenol (ISO) perfluorobutanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenylmercury acetate (EXP) quartz (ISO) quercetin (EXP) SB 431542 (EXP) sodium arsenite (EXP) sodium chloride (EXP) sorafenib (EXP) sunitinib (EXP) terbufos (EXP) tetrachloromethane (ISO) theophylline (EXP) thioacetamide (ISO) titanium dioxide (ISO) trichloroethene (ISO) trichostatin A (EXP) triptonide (ISO) valproic acid (EXP,ISO) vemurafenib (EXP) verteporfin (EXP,ISO) vinclozolin (ISO) wortmannin (EXP) XMU-MP-1 (EXP) zearalenone (ISO) zinc atom (EXP) zinc dichloride (EXP) zinc(0) (EXP)
Biological Process
blastocyst development (IEA) bud elongation involved in lung branching (IEA) canonical Wnt signaling pathway (IEA) cardiac muscle tissue regeneration (IEA) cell morphogenesis (IEA) cell population proliferation (IEA) cellular response to gamma radiation (IDA) cellular response to retinoic acid (IEA) DNA damage response (IDA) embryonic heart tube morphogenesis (IEA) enterocyte differentiation (IEA) epithelial cell differentiation (IEA) epithelial cell proliferation (IEA,ISS) extrinsic apoptotic signaling pathway (IEA) glandular epithelial cell differentiation (IEA) heart process (IEA) hippo signaling (IBA,IDA,IEA,NAS,TAS) interleukin-6-mediated signaling pathway (IEA) intestinal epithelial cell development (IEA) intestinal epithelial cell differentiation (IEA) keratinocyte differentiation (IEA) lateral mesoderm development (IEA) lung epithelial cell differentiation (IEA) negative regulation of cilium assembly (IMP) negative regulation of epithelial cell apoptotic process (IMP) negative regulation of epithelial cell differentiation (IEA) negative regulation of extrinsic apoptotic signaling pathway (IEA) negative regulation of fat cell differentiation (IMP) negative regulation of gene expression (IMP) negative regulation of stem cell differentiation (IEA) negative regulation of transcription by RNA polymerase II (IMP) notochord development (IEA) organ growth (IEA,ISS) paraxial mesoderm development (IEA) polarized epithelial cell differentiation (IC) positive regulation of canonical Wnt signaling pathway (IEA) positive regulation of cardiac muscle cell proliferation (IEA) positive regulation of cell growth (IDA) positive regulation of cell population proliferation (IEA) positive regulation of DNA-templated transcription (IDA,IEA,IMP) positive regulation of epithelial cell proliferation (IEA,IMP) positive regulation of gene expression (IMP) positive regulation of Notch signaling pathway (IEA) positive regulation of organ growth (IEA) positive regulation of osteoblast differentiation (IMP) positive regulation of protein localization to nucleus (IEA,ISS) positive regulation of stem cell population maintenance (IEA) positive regulation of transcription by RNA polymerase II (IBA,IDA,IEA) protein-containing complex assembly (IDA,IMP) regulation of canonical Wnt signaling pathway (IEA) regulation of cell population proliferation (IEA) regulation of gene expression (IEA) regulation of keratinocyte proliferation (IEA) regulation of metanephric nephron tubule epithelial cell differentiation (IEA) regulation of neurogenesis (IDA) regulation of stem cell proliferation (IDA,IEA) response to progesterone (IDA) somatic stem cell population maintenance (IEA) tissue homeostasis (IEA) trophectodermal cell differentiation (IEA) vasculogenesis (IEA) wound healing (IEA)
Cellular Component
anchoring junction (IEA) bicellular tight junction (IEA) cell junction (IDA) cell-cell junction (IEA,ISS) cytoplasm (IDA,IEA) cytosol (IDA,IEA,TAS) female germ cell nucleus (IEA) membrane (IEA) mitochondrion (IDA) nucleoplasm (IDA,TAS) nucleus (IDA,IEA,ISO) plasma membrane (IDA,IEA) TEAD-YAP complex (IDA,IEA,IPI) tight junction (ISO) transcription regulator complex (IEA)
YAP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 102,110,447 - 102,233,424 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 102,110,447 - 102,233,424 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 101,981,178 - 102,104,155 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 101,486,541 - 101,609,359 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 101,486,540 - 101,609,356 NCBI Celera 11 99,142,746 - 99,265,700 (+) NCBI Celera Cytogenetic Map 11 q22.1 NCBI HuRef 11 97,907,865 - 98,030,476 (+) NCBI HuRef CHM1_1 11 101,864,181 - 101,987,123 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI T2T-CHM13v2.0
Yap1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 7,932,000 - 8,004,890 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 7,932,000 - 8,004,597 (-) Ensembl GRCm39 Ensembl GRCm38 9 7,931,999 - 8,004,638 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 7,931,999 - 8,004,596 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 7,931,999 - 8,004,596 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 7,932,520 - 8,005,109 (-) NCBI MGSCv36 mm8 Celera 9 5,324,108 - 5,396,890 (-) NCBI Celera Cytogenetic Map 9 A1 NCBI cM Map 9 2.46 NCBI
Yap1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 13,380,551 - 13,451,640 (-) NCBI GRCr8 mRatBN7.2 8 5,095,705 - 5,166,808 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 5,095,722 - 5,167,010 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 9,049,437 - 9,120,258 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 7,347,114 - 7,417,927 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 5,355,414 - 5,426,296 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 6,133,014 - 6,204,240 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 6,135,493 - 6,203,579 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 6,131,653 - 6,202,586 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 4,780,845 - 4,848,881 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 4,780,674 - 4,881,302 (-) NCBI Celera 8 6,655,412 - 6,723,571 (-) NCBI Celera Cytogenetic Map 8 q11 NCBI
Yap1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 5,423,855 - 5,534,408 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 5,423,866 - 5,533,728 (+) NCBI ChiLan1.0 ChiLan1.0
YAP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 102,911,890 - 103,039,644 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 104,002,427 - 104,128,009 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 97,061,367 - 97,186,961 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 100,556,689 - 100,681,301 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 100,552,424 - 100,681,301 (+) Ensembl panpan1.1 panPan2
YAP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 29,394,760 - 29,495,977 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 29,394,541 - 29,496,251 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 29,340,746 - 29,445,498 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 29,444,603 - 29,550,383 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 29,447,525 - 29,551,237 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 29,501,168 - 29,606,791 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 29,358,262 - 29,463,735 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 29,533,412 - 29,638,553 (-) NCBI UU_Cfam_GSD_1.0
Yap1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 85,795,986 - 85,901,455 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936551 5,634,751 - 5,740,567 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936551 5,638,383 - 5,740,523 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
YAP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 32,811,226 - 32,925,606 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 32,811,629 - 32,924,926 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 36,760,481 - 36,872,904 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
YAP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 93,479,478 - 93,605,340 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 93,479,135 - 93,606,808 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 32,256,708 - 32,382,950 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Yap1
.
Confirmed Target Of
Predicted Target Of
Count of predictions: 4277 Count of miRNA genes: 825 Interacting mature miRNAs: 932 Transcripts: ENST00000282441, ENST00000345877, ENST00000524575, ENST00000526343, ENST00000526594, ENST00000528834, ENST00000529029, ENST00000531439, ENST00000537274 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
597075477 GWAS1171551_H Cleft palate QTL GWAS1171551 (human) 0.0000006 Cleft palate 11 102208982 102208983 Human 597020381 GWAS1116455_H polycystic ovary syndrome QTL GWAS1116455 (human) 8e-11 polycystic ovary syndrome 11 102172509 102172510 Human 597478230 GWAS1574304_H sex hormone-binding globulin measurement QTL GWAS1574304 (human) 2e-12 sex hormone-binding globulin measurement 11 102186337 102186338 Human 597098265 GWAS1194339_H sex hormone-binding globulin measurement QTL GWAS1194339 (human) 5e-18 sex hormone-binding globulin measurement 11 102212964 102212965 Human 597189591 GWAS1285665_H sex hormone-binding globulin measurement QTL GWAS1285665 (human) 4e-16 sex hormone-binding globulin measurement 11 102214209 102214210 Human 597294920 GWAS1390994_H migraine disorder QTL GWAS1390994 (human) 2e-13 migraine disorder 11 102200245 102200246 Human 597098375 GWAS1194449_H sex hormone-binding globulin measurement QTL GWAS1194449 (human) 9e-15 sex hormone-binding globulin measurement 11 102214209 102214210 Human 597166210 GWAS1262284_H open-angle glaucoma QTL GWAS1262284 (human) 3e-09 open-angle glaucoma 11 102215051 102215052 Human 1559115 SCL20_H Serum cholesterol level QTL 20 (human) 3.22 0.001213 Lipid level LDL cholesterol 11 100442501 126442501 Human 597114315 GWAS1210389_H polycystic ovary syndrome QTL GWAS1210389 (human) 5e-11 polycystic ovary syndrome 11 102172509 102172510 Human 597084106 GWAS1180180_H migraine disorder, pulse pressure measurement QTL GWAS1180180 (human) 2e-17 migraine disorder, pulse pressure measurement pulse pressure (CMO:0000292) 11 102226584 102226585 Human 407043043 GWAS692019_H polycystic ovary syndrome QTL GWAS692019 (human) 1e-22 polycystic ovary syndrome 11 102199908 102199909 Human 597443710 GWAS1539784_H sex hormone-binding globulin measurement QTL GWAS1539784 (human) 4e-09 sex hormone-binding globulin measurement 11 102186337 102186338 Human 597129525 GWAS1225599_H pulse pressure measurement QTL GWAS1225599 (human) 8e-19 pulse pressure measurement pulse pressure (CMO:0000292) 11 102206469 102206470 Human 597306879 GWAS1402953_H pulse pressure measurement QTL GWAS1402953 (human) 5e-11 pulse pressure measurement pulse pressure (CMO:0000292) 11 102232869 102232870 Human 597100720 GWAS1196794_H sex hormone-binding globulin measurement QTL GWAS1196794 (human) 1e-17 sex hormone-binding globulin measurement 11 102214209 102214210 Human 407135084 GWAS784060_H migraine disorder QTL GWAS784060 (human) 2e-08 migraine disorder 11 102212877 102212878 Human 597428982 GWAS1525056_H sex hormone-binding globulin measurement QTL GWAS1525056 (human) 0.0000005 sex hormone-binding globulin measurement 11 102186337 102186338 Human 597032830 GWAS1128904_H pulse pressure measurement QTL GWAS1128904 (human) 6e-15 pulse pressure measurement pulse pressure (CMO:0000292) 11 102206469 102206470 Human 597099708 GWAS1195782_H sex hormone-binding globulin measurement QTL GWAS1195782 (human) 4e-25 sex hormone-binding globulin measurement 11 102212964 102212965 Human 597208563 GWAS1304637_H birth weight, parental genotype effect measurement QTL GWAS1304637 (human) 7e-13 birth weight, parental genotype effect measurement neonatal body weight (CMO:0002079) 11 102224604 102224605 Human 597115687 GWAS1211761_H pulse pressure measurement QTL GWAS1211761 (human) 3e-17 pulse pressure measurement pulse pressure (CMO:0000292) 11 102206469 102206470 Human 597201129 GWAS1297203_H diastolic blood pressure QTL GWAS1297203 (human) 0.000002 diastolic blood pressure diastolic blood pressure (CMO:0000005) 11 102206469 102206470 Human 597106789 GWAS1202863_H reticulocyte count QTL GWAS1202863 (human) 4e-10 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 11 102181275 102181276 Human 597075296 GWAS1171370_H Cleft palate QTL GWAS1171370 (human) 3e-08 Cleft palate 11 102208982 102208983 Human 597537386 GWAS1633460_H migraine disorder QTL GWAS1633460 (human) 2e-11 migraine disorder 11 102186337 102186338 Human 597075297 GWAS1171371_H Cleft palate QTL GWAS1171371 (human) 0.0000002 Cleft palate 11 102208982 102208983 Human 597191330 GWAS1287404_H sex hormone-binding globulin measurement QTL GWAS1287404 (human) 3e-08 sex hormone-binding globulin measurement 11 102212338 102212339 Human 597285095 GWAS1381169_H calcium measurement QTL GWAS1381169 (human) 2e-10 calcium measurement blood calcium level (CMO:0000502) 11 102129243 102129244 Human 597446371 GWAS1542445_H sex hormone-binding globulin measurement QTL GWAS1542445 (human) 7e-09 sex hormone-binding globulin measurement 11 102186337 102186338 Human
D11S1339
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 102,057,505 - 102,057,632 UniSTS GRCh37 GRCh37 11 102,057,512 - 102,057,633 UniSTS GRCh37 Build 36 11 101,562,715 - 101,562,842 RGD NCBI36 Celera 11 99,219,055 - 99,219,182 RGD Celera 11 99,219,062 - 99,219,183 UniSTS Cytogenetic Map 11 q13 UniSTS HuRef 11 97,983,970 - 97,984,095 UniSTS HuRef 11 97,983,977 - 97,984,096 UniSTS Marshfield Genetic Map 11 100.05 RGD Genethon Genetic Map 11 104.8 UniSTS TNG Radiation Hybrid Map 11 47292.0 UniSTS deCODE Assembly Map 11 104.08 UniSTS Stanford-G3 RH Map 11 4482.0 UniSTS GeneMap99-GB4 RH Map 11 348.86 UniSTS Whitehead-RH Map 11 459.6 UniSTS Whitehead-YAC Contig Map 11 UniSTS NCBI RH Map 11 882.6 UniSTS GeneMap99-G3 RH Map 11 4482.0 UniSTS
D11S1762
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 102,015,494 - 102,015,642 UniSTS GRCh37 Build 36 11 101,520,704 - 101,520,852 RGD NCBI36 Celera 11 99,177,048 - 99,177,196 RGD Cytogenetic Map 11 q13 UniSTS HuRef 11 97,941,901 - 97,942,049 UniSTS Marshfield Genetic Map 11 98.45 RGD Marshfield Genetic Map 11 98.45 UniSTS Genethon Genetic Map 11 102.6 UniSTS
RH47129
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 102,103,623 - 102,103,809 UniSTS GRCh37 GRCh37 6 147,731,931 - 147,732,117 UniSTS GRCh37 Build 36 6 147,773,624 - 147,773,810 RGD NCBI36 Celera 11 99,265,169 - 99,265,355 UniSTS Celera 6 148,472,375 - 148,472,561 RGD Cytogenetic Map 11 q13 UniSTS HuRef 11 98,029,945 - 98,030,131 UniSTS HuRef 6 145,295,551 - 145,295,737 UniSTS
RH91842
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 101,980,560 - 101,980,694 UniSTS GRCh37 Build 36 11 101,485,770 - 101,485,904 RGD NCBI36 Celera 11 99,142,114 - 99,142,248 RGD Cytogenetic Map 11 q13 UniSTS HuRef 11 97,907,233 - 97,907,367 UniSTS GeneMap99-GB4 RH Map 11 344.41 UniSTS
RH41050
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 102,103,685 - 102,103,873 UniSTS GRCh37 GRCh37 6 147,731,993 - 147,732,181 UniSTS GRCh37 Build 36 6 147,773,686 - 147,773,874 RGD NCBI36 Celera 11 99,265,231 - 99,265,419 UniSTS Celera 6 148,472,437 - 148,472,625 RGD Cytogenetic Map 11 q13 UniSTS HuRef 11 98,030,007 - 98,030,195 UniSTS HuRef 6 145,295,613 - 145,295,801 UniSTS
SHGC-77975
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 102,011,906 - 102,012,227 UniSTS GRCh37 Build 36 11 101,517,116 - 101,517,437 RGD NCBI36 Celera 11 99,173,460 - 99,173,781 RGD Cytogenetic Map 11 q13 UniSTS HuRef 11 97,938,313 - 97,938,634 UniSTS
RH123128
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 102,095,042 - 102,095,321 UniSTS GRCh37 Build 36 11 101,600,252 - 101,600,531 RGD NCBI36 Celera 11 99,256,589 - 99,256,868 RGD Cytogenetic Map 11 q13 UniSTS HuRef 11 98,021,367 - 98,021,646 UniSTS TNG Radiation Hybrid Map 11 47320.0 UniSTS
SHGC-32695
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 102,103,559 - 102,103,708 UniSTS GRCh37 GRCh37 6 147,731,865 - 147,732,016 UniSTS GRCh37 Build 36 6 147,773,558 - 147,773,709 RGD NCBI36 Celera 11 99,265,105 - 99,265,254 UniSTS Celera 6 148,472,309 - 148,472,460 RGD Cytogenetic Map 11 q13 UniSTS HuRef 11 98,029,881 - 98,030,030 UniSTS HuRef 6 145,295,485 - 145,295,636 UniSTS TNG Radiation Hybrid Map 6 72432.0 UniSTS
SHGC-110032
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 101,989,812 - 101,990,150 UniSTS GRCh37 Build 36 11 101,495,022 - 101,495,360 RGD NCBI36 Celera 11 99,151,367 - 99,151,705 RGD Cytogenetic Map 11 q13 UniSTS
HUM000S656
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 102,103,701 - 102,103,868 UniSTS GRCh37 Build 36 11 101,608,911 - 101,609,078 RGD NCBI36 Celera 11 99,265,247 - 99,265,414 RGD Cytogenetic Map 11 q13 UniSTS HuRef 11 98,030,023 - 98,030,190 UniSTS Stanford-G3 RH Map 11 4404.0 UniSTS NCBI RH Map 11 867.0 UniSTS GeneMap99-G3 RH Map 11 4404.0 UniSTS
D11S2249E
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 102,103,180 - 102,103,263 UniSTS GRCh37 Build 36 11 101,608,390 - 101,608,473 RGD NCBI36 Celera 11 99,264,726 - 99,264,809 RGD Cytogenetic Map 11 q13 UniSTS HuRef 11 98,029,502 - 98,029,585 UniSTS GeneMap99-GB4 RH Map 11 348.76 UniSTS
D11S1339
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 11 q13 UniSTS Marshfield Genetic Map 11 100.05 UniSTS Genethon Genetic Map 11 104.8 UniSTS deCODE Assembly Map 11 104.08 UniSTS GeneMap99-GB4 RH Map 11 348.86 UniSTS Whitehead-RH Map 11 459.6 UniSTS Whitehead-YAC Contig Map 11 UniSTS NCBI RH Map 11 885.6 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2438
2788
2250
4973
1725
2343
6
624
1555
465
2269
6914
6080
53
3734
1
852
1744
1608
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000282441 ⟹ ENSP00000282441
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 102,110,447 - 102,233,424 (+) Ensembl
Ensembl Acc Id:
ENST00000345877 ⟹ ENSP00000331023
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 102,110,461 - 102,233,423 (+) Ensembl
Ensembl Acc Id:
ENST00000524575 ⟹ ENSP00000435602
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 102,112,514 - 102,230,152 (+) Ensembl
Ensembl Acc Id:
ENST00000526343 ⟹ ENSP00000434134
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 102,110,461 - 102,230,592 (+) Ensembl
Ensembl Acc Id:
ENST00000526594
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 102,162,456 - 102,186,686 (+) Ensembl
Ensembl Acc Id:
ENST00000528834
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 102,226,973 - 102,230,502 (+) Ensembl
Ensembl Acc Id:
ENST00000529029 ⟹ ENSP00000431626
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 102,186,081 - 102,230,579 (+) Ensembl
Ensembl Acc Id:
ENST00000531439 ⟹ ENSP00000431574
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 102,110,849 - 102,229,963 (+) Ensembl
Ensembl Acc Id:
ENST00000537274 ⟹ ENSP00000445635
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 102,110,461 - 102,233,423 (+) Ensembl
Ensembl Acc Id:
ENST00000615667 ⟹ ENSP00000478927
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 102,110,461 - 102,233,423 (+) Ensembl
Ensembl Acc Id:
ENST00000629586 ⟹ ENSP00000487519
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 102,110,849 - 102,229,940 (+) Ensembl
RefSeq Acc Id:
NM_001130145 ⟹ NP_001123617
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,110,447 - 102,233,424 (+) NCBI GRCh37 11 101,981,151 - 102,104,154 (+) NCBI HuRef 11 97,907,865 - 98,030,476 (+) ENTREZGENE CHM1_1 11 101,864,181 - 101,987,123 (+) NCBI T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI
Sequence:
CTCAGTCGGGCGCAGCCGCCGCCAGGGAAAAGAAAGGGAGGAAGGAAGGAACAAGAAAAGGAAATAAAGAGAAAGGGGAGGCGGGGAAAGGCAACGAGCTGTCCGGCCTCCGTCAAGGGAGTTGGAGG
hide sequence
RefSeq Acc Id:
NM_001195044 ⟹ NP_001181973
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,110,447 - 102,233,424 (+) NCBI GRCh37 11 101,981,151 - 102,104,154 (+) NCBI HuRef 11 97,907,865 - 98,030,476 (+) ENTREZGENE CHM1_1 11 101,864,181 - 101,987,123 (+) NCBI T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI
Sequence:
CTCAGTCGGGCGCAGCCGCCGCCAGGGAAAAGAAAGGGAGGAAGGAAGGAACAAGAAAAGGAAA
hide sequence
RefSeq Acc Id:
NM_001195045 ⟹ NP_001181974
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,112,448 - 102,233,424 (+) NCBI GRCh37 11 101,981,151 - 102,104,154 (+) NCBI HuRef 11 97,907,865 - 98,030,476 (+) ENTREZGENE CHM1_1 11 101,866,159 - 101,987,123 (+) NCBI T2T-CHM13v2.0 11 102,114,538 - 102,235,509 (+) NCBI
Sequence:
AGAACTTGCTTCAGGCTAAACTTCAGCATAGGAACTTTGCCCAAAAGTTAATAGGTTTTCCAAA
hide sequence
RefSeq Acc Id:
NM_001282097 ⟹ NP_001269026
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,110,447 - 102,233,424 (+) NCBI HuRef 11 97,907,865 - 98,030,476 (+) NCBI CHM1_1 11 101,864,181 - 101,987,123 (+) NCBI T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI
Sequence:
CTCAGTCGGGCGCAGCCGCCGCCAGGGAAAAGAAAGGGAGGAAGGAAGGAACAAGAAAAGGAAA
hide sequence
RefSeq Acc Id:
NM_001282098 ⟹ NP_001269027
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,110,447 - 102,233,424 (+) NCBI HuRef 11 97,907,865 - 98,030,476 (+) NCBI CHM1_1 11 101,864,181 - 101,987,123 (+) NCBI T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI
Sequence:
CTCAGTCGGGCGCAGCCGCCGCCAGGGAAAAGAAAGGGAGGAAGGAAGGAACAAGAAAAGGAAATAAAGAGAAAGGGGAGGCGGGGAAAGGCAACGAGCTGTCCGGCCTCCGTCAAGGGAGTTGGAGG
hide sequence
RefSeq Acc Id:
NM_001282099 ⟹ NP_001269028
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,110,447 - 102,233,424 (+) NCBI HuRef 11 97,907,865 - 98,030,476 (+) NCBI CHM1_1 11 101,864,181 - 101,987,123 (+) NCBI T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI
Sequence:
CTCAGTCGGGCGCAGCCGCCGCCAGGGAAAAGAAAGGGAGGAAGGAAGGAACAAGAAAAGGAAA
hide sequence
RefSeq Acc Id:
NM_001282100 ⟹ NP_001269029
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,110,447 - 102,233,424 (+) NCBI HuRef 11 97,907,865 - 98,030,476 (+) NCBI CHM1_1 11 101,864,181 - 101,987,123 (+) NCBI T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI
Sequence:
CTCAGTCGGGCGCAGCCGCCGCCAGGGAAAAGAAAGGGAGGAAGGAAGGAACAAGAAAAGGAAATAAAGAGAAAGGGGAGGCGGGGAAAGGCAACGAGCTGTCCGGCCTCCGTCAAGGGAGTTGGAGG
hide sequence
RefSeq Acc Id:
NM_001282101 ⟹ NP_001269030
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,110,447 - 102,233,424 (+) NCBI HuRef 11 97,907,865 - 98,030,476 (+) NCBI CHM1_1 11 101,864,181 - 101,987,123 (+) NCBI T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI
Sequence:
CTCAGTCGGGCGCAGCCGCCGCCAGGGAAAAGAAAGGGAGGAAGGAAGGAACAAGAAAAGGAAATAAAGAGAAAGGGGAGGCGGGGAAAGGCAACGAGCTGTCCGGCCTCCGTCAAGGGAGTTGGAGG
hide sequence
RefSeq Acc Id:
NM_006106 ⟹ NP_006097
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,110,447 - 102,233,424 (+) NCBI GRCh37 11 101,981,151 - 102,104,154 (+) NCBI Build 36 11 101,486,541 - 101,609,359 (+) NCBI Archive HuRef 11 97,907,865 - 98,030,476 (+) ENTREZGENE CHM1_1 11 101,864,181 - 101,987,123 (+) NCBI T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI
Sequence:
CTCAGTCGGGCGCAGCCGCCGCCAGGGAAAAGAAAGGGAGGAAGGAAGGAACAAGAAAAGGAAA
hide sequence
RefSeq Acc Id:
XM_005271378 ⟹ XP_005271435
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,110,447 - 102,233,424 (+) NCBI GRCh37 11 101,981,151 - 102,104,154 (+) NCBI
Sequence:
AGGAGGAGGTGGGTTCGCACATCCTCTCTCCACTTCTTTCGGCCTTGGCCCTTTCGCAGGTCCA
hide sequence
RefSeq Acc Id:
XM_005271380 ⟹ XP_005271437
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,110,447 - 102,233,424 (+) NCBI GRCh37 11 101,981,151 - 102,104,154 (+) NCBI
Sequence:
AGGAGGAGGTGGGTTCGCACATCCTCTCTCCACTTCTTTCGGCCTTGGCCCTTTCGCAGGTCCAGGCGAACTGGAAGCGCCTTTCCCGAGCACGGGCGGGGAAAAGGGGCCGAGCGGAGCGGAAGAAC
hide sequence
RefSeq Acc Id:
XM_005271381 ⟹ XP_005271438
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,110,447 - 102,233,424 (+) NCBI GRCh37 11 101,981,151 - 102,104,154 (+) NCBI
Sequence:
AGGAGGAGGTGGGTTCGCACATCCTCTCTCCACTTCTTTCGGCCTTGGCCCTTTCGCAGGTCCA
hide sequence
RefSeq Acc Id:
XM_005271383 ⟹ XP_005271440
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,110,447 - 102,233,424 (+) NCBI GRCh37 11 101,981,151 - 102,104,154 (+) NCBI
Sequence:
AGGAGGAGGTGGGTTCGCACATCCTCTCTCCACTTCTTTCGGCCTTGGCCCTTTCGCAGGTCCAGGCGAACTGGAAGCGCCTTTCCCGAGCACGGGCGGGGAAAAGGGGCCGAGCGGAGCGGAAGAAC
hide sequence
RefSeq Acc Id:
XM_011542555 ⟹ XP_011540857
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 102,111,549 - 102,233,424 (+) NCBI
Sequence:
TTGAGAACTTGCTTCAGGCTAAACTTCAGCATAGGAACTTTGCCCAAAAGTTAATAGGTTTTCC
hide sequence
RefSeq Acc Id:
XM_054367453 ⟹ XP_054223428
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI
RefSeq Acc Id:
XM_054367454 ⟹ XP_054223429
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI
RefSeq Acc Id:
XM_054367455 ⟹ XP_054223430
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI
RefSeq Acc Id:
XM_054367456 ⟹ XP_054223431
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 102,112,538 - 102,235,509 (+) NCBI
RefSeq Acc Id:
XM_054367457 ⟹ XP_054223432
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 102,114,538 - 102,235,509 (+) NCBI
RefSeq Acc Id:
NP_001123617 ⟸ NM_001130145
- Peptide Label:
isoform 1
- UniProtKB:
Q7Z574 (UniProtKB/Swiss-Prot), K0L1G3 (UniProtKB/Swiss-Prot), K0L195 (UniProtKB/Swiss-Prot), K0KYZ8 (UniProtKB/Swiss-Prot), K0KQ18 (UniProtKB/Swiss-Prot), F5H202 (UniProtKB/Swiss-Prot), E9PRV2 (UniProtKB/Swiss-Prot), E3WEB6 (UniProtKB/Swiss-Prot), E3WEB5 (UniProtKB/Swiss-Prot), B7ZA01 (UniProtKB/Swiss-Prot), B4DTY1 (UniProtKB/Swiss-Prot), Q8IUY9 (UniProtKB/Swiss-Prot), P46937 (UniProtKB/Swiss-Prot)
- Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSS
hide sequence
RefSeq Acc Id:
NP_001181973 ⟸ NM_001195044
- Peptide Label:
isoform 3
- UniProtKB:
P46937 (UniProtKB/Swiss-Prot), Q86T74 (UniProtKB/TrEMBL)
- Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSS
hide sequence
RefSeq Acc Id:
NP_006097 ⟸ NM_006106
- Peptide Label:
isoform 2
- UniProtKB:
Q86T74 (UniProtKB/TrEMBL)
- Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSS
hide sequence
RefSeq Acc Id:
NP_001181974 ⟸ NM_001195045
- Peptide Label:
isoform 4
- UniProtKB:
Q86T74 (UniProtKB/TrEMBL)
- Sequence:
MAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQM
hide sequence
RefSeq Acc Id:
XP_005271435 ⟸ XM_005271378
- Peptide Label:
isoform X1
- Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSS
hide sequence
RefSeq Acc Id:
XP_005271438 ⟸ XM_005271381
- Peptide Label:
isoform X3
- Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSS
hide sequence
RefSeq Acc Id:
XP_005271437 ⟸ XM_005271380
- Peptide Label:
isoform X2
- Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSS
hide sequence
RefSeq Acc Id:
XP_005271440 ⟸ XM_005271383
- Peptide Label:
isoform X4
- Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSS
hide sequence
RefSeq Acc Id:
NP_001269030 ⟸ NM_001282101
- Peptide Label:
isoform 9
- UniProtKB:
P46937 (UniProtKB/Swiss-Prot), K0KVU2 (UniProtKB/TrEMBL), Q86T74 (UniProtKB/TrEMBL)
- Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSS
hide sequence
RefSeq Acc Id:
NP_001269029 ⟸ NM_001282100
- Peptide Label:
isoform 8
- UniProtKB:
P46937 (UniProtKB/Swiss-Prot), Q86T74 (UniProtKB/TrEMBL)
- Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSS
hide sequence
RefSeq Acc Id:
NP_001269028 ⟸ NM_001282099
- Peptide Label:
isoform 7
- UniProtKB:
P46937 (UniProtKB/Swiss-Prot), Q86T74 (UniProtKB/TrEMBL)
- Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSS
hide sequence
RefSeq Acc Id:
NP_001269027 ⟸ NM_001282098
- Peptide Label:
isoform 5
- Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSS
hide sequence
RefSeq Acc Id:
NP_001269026 ⟸ NM_001282097
- Peptide Label:
isoform 6
- UniProtKB:
P46937 (UniProtKB/Swiss-Prot), Q86T74 (UniProtKB/TrEMBL)
- Sequence:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSS
hide sequence
RefSeq Acc Id:
XP_011540857 ⟸ XM_011542555
- Peptide Label:
isoform X5
- UniProtKB:
Q86T74 (UniProtKB/TrEMBL)
- Sequence:
MAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFGKAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQ
hide sequence
Ensembl Acc Id:
ENSP00000331023 ⟸ ENST00000345877
Ensembl Acc Id:
ENSP00000431574 ⟸ ENST00000531439
Ensembl Acc Id:
ENSP00000282441 ⟸ ENST00000282441
Ensembl Acc Id:
ENSP00000487519 ⟸ ENST00000629586
Ensembl Acc Id:
ENSP00000478927 ⟸ ENST00000615667
Ensembl Acc Id:
ENSP00000445635 ⟸ ENST00000537274
Ensembl Acc Id:
ENSP00000435602 ⟸ ENST00000524575
Ensembl Acc Id:
ENSP00000434134 ⟸ ENST00000526343
Ensembl Acc Id:
ENSP00000431626 ⟸ ENST00000529029
RefSeq Acc Id:
XP_054223428 ⟸ XM_054367453
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_054223430 ⟸ XM_054367455
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_054223429 ⟸ XM_054367454
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_054223431 ⟸ XM_054367456
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_054223432 ⟸ XM_054367457
- Peptide Label:
isoform X5
- UniProtKB:
Q86T74 (UniProtKB/TrEMBL)
RGD ID: 6789585 Promoter ID: HG_KWN:14031 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell_12Hour, HeLa_S3 Transcripts: NM_001130145, NM_006106, UC001PGU.1, UC001PGV.1 Position: Human Assembly Chr Position (strand) Source Build 36 11 101,486,106 - 101,487,007 (+) MPROMDB
RGD ID: 6810207 Promoter ID: HG_ACW:13998 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: HeLa_S3 Transcripts: YAP1.EAPR07, YAP1.FAPR07 Position: Human Assembly Chr Position (strand) Source Build 36 11 101,487,606 - 101,488,106 (+) MPROMDB
RGD ID: 7221897 Promoter ID: EPDNEW_H16695 Type: initiation region Name: YAP1_1 Description: Yes associated protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H16696 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 11 102,110,450 - 102,110,510 EPDNEW
RGD ID: 7221903 Promoter ID: EPDNEW_H16696 Type: initiation region Name: YAP1_2 Description: Yes associated protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H16695 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 11 102,110,719 - 102,110,779 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-12-25
YAP1
Yes1 associated transcriptional regulator
YAP1
Yes associated protein 1
Symbol and/or name change
5135510 APPROVED
2015-11-24
YAP1
Yes associated protein 1
YAP1
Yes-associated protein 1
Symbol and/or name change
5135510 APPROVED
2011-07-27
YAP1
Yes-associated protein 1
YAP1
Yes-associated protein 1, 65kDa
Symbol and/or name change
5135510 APPROVED
