Advanced Search (OLGA)

Gene: NDUFAB1 (NADH:ubiquinone oxidoreductase subunit AB1) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

NDUFAB1

Name:

NADH:ubiquinone oxidoreductase subunit AB1

RGD ID:

1313754

HGNC Page

HGNC:7694

Description:

Enables mitochondrial large ribosomal subunit binding activity. Involved in [2Fe-2S] cluster assembly and protein lipoylation. Located in mitochondrial inner membrane and nucleoplasm. Part of mitochondrial [2Fe-2S] assembly complex and respiratory chain complex I.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ACP; ACP1; acyl carrier protein, mitochondrial; CI-SDAP; complex I SDAP subunit; FASN2A; MGC65095; mitochondrial acyl carrier protein; NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa; NADH-ubiquinone oxidoreductase 9.6 kDa subunit; NADH:ubiquinone oxidoreductase SDAP subunit; SDAP

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Related Pseudogenes:

NDUFAB1P1

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	23,581,014 - 23,596,316 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	23,581,014 - 23,596,316 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	23,592,335 - 23,607,637 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	23,499,836 - 23,515,140 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	23,499,837 - 23,515,140	NCBI
Celera	16	22,370,508 - 22,385,819 (-)	NCBI		Celera
Cytogenetic Map	16	p12.2	NCBI
HuRef	16	21,682,894 - 21,697,748 (-)	NCBI		HuRef
CHM1_1	16	24,603,886 - 24,619,351 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	23,856,813 - 23,872,135 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NDUFAB1	Human	Breast Cancer, Familial		IAGP	RGD:405876570	8554872	ClinVar Annotator: match by term: Familial cancer of breast	ClinVar	PMID:16793542\|PMID:17200668\|PMID:17200671\|PMID:24136930\|PMID:25099575\|PMID:28492532
NDUFAB1	Human	Breast Cancer, Familial		IAGP	RGD:156450524	8554872	ClinVar Annotator: match by term: Familial cancer of breast	ClinVar	PMID:17200668\|PMID:17200671\|PMID:19609323\|PMID:28492532
NDUFAB1	Human	congenital disorder of glycosylation type IIe		IAGP	RGD:156443382	8554872	ClinVar Annotator: match by term: COG7 congenital disorder of glycosylation	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NDUFAB1	Human	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1313755	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NDUFAB1 mRNA	CTD	PMID:36331819
NDUFAB1	Human	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1313755	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NDUFAB1 mRNA	CTD	PMID:22206623
NDUFAB1	Human	17alpha-ethynylestradiol	increases expression	ISO	RGD:1305619	6480464	Ethinyl Estradiol results in increased expression of NDUFAB1 mRNA	CTD	PMID:17108234
NDUFAB1	Human	17beta-estradiol	decreases expression	ISO	RGD:1313755	6480464	Estradiol results in decreased expression of NDUFAB1 mRNA	CTD	PMID:39298647
NDUFAB1	Human	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	RGD:1313755	6480464	2,2',4,4'-tetrabromodiphenyl ether affects the expression of NDUFAB1 mRNA	CTD	PMID:30294300
NDUFAB1	Human	2,2,2-tetramine	multiple interactions	ISO	RGD:1305619	6480464	Trientine inhibits the reaction [Streptozocin results in increased expression of NDUFAB1 protein]	CTD	PMID:19634143
NDUFAB1	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of NDUFAB1 mRNA	CTD	PMID:20106945\|PMID:21632981
NDUFAB1	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1305619	6480464	Tetrachlorodibenzodioxin results in increased expression of NDUFAB1 mRNA	CTD	PMID:33387578
NDUFAB1	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1305619	6480464	Tetrachlorodibenzodioxin results in decreased expression of NDUFAB1 mRNA	CTD	PMID:27913140\|PMID:32109520
NDUFAB1	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1313755	6480464	Tetrachlorodibenzodioxin affects the expression of NDUFAB1 mRNA	CTD	PMID:21570461
NDUFAB1	Human	2-hydroxypropanoic acid	decreases expression	EXP		6480464	Lactic Acid results in decreased expression of NDUFAB1 mRNA	CTD	PMID:30851411
NDUFAB1	Human	3H-1,2-dithiole-3-thione	increases expression	ISO	RGD:1305619	6480464	1,2-dithiol-3-thione results in increased expression of NDUFAB1 mRNA	CTD	PMID:19162173
NDUFAB1	Human	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1313755	6480464	bisphenol S results in increased expression of NDUFAB1 mRNA	CTD	PMID:39298647
NDUFAB1	Human	4,4'-sulfonyldiphenol	multiple interactions	ISO	RGD:1305619	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
NDUFAB1	Human	4,4'-sulfonyldiphenol	decreases methylation	EXP		6480464	bisphenol S results in decreased methylation of NDUFAB1 gene	CTD	PMID:31601247
NDUFAB1	Human	4-hydroxyphenyl retinamide	affects expression	EXP		6480464	Fenretinide affects the expression of NDUFAB1 mRNA	CTD	PMID:16570282
NDUFAB1	Human	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:1313755	6480464	Fenretinide results in decreased expression of NDUFAB1 mRNA	CTD	PMID:28973697
NDUFAB1	Human	5-fluorouracil	affects expression	EXP		6480464	Fluorouracil affects the expression of NDUFAB1 mRNA	CTD	PMID:34151400
NDUFAB1	Human	6-propyl-2-thiouracil	decreases expression	ISO	RGD:1305619	6480464	Propylthiouracil results in decreased expression of NDUFAB1 mRNA	CTD	PMID:30047161
NDUFAB1	Human	6-propyl-2-thiouracil	increases expression	ISO	RGD:1305619	6480464	Propylthiouracil results in increased expression of NDUFAB1 mRNA	CTD	PMID:30047161
NDUFAB1	Human	aconitine	increases expression	ISO	RGD:1305619	6480464	Aconitine results in increased expression of NDUFAB1 protein	CTD	PMID:33236894
NDUFAB1	Human	aflatoxin B1	increases expression	ISO	RGD:1313755	6480464	Aflatoxin B1 results in increased expression of NDUFAB1 mRNA	CTD	PMID:19770486
NDUFAB1	Human	amitrole	increases expression	ISO	RGD:1305619	6480464	Amitrole results in increased expression of NDUFAB1 mRNA	CTD	PMID:30047161
NDUFAB1	Human	amitrole	decreases expression	ISO	RGD:1305619	6480464	Amitrole results in decreased expression of NDUFAB1 mRNA	CTD	PMID:30047161
NDUFAB1	Human	ampicillin	multiple interactions	ISO	RGD:1305619	6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ...	CTD	PMID:30545405
NDUFAB1	Human	arsane	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
NDUFAB1	Human	arsenic atom	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
NDUFAB1	Human	arsenite(3-)	decreases expression	ISO	RGD:1313755	6480464	arsenite results in decreased expression of NDUFAB1 mRNA	CTD	PMID:33053406
NDUFAB1	Human	arsenite(3-)	multiple interactions	EXP		6480464	arsenite promotes the reaction [G3BP1 protein binds to NDUFAB1 mRNA]	CTD	PMID:32406909
NDUFAB1	Human	arsenous acid	increases expression	EXP		6480464	Arsenic Trioxide results in increased expression of NDUFAB1 mRNA	CTD	PMID:22521957\|PMID:29633893
NDUFAB1	Human	arsenous acid	decreases expression	ISO	RGD:1313755	6480464	Arsenic Trioxide results in decreased expression of NDUFAB1 mRNA	CTD	PMID:19422848
NDUFAB1	Human	atrazine	decreases expression	EXP		6480464	Atrazine results in decreased expression of NDUFAB1 mRNA	CTD	PMID:22378314
NDUFAB1	Human	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of NDUFAB1 mRNA	CTD	PMID:17879257
NDUFAB1	Human	benzo[a]pyrene	increases expression	ISO	RGD:1313755	6480464	Benzo(a)pyrene results in increased expression of NDUFAB1 mRNA	CTD	PMID:19770486\|PMID:22228805
NDUFAB1	Human	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1313755	6480464	Diethylhexyl Phthalate results in decreased expression of NDUFAB1 mRNA	CTD	PMID:35550907
NDUFAB1	Human	bisphenol A	affects expression	ISO	RGD:1305619	6480464	bisphenol A affects the expression of NDUFAB1 mRNA	CTD	PMID:25181051
NDUFAB1	Human	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of NDUFAB1 protein	CTD	PMID:37567409
NDUFAB1	Human	bisphenol A	multiple interactions	ISO	RGD:1305619	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
NDUFAB1	Human	bisphenol A	increases expression	ISO	RGD:1305619	6480464	bisphenol A results in increased expression of NDUFAB1 mRNA	CTD	PMID:34947998
NDUFAB1	Human	bisphenol A	decreases expression	ISO	RGD:1313755	6480464	bisphenol A results in decreased expression of NDUFAB1 mRNA; bisphenol A results in decreased expression more ...	CTD	PMID:37992956
NDUFAB1	Human	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of NDUFAB1 mRNA; bisphenol A results in decreased expression more ...	CTD	PMID:29275510\|PMID:37664457
NDUFAB1	Human	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of NDUFAB1 mRNA	CTD	PMID:30903817
NDUFAB1	Human	bisphenol AF	increases expression	EXP		6480464	bisphenol AF results in increased expression of NDUFAB1 protein	CTD	PMID:34186270
NDUFAB1	Human	bisphenol F	multiple interactions	ISO	RGD:1305619	6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
NDUFAB1	Human	carbon nanotube	decreases expression	ISO	RGD:1313755	6480464	Nanotubes, Carbon analog results in decreased expression of NDUFAB1 mRNA	CTD	PMID:25620056
NDUFAB1	Human	carbon nanotube	increases expression	ISO	RGD:1313755	6480464	Nanotubes, Carbon analog results in increased expression of NDUFAB1 mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681
NDUFAB1	Human	CGP 52608	multiple interactions	EXP		6480464	CGP 52608 promotes the reaction [RORA protein binds to NDUFAB1 gene]	CTD	PMID:28238834
NDUFAB1	Human	chloropicrin	increases expression	EXP		6480464	chloropicrin results in increased expression of NDUFAB1 mRNA	CTD	PMID:26352163
NDUFAB1	Human	chlorpyrifos	increases expression	ISO	RGD:1313755	6480464	Chlorpyrifos results in increased expression of NDUFAB1 mRNA	CTD	PMID:37019170
NDUFAB1	Human	clofibrate	multiple interactions	ISO	RGD:1313755	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of NDUFAB1 mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
NDUFAB1	Human	clofibrate	decreases expression	ISO	RGD:1313755	6480464	Clofibrate results in decreased expression of NDUFAB1 mRNA	CTD	PMID:17585979
NDUFAB1	Human	copper(II) sulfate	decreases expression	EXP		6480464	Copper Sulfate results in decreased expression of NDUFAB1 mRNA	CTD	PMID:19549813
NDUFAB1	Human	corosolic acid	decreases expression	EXP		6480464	corosolic acid results in decreased expression of NDUFAB1 mRNA	CTD	PMID:37939859
NDUFAB1	Human	cyclosporin A	increases expression	EXP		6480464	Cyclosporine results in increased expression of NDUFAB1 mRNA	CTD	PMID:27989131
NDUFAB1	Human	diarsenic trioxide	increases expression	EXP		6480464	Arsenic Trioxide results in increased expression of NDUFAB1 mRNA	CTD	PMID:22521957\|PMID:29633893
NDUFAB1	Human	diarsenic trioxide	decreases expression	ISO	RGD:1313755	6480464	Arsenic Trioxide results in decreased expression of NDUFAB1 mRNA	CTD	PMID:19422848
NDUFAB1	Human	Dibutyl phosphate	affects expression	EXP		6480464	di-n-butylphosphoric acid affects the expression of NDUFAB1 mRNA	CTD	PMID:37042841
NDUFAB1	Human	dibutyl phthalate	decreases expression	ISO	RGD:1313755	6480464	Dibutyl Phthalate results in decreased expression of NDUFAB1 mRNA	CTD	PMID:17361019\|PMID:21266533
NDUFAB1	Human	dioxygen	multiple interactions	ISO	RGD:1313755	6480464	Oxygen inhibits the reaction [Oxygen deficiency results in decreased expression of NDUFAB1 mRNA]	CTD	PMID:22629407
NDUFAB1	Human	dioxygen	decreases expression	ISO	RGD:1313755	6480464	Oxygen deficiency results in decreased expression of NDUFAB1 mRNA	CTD	PMID:22629407
NDUFAB1	Human	disodium selenite	increases expression	EXP		6480464	Sodium Selenite results in increased expression of NDUFAB1 mRNA	CTD	PMID:18175754
NDUFAB1	Human	doxorubicin	decreases expression	ISO	RGD:1313755	6480464	Doxorubicin results in decreased expression of NDUFAB1 mRNA	CTD	PMID:26873546
NDUFAB1	Human	doxorubicin	increases expression	EXP		6480464	Doxorubicin results in increased expression of NDUFAB1 mRNA	CTD	PMID:29803840
NDUFAB1	Human	ethanol	multiple interactions	ISO	RGD:1305619	6480464	[Fish Oils co-treated with Ethanol] results in increased expression of NDUFAB1 mRNA	CTD	PMID:17347304
NDUFAB1	Human	fenofibrate	increases expression	ISO	RGD:1313755	6480464	Fenofibrate results in increased expression of NDUFAB1 mRNA	CTD	PMID:11798191
NDUFAB1	Human	finasteride	increases expression	ISO	RGD:1305619	6480464	Finasteride results in increased expression of NDUFAB1 mRNA	CTD	PMID:24136188
NDUFAB1	Human	flutamide	decreases expression	ISO	RGD:1313755	6480464	Flutamide analog results in decreased expression of NDUFAB1 mRNA; Flutamide results in decreased expression of more ...	CTD	PMID:17702527
NDUFAB1	Human	flutamide	increases expression	ISO	RGD:1305619	6480464	Flutamide results in increased expression of NDUFAB1 mRNA	CTD	PMID:24136188
NDUFAB1	Human	flutamide	increases expression	ISO	RGD:1313755	6480464	Flutamide analog results in increased expression of NDUFAB1 mRNA; Flutamide results in increased expression of more ...	CTD	PMID:17702527
NDUFAB1	Human	folic acid	multiple interactions	ISO	RGD:1313755	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NDUFAB1 mRNA	CTD	PMID:22206623
NDUFAB1	Human	gentamycin	increases expression	ISO	RGD:1305619	6480464	Gentamicins results in increased expression of NDUFAB1 mRNA	CTD	PMID:22061828
NDUFAB1	Human	gentamycin	multiple interactions	ISO	RGD:1305619	6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ...	CTD	PMID:30545405
NDUFAB1	Human	hydrogen sulfide	decreases expression	ISO	RGD:1313755	6480464	Hydrogen Sulfide results in decreased expression of NDUFAB1 protein	CTD	PMID:29932956
NDUFAB1	Human	isoniazide	affects expression	ISO	RGD:1313755	6480464	Isoniazid affects the expression of NDUFAB1 mRNA	CTD	PMID:24848797
NDUFAB1	Human	ivermectin	decreases expression	EXP		6480464	Ivermectin results in decreased expression of NDUFAB1 protein	CTD	PMID:32959892
NDUFAB1	Human	lamivudine	multiple interactions	ISO	RGD:1313755	6480464	[Zidovudine co-treated with Lamivudine] results in increased expression of NDUFAB1 mRNA	CTD	PMID:18313992
NDUFAB1	Human	lead diacetate	decreases expression	ISO	RGD:1313755	6480464	lead acetate results in decreased expression of NDUFAB1 mRNA	CTD	PMID:21829687
NDUFAB1	Human	lipopolysaccharide	multiple interactions	EXP		6480464	[Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of NDUFAB1 mRNA	CTD	PMID:31059760
NDUFAB1	Human	manganese atom	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
NDUFAB1	Human	manganese(0)	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
NDUFAB1	Human	manganese(II) chloride	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
NDUFAB1	Human	methimazole	increases expression	ISO	RGD:1305619	6480464	Methimazole results in increased expression of NDUFAB1 mRNA	CTD	PMID:30047161
NDUFAB1	Human	methimazole	decreases expression	ISO	RGD:1305619	6480464	Methimazole results in decreased expression of NDUFAB1 mRNA	CTD	PMID:30047161
NDUFAB1	Human	metronidazole	multiple interactions	ISO	RGD:1305619	6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ...	CTD	PMID:30545405
NDUFAB1	Human	morphine	affects expression	ISO	RGD:1313755	6480464	Morphine affects the expression of NDUFAB1 mRNA	CTD	PMID:20144693
NDUFAB1	Human	nefazodone	increases expression	ISO	RGD:1305619	6480464	nefazodone results in increased expression of NDUFAB1 mRNA	CTD	PMID:24136188
NDUFAB1	Human	neomycin	multiple interactions	ISO	RGD:1305619	6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ...	CTD	PMID:30545405
NDUFAB1	Human	nimesulide	increases expression	ISO	RGD:1305619	6480464	nimesulide results in increased expression of NDUFAB1 mRNA	CTD	PMID:24136188
NDUFAB1	Human	oxybenzone	increases expression	ISO	RGD:1305619	6480464	oxybenzone results in increased expression of NDUFAB1 mRNA	CTD	PMID:30316929
NDUFAB1	Human	paracetamol	multiple interactions	ISO	RGD:1313755	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of NDUFAB1 mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
NDUFAB1	Human	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of NDUFAB1 mRNA	CTD	PMID:31059760
NDUFAB1	Human	paracetamol	multiple interactions	EXP		6480464	[Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of NDUFAB1 mRNA	CTD	PMID:31059760
NDUFAB1	Human	paracetamol	affects expression	ISO	RGD:1313755	6480464	Acetaminophen affects the expression of NDUFAB1 mRNA	CTD	PMID:17562736
NDUFAB1	Human	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1313755	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NDUFAB1 mRNA; PPARA protein more ...	CTD	PMID:20936131\|PMID:36331819
NDUFAB1	Human	perfluorooctane-1-sulfonic acid	increases expression	ISO	RGD:1313755	6480464	perfluorooctane sulfonic acid results in increased expression of NDUFAB1 mRNA	CTD	PMID:20936131
NDUFAB1	Human	perfluorooctanoic acid	decreases expression	EXP		6480464	perfluorooctanoic acid results in decreased expression of NDUFAB1 protein	CTD	PMID:26879310
NDUFAB1	Human	phlorizin	increases expression	ISO	RGD:1313755	6480464	Phlorhizin results in increased expression of NDUFAB1 mRNA	CTD	PMID:22538082
NDUFAB1	Human	pirinixic acid	increases expression	ISO	RGD:1313755	6480464	pirinixic acid results in increased expression of NDUFAB1 mRNA	CTD	PMID:11798191\|PMID:15375163\|PMID:18301758\|PMID:20813756\|PMID:23811191
NDUFAB1	Human	pirinixic acid	increases expression	ISO	RGD:1305619	6480464	pirinixic acid results in increased expression of NDUFAB1 mRNA	CTD	PMID:19162173
NDUFAB1	Human	rac-lactic acid	decreases expression	EXP		6480464	Lactic Acid results in decreased expression of NDUFAB1 mRNA	CTD	PMID:30851411
NDUFAB1	Human	rotenone	decreases expression	ISO	RGD:1313755	6480464	Rotenone results in decreased expression of NDUFAB1 mRNA	CTD	PMID:17702527
NDUFAB1	Human	rotenone	increases expression	ISO	RGD:1313755	6480464	Rotenone results in increased expression of NDUFAB1 mRNA	CTD	PMID:17702527
NDUFAB1	Human	SB 431542	multiple interactions	EXP		6480464	[LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of NDUFAB1 more ...	CTD	PMID:37664457
NDUFAB1	Human	silicon dioxide	decreases expression	ISO	RGD:1313755	6480464	Silicon Dioxide results in decreased expression of NDUFAB1 mRNA	CTD	PMID:19073995
NDUFAB1	Human	sodium arsenate	decreases expression	ISO	RGD:1313755	6480464	sodium arsenate results in decreased expression of NDUFAB1 mRNA	CTD	PMID:21795629
NDUFAB1	Human	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of NDUFAB1 mRNA	CTD	PMID:34032870
NDUFAB1	Human	sodium arsenite	multiple interactions	EXP		6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
NDUFAB1	Human	sodium fluoride	decreases expression	ISO	RGD:1313755	6480464	Sodium Fluoride results in decreased expression of NDUFAB1 mRNA	CTD	PMID:27862939
NDUFAB1	Human	streptozocin	increases expression	ISO	RGD:1305619	6480464	Streptozocin results in increased expression of NDUFAB1 protein	CTD	PMID:19634143
NDUFAB1	Human	streptozocin	multiple interactions	ISO	RGD:1305619	6480464	Trientine inhibits the reaction [Streptozocin results in increased expression of NDUFAB1 protein]	CTD	PMID:19634143
NDUFAB1	Human	succimer	multiple interactions	ISO	RGD:1313755	6480464	[Succimer binds to Magnetite Nanoparticles] which results in decreased expression of NDUFAB1 mRNA	CTD	PMID:21641980
NDUFAB1	Human	sulfadimethoxine	decreases expression	ISO	RGD:1305619	6480464	Sulfadimethoxine results in decreased expression of NDUFAB1 mRNA	CTD	PMID:30047161
NDUFAB1	Human	sulforaphane	increases expression	ISO	RGD:1313755	6480464	sulforaphane results in increased expression of NDUFAB1 mRNA	CTD	PMID:30529165
NDUFAB1	Human	tetrachloromethane	decreases expression	ISO	RGD:1313755	6480464	Carbon Tetrachloride results in decreased expression of NDUFAB1 mRNA	CTD	PMID:31919559
NDUFAB1	Human	thapsigargin	decreases expression	EXP		6480464	Thapsigargin results in decreased expression of NDUFAB1 mRNA	CTD	PMID:22378314
NDUFAB1	Human	toluene	affects expression	ISO	RGD:1305619	6480464	Toluene affects the expression of NDUFAB1 mRNA	CTD	PMID:21827849
NDUFAB1	Human	triadimefon	decreases expression	ISO	RGD:1305619	6480464	triadimefon results in decreased expression of NDUFAB1 mRNA	CTD	PMID:30047161
NDUFAB1	Human	trimellitic anhydride	increases expression	ISO	RGD:1313755	6480464	trimellitic anhydride results in increased expression of NDUFAB1 mRNA	CTD	PMID:19042947
NDUFAB1	Human	tungsten	increases expression	ISO	RGD:1313755	6480464	Tungsten results in increased expression of NDUFAB1 mRNA	CTD	PMID:30912803
NDUFAB1	Human	tunicamycin	decreases expression	EXP		6480464	Tunicamycin results in decreased expression of NDUFAB1 mRNA	CTD	PMID:22378314
NDUFAB1	Human	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of NDUFAB1 mRNA	CTD	PMID:25979313
NDUFAB1	Human	vancomycin	multiple interactions	ISO	RGD:1305619	6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ...	CTD	PMID:30545405
NDUFAB1	Human	zidovudine	increases expression	EXP		6480464	Zidovudine results in increased expression of NDUFAB1 mRNA	CTD	PMID:16894629
NDUFAB1	Human	zidovudine	multiple interactions	ISO	RGD:1313755	6480464	[Zidovudine co-treated with Lamivudine] results in increased expression of NDUFAB1 mRNA	CTD	PMID:18313992

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NDUFAB1	Human	[2Fe-2S] cluster assembly	involved_in	IDA		150520179	PMID:31664822, PMID:38627381	UniProt	PMID:31664822\|PMID:38627381
NDUFAB1	Human	aerobic respiration	involved_in	NAS		150520179	PMID:30030361	ComplexPortal	PMID:30030361
NDUFAB1	Human	fatty acid biosynthetic process	involved_in	IEA	InterPro:IPR003231	150520179		InterPro	GO_REF:0000002
NDUFAB1	Human	fatty acid biosynthetic process	involved_in	IEA	UniProtKB-KW:KW-0275	150520179		UniProt	GO_REF:0000043
NDUFAB1	Human	fatty acid biosynthetic process	involved_in	NAS		150520179	PMID:10234612	UniProt	PMID:10234612
NDUFAB1	Human	fatty acid metabolic process	involved_in	IEA	UniProtKB-KW:KW-0276	150520179		UniProt	GO_REF:0000043
NDUFAB1	Human	iron-sulfur cluster assembly	involved_in	NAS		150520179	PMID:29097656	ComplexPortal	PMID:29097656
NDUFAB1	Human	lipid metabolic process	involved_in	IEA	UniProtKB-KW:KW-0443	150520179		UniProt	GO_REF:0000043
NDUFAB1	Human	mitochondrial electron transport, NADH to ubiquinone	involved_in	NAS		150520179	PMID:9878551	UniProt	PMID:9878551
NDUFAB1	Human	protein lipoylation	involved_in	IMP		150520179	PMID:21846720	UniProt	PMID:21846720
NDUFAB1	Human	proton motive force-driven mitochondrial ATP synthesis	involved_in	NAS		150520179	PMID:30030361	ComplexPortal	PMID:30030361

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NDUFAB1	Human	iron-sulfur cluster assembly complex	part_of	NAS		150520179	PMID:29097656	ComplexPortal	PMID:29097656
NDUFAB1	Human	mitochondrial [2Fe-2S] assembly complex	part_of	IDA		150520179	PMID:31101807	FlyBase	PMID:31101807
NDUFAB1	Human	mitochondrial inner membrane	located_in	TAS		150520179		Reactome	Reactome:R-HSA-163217\|Reactome:R-HSA-6793590\|Reactome:R-HSA-6799178\|Reactome:R-HSA-6799179\|Reactome:R-HSA-6799191\|Reactome:R-HSA-6799196\|Reactome:R-HSA-6799197\|Reactome:R-HSA-6799202\|Reactome:R-HSA-8933547
NDUFAB1	Human	mitochondrial inner membrane	is_active_in	IEA	UniProtKB:Q9CR21\|ensembl:ENSMUSP00000033157	150520179		Ensembl	GO_REF:0000107
NDUFAB1	Human	mitochondrial inner membrane	located_in	IDA		150520179	PMID:28844695	ComplexPortal	PMID:28844695
NDUFAB1	Human	mitochondrial matrix	located_in	ISS	UniProtKB:P52505	150520179		UniProt	GO_REF:0000024
NDUFAB1	Human	mitochondrial membrane	located_in	NAS		150520179	PMID:10234612	UniProt	PMID:10234612
NDUFAB1	Human	mitochondrial membrane	located_in	ISS	UniProtKB:P52505	150520179		UniProt	GO_REF:0000024
NDUFAB1	Human	mitochondrion	located_in	NAS		150520179	PMID:27519411	ComplexPortal	PMID:27519411
NDUFAB1	Human	mitochondrion	is_active_in	IBA	MGI:1917566\|PANTHER:PTN000466616\|SGD:S000001675\|TAIR:locus:2042331\|TAIR:locus:2168968\|TAIR:locus:2206300\|UniProtKB:O14561\|UniProtKB:P52505\|UniProtKB:Q57WW9\|UniProtKB:Q8I0V5	150520179		GO_Central	GO_REF:0000033
NDUFAB1	Human	mitochondrion	located_in	IEA	ARBA:ARBA00026962	150520179		UniProt	GO_REF:0000117
NDUFAB1	Human	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	150520179		UniProt	GO_REF:0000043
NDUFAB1	Human	mitochondrion	located_in	IEA	UniProtKB-SubCell:SL-0173	150520179		UniProt	GO_REF:0000044
NDUFAB1	Human	mitochondrion	located_in	HTP		150520179	PMID:34800366	FlyBase	PMID:34800366
NDUFAB1	Human	mitochondrion	located_in	IDA		150520179		HPA	GO_REF:0000052
NDUFAB1	Human	nucleoplasm	located_in	IDA		150520179		HPA	GO_REF:0000052
NDUFAB1	Human	respiratory chain complex I	part_of	ISS	UniProtKB:P52505	150520179		UniProt	GO_REF:0000024
NDUFAB1	Human	respiratory chain complex I	part_of	IBA	FB:FBgn0011361\|MGI:1917566\|PANTHER:PTN001074652\|UniProtKB:O14561\|UniProtKB:P52505	150520179		GO_Central	GO_REF:0000033
NDUFAB1	Human	respiratory chain complex I	part_of	IEA	UniProtKB:Q9CR21\|ensembl:ENSMUSP00000033157	150520179		Ensembl	GO_REF:0000107
NDUFAB1	Human	respiratory chain complex I	part_of	IDA		150520179	PMID:12611891, PMID:27626371	UniProt	PMID:12611891\|PMID:27626371
NDUFAB1	Human	respiratory chain complex I	part_of	NAS		150520179	PMID:9878551	UniProt	PMID:9878551

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NDUFAB1	Human	acyl binding	enables	IBA	PANTHER:PTN000466551\|UniProtKB:P0A6A8\|UniProtKB:P9WQF3	150520179		GO_Central	GO_REF:0000033
NDUFAB1	Human	acyl carrier activity	enables	NAS		150520179	PMID:10234612	UniProt	PMID:10234612
NDUFAB1	Human	acyl carrier activity	enables	IBA	PANTHER:PTN000466551\|TAIR:locus:2042331\|TAIR:locus:2168968\|TAIR:locus:2206300\|UniProtKB:P0A6A8\|UniProtKB:P9WQF1\|UniProtKB:P9WQF3\|UniProtKB:Q57WW9	150520179		GO_Central	GO_REF:0000033
NDUFAB1	Human	calcium ion binding	enables	NAS		150520179	PMID:10234612	UniProt	PMID:10234612
NDUFAB1	Human	fatty acid binding	enables	ISS	UniProtKB:P52505	150520179		UniProt	GO_REF:0000024
NDUFAB1	Human	mitochondrial large ribosomal subunit binding	enables	IDA		150520179	PMID:28892042	UniProt	PMID:28892042
NDUFAB1	Human	protein binding	enables	IPI	UniProtKB:P02760-PRO_0000017886	150520179	PMID:23157686	UniProt	PMID:23157686
NDUFAB1	Human	protein binding	enables	IPI	UniProtKB:Q9HD34\|UniProtKB:Q9Y697	150520179	PMID:31664822	UniProt	PMID:31664822
NDUFAB1	Human	protein binding	enables	IPI	UniProtKB:L0R8F8	150520179	PMID:28892042, PMID:30215512	UniProt	PMID:28892042\|PMID:30215512
NDUFAB1	Human	protein binding	enables	IPI	UniProtKB:O43482\|UniProtKB:O43711\|UniProtKB:P17023\|UniProtKB:P17980\|UniProtKB:P25791-3\|UniProtKB:P26441\|UniProtKB:Q08043\|UniProtKB:Q08AM6\|UniProtKB:Q13643\|UniProtKB:Q16656-4\|UniProtKB:Q3KNS6-3\|UniProtKB:Q53EP0-3\|UniProtKB:Q5H9J7\|UniProtKB:Q6PF18\|UniProtKB:Q7L273\|UniProtKB:Q86UR1-2\|UniProtKB:Q86VK4-3\|UniProtKB:Q8N4L8\|UniProtKB:Q8TBB1\|UniProtKB:Q969H6\|UniProtKB:Q96HA8\|UniProtKB:Q96I34\|UniProtKB:Q96NM4-3\|UniProtKB:Q96PG8\|UniProtKB:Q9BQA5\|UniProtKB:Q9BSK4\|UniProtKB:Q9GZT3\|UniProtKB:Q9NVV9	150520179	PMID:32296183	IntAct	PMID:32296183
NDUFAB1	Human	protein binding	enables	IPI	UniProtKB:Q9GZT3	150520179	PMID:28892042	IntAct	PMID:28892042
NDUFAB1	Human	protein binding	enables	IPI	UniProtKB:Q6IPR1	150520179	PMID:27499296	UniProt	PMID:27499296
NDUFAB1	Human	structural molecule activity	enables	IDA		150520179	PMID:28634302	FlyBase	PMID:28634302

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NDUFAB1	Human	Alzheimer's disease pathway		IEA		6907045		KEGG	hsa:05010
NDUFAB1	Human	Huntington's disease pathway		IEA		6907045		KEGG	hsa:05016
NDUFAB1	Human	oxidative phosphorylation pathway		IEA		6907045		KEGG	hsa:00190
NDUFAB1	Human	Parkinson's disease pathway		IEA		6907045		KEGG	hsa:05012

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:1907568	PMID:9763677	PMID:9878551	PMID:10234612	PMID:10493829	PMID:12477932	PMID:12611891	PMID:12882974	PMID:15489334	PMID:17554300	PMID:17601350	PMID:18230186
PMID:18977241	PMID:19221180	PMID:19343046	PMID:20877624	PMID:21846720	PMID:21873635	PMID:21988832	PMID:23157686	PMID:24344204	PMID:25437307	PMID:26186194	PMID:26344197
PMID:27499296	PMID:27519411	PMID:27626371	PMID:28514442	PMID:28634302	PMID:28844695	PMID:28892042	PMID:29097656	PMID:29395067	PMID:29507755	PMID:29568061	PMID:29615496
PMID:29983374	PMID:30030361	PMID:30215512	PMID:31091453	PMID:31101807	PMID:31536960	PMID:31586073	PMID:31664822	PMID:31980649	PMID:32296183	PMID:32628020	PMID:32877691
PMID:33961781	PMID:34373451	PMID:34800366	PMID:35013218	PMID:35063084	PMID:35235311	PMID:35271311	PMID:35575683	PMID:35831314	PMID:37071682	PMID:37788672	PMID:38039071
PMID:38627381

NDUFAB1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	23,581,014 - 23,596,316 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	23,581,014 - 23,596,316 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	23,592,335 - 23,607,637 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	23,499,836 - 23,515,140 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	23,499,837 - 23,515,140	NCBI
Celera	16	22,370,508 - 22,385,819 (-)	NCBI		Celera
Cytogenetic Map	16	p12.2	NCBI
HuRef	16	21,682,894 - 21,697,748 (-)	NCBI		HuRef
CHM1_1	16	24,603,886 - 24,619,351 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	23,856,813 - 23,872,135 (-)	NCBI		T2T-CHM13v2.0

Ndufab1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	121,686,038 - 121,701,071 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	121,684,626 - 121,701,109 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	122,086,815 - 122,101,848 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	122,085,403 - 122,101,886 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	129,231,558 - 129,245,362 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	121,879,192 - 121,892,996 (-)	NCBI		MGSCv36	mm8
Celera	7	121,978,262 - 121,992,066 (-)	NCBI		Celera
Cytogenetic Map	7	F2	NCBI
cM Map	7	65.38	NCBI

Ndufab1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	186,075,933 - 186,091,843 (-)	NCBI		GRCr8
mRatBN7.2	1	176,644,696 - 176,658,131 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	176,644,703 - 176,658,099 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	184,972,598 - 184,985,999 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	192,158,550 - 192,171,951 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	184,842,359 - 184,855,803 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	192,044,209 - 192,057,644 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	192,044,216 - 192,057,612 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	199,106,654 - 199,120,089 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	180,908,331 - 180,921,734	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	174,354,467 - 174,367,869 (-)	NCBI		Celera
Cytogenetic Map	1	q36	NCBI

NDUFAB1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	24,992,700 - 25,008,605 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	29,512,277 - 29,527,729 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	14,513,734 - 14,529,087 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	23,833,485 - 23,849,085 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	23,833,485 - 23,849,085 (-)	Ensembl	panpan1.1		panPan2

NDUFAB1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	22,242,398 - 22,253,048 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	23,809,195 - 23,819,836 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	22,384,797 - 22,395,437 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	22,384,805 - 22,395,444 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	22,189,574 - 22,200,230 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	22,092,316 - 22,102,957 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	22,487,392 - 22,498,037 (+)	NCBI		UU_Cfam_GSD_1.0

Ndufab1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	120,135,060 - 120,142,818 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936501	8,232,140 - 8,240,739 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936501	8,232,920 - 8,240,675 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NDUFAB1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	22,619,492 - 22,635,288 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	22,619,458 - 22,631,575 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	50,608 - 62,608 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NDUFAB1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	21,306,014 - 21,317,721 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666068	8,480,979 - 8,493,485 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ndufab1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624782	8,740,125 - 8,749,473 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624782	8,739,614 - 8,748,968 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in NDUFAB1
14 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 16p13.11-12.1(chr16:14954894-28306843)x3	copy number gain	See cases [RCV000051828]	Chr16:14954894..28306843 [GRCh38] Chr16:15048751..28318164 [GRCh37] Chr16:14956252..28225665 [NCBI36] Chr16:16p13.11-12.1	pathogenic
GRCh38/hg38 16p12.2-11.2(chr16:21463739-29249579)x3	copy number gain	See cases [RCV000051829]	Chr16:21463739..29249579 [GRCh38] Chr16:21475060..29260900 [GRCh37] Chr16:21382561..29168401 [NCBI36] Chr16:16p12.2-11.2	pathogenic
GRCh38/hg38 16p12.2-11.2(chr16:21602183-29314373)x3	copy number gain	See cases [RCV000051842]	Chr16:21602183..29314373 [GRCh38] Chr16:21613504..29325694 [GRCh37] Chr16:21521005..29233195 [NCBI36] Chr16:16p12.2-11.2	pathogenic
GRCh38/hg38 16p12.2-11.2(chr16:23047969-30632245)x3	copy number gain	See cases [RCV000052401]	Chr16:23047969..30632245 [GRCh38] Chr16:23059290..30643566 [GRCh37] Chr16:22966791..30551067 [NCBI36] Chr16:16p12.2-11.2	pathogenic
GRCh38/hg38 16p12.2-12.1(chr16:21600992-28323344)x1	copy number loss	See cases [RCV000052519]	Chr16:21600992..28323344 [GRCh38] Chr16:21612313..28334665 [GRCh37] Chr16:21519814..28242166 [NCBI36] Chr16:16p12.2-12.1	pathogenic
GRCh38/hg38 16p13.3-11.2(chr16:4644892-29170820)x3	copy number gain	See cases [RCV000133809]	Chr16:4644892..29170820 [GRCh38] Chr16:4694893..29182141 [GRCh37] Chr16:4634894..29089642 [NCBI36] Chr16:16p13.3-11.2	pathogenic
GRCh38/hg38 16p12.2-11.2(chr16:22634385-29227323)x3	copy number gain	See cases [RCV000135594]	Chr16:22634385..29227323 [GRCh38] Chr16:22645706..29238644 [GRCh37] Chr16:22553207..29146145 [NCBI36] Chr16:16p12.2-11.2	likely pathogenic
GRCh38/hg38 16p12.2-11.2(chr16:21350622-29202837)x3	copy number gain	See cases [RCV000140235]	Chr16:21350622..29202837 [GRCh38] Chr16:21361943..29214158 [GRCh37] Chr16:21269444..29121659 [NCBI36] Chr16:16p12.2-11.2	likely pathogenic
GRCh37/hg19 16p13.3-11.2(chr16:102839-28327676)x3	copy number gain	See cases [RCV000203445]	Chr16:102839..28327676 [GRCh37] Chr16:16p13.3-11.2	pathogenic
GRCh37/hg19 16p12.3-11.2(chr16:19590412-29814175)x3	copy number gain	Breast ductal adenocarcinoma [RCV000207226]	Chr16:19590412..29814175 [GRCh37] Chr16:16p12.3-11.2	uncertain significance
GRCh37/hg19 16p13.3-11.2(chr16:1279324-31926800)x3	copy number gain	Breast ductal adenocarcinoma [RCV000207053]	Chr16:1279324..31926800 [GRCh37] Chr16:16p13.3-11.2	uncertain significance
GRCh37/hg19 16p12.2-11.2(chr16:21475039-29043958)x1	copy number loss	Chromosome 16p12.2-p11.2 deletion syndrome [RCV003315282]	Chr16:21475039..29043958 [GRCh37] Chr16:16p12.2-11.2	pathogenic
GRCh37/hg19 16p12.3-11.2(chr16:19424115-30142220)x3	copy number gain	See cases [RCV000449403]	Chr16:19424115..30142220 [GRCh37] Chr16:16p12.3-11.2	pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:69193-90274381)x3	copy number gain	See cases [RCV000446684]	Chr16:69193..90274381 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p12.2(chr16:23567993-23666408)x1	copy number loss	See cases [RCV000447156]	Chr16:23567993..23666408 [GRCh37] Chr16:16p12.2	uncertain significance
GRCh37/hg19 16p13.2-q24.3(chr16:9273328-89548493)x3	copy number gain	See cases [RCV000511622]	Chr16:9273328..89548493 [GRCh37] Chr16:16p13.2-q24.3	uncertain significance
GRCh37/hg19 16p12.2-11.2(chr16:22718350-28858721)x4	copy number gain	See cases [RCV000511587]	Chr16:22718350..28858721 [GRCh37] Chr16:16p12.2-11.2	pathogenic
GRCh37/hg19 16p12.2-11.2(chr16:21596299-30399167)x1	copy number loss	See cases [RCV000511271]	Chr16:21596299..30399167 [GRCh37] Chr16:16p12.2-11.2	pathogenic
maternal UPD(16p)	complex	Hemimegalencephaly [RCV000494707]	Chr16:1280042..33710558 [GRCh37] Chr16:16p13.3-11.2	pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:85881-90155062)	copy number gain	See cases [RCV000511296]	Chr16:85881..90155062 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:85881-90155062)x3	copy number gain	See cases [RCV000512138]	Chr16:85881..90155062 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p12.3-11.2(chr16:18238275-30177240)x3	copy number gain	See cases [RCV000512428]	Chr16:18238275..30177240 [GRCh37] Chr16:16p12.3-11.2	pathogenic
GRCh37/hg19 16p12.2-11.2(chr16:21379628-29351826)x3	copy number gain	See cases [RCV000512478]	Chr16:21379628..29351826 [GRCh37] Chr16:16p12.2-11.2	pathogenic
GRCh37/hg19 16p12.2-11.2(chr16:21379628-29379768)x1	copy number loss	not provided [RCV000683786]	Chr16:21379628..29379768 [GRCh37] Chr16:16p12.2-11.2	pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:88165-90274695)x3	copy number gain	not provided [RCV000738918]	Chr16:88165..90274695 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:61451-90294632)x3	copy number gain	not provided [RCV000738915]	Chr16:61451..90294632 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
GRCh37/hg19 16p13.3-q24.3(chr16:88165-90163275)x3	copy number gain	not provided [RCV000738917]	Chr16:88165..90163275 [GRCh37] Chr16:16p13.3-q24.3	pathogenic
NM_005003.3(NDUFAB1):c.40C>T (p.Pro14Ser)	single nucleotide variant	not provided [RCV000895425]	Chr16:23596251 [GRCh38] Chr16:23607572 [GRCh37] Chr16:16p12.2	benign
NC_000016.9:g.21530207_29332245del	deletion	not provided [RCV001030428]	Chr16:21530207..29332245 [GRCh37] Chr16:16p12.2-11.2	pathogenic
NM_005003.3(NDUFAB1):c.442A>G (p.Ile148Val)	single nucleotide variant	not specified [RCV004306891]	Chr16:23582313 [GRCh38] Chr16:23593634 [GRCh37] Chr16:16p12.2	uncertain significance
GRCh37/hg19 16p12.2-11.2(chr16:21312200-29646379)x3	copy number gain	not provided [RCV001249228]	Chr16:21312200..29646379 [GRCh37] Chr16:16p12.2-11.2	not provided
NM_005003.3(NDUFAB1):c.225G>A (p.Thr75=)	single nucleotide variant	not provided [RCV000891160]	Chr16:23587263 [GRCh38] Chr16:23598584 [GRCh37] Chr16:16p12.2	benign
GRCh37/hg19 16p13.3-11.2(chr16:4380767-30445350)x3	copy number gain	not provided [RCV002472599]	Chr16:4380767..30445350 [GRCh37] Chr16:16p13.3-11.2	pathogenic
GRCh37/hg19 16p12.2-11.2(chr16:21576802-29351826)x3	copy number gain	not provided [RCV001006786]	Chr16:21576802..29351826 [GRCh37] Chr16:16p12.2-11.2	pathogenic
GRCh37/hg19 16p13.3-11.2(chr16:5805001-34230001)	copy number gain	Microcephaly [RCV001252948]	Chr16:5805001..34230001 [GRCh37] Chr16:16p13.3-11.2	pathogenic
GRCh37/hg19 16p13.3-11.2(chr16:2959279-30190593)x3	copy number gain	See cases [RCV001263169]	Chr16:2959279..30190593 [GRCh37] Chr16:16p13.3-11.2	pathogenic\|likely pathogenic
GRCh37/hg19 16p12.2-11.2(chr16:21594997-29625302)x1	copy number loss	not provided [RCV001795549]	Chr16:21594997..29625302 [GRCh37] Chr16:16p12.2-11.2	pathogenic
NC_000016.9:g.(?_23464127)_(23635435_?)del	deletion	not provided [RCV001951393]	Chr16:23464127..23635435 [GRCh37] Chr16:16p12.2	pathogenic
NC_000016.9:g.(?_23193865)_(23652612_?)del	deletion	COG7 congenital disorder of glycosylation [RCV003113761]	Chr16:23193865..23652612 [GRCh37] Chr16:16p12.2	uncertain significance
NC_000016.9:g.(?_23543958)_(23619353_?)del	deletion	not provided [RCV003122502]	Chr16:23543958..23619353 [GRCh37] Chr16:16p12.2	pathogenic
NC_000016.9:g.(?_23584033)_(23647150_?)del	deletion	Familial cancer of breast [RCV003122698]	Chr16:23584033..23647150 [GRCh37] Chr16:16p12.2	pathogenic
GRCh37/hg19 16p12.2-11.2(chr16:21576803-30177240)x3	copy number gain	not provided [RCV002474541]	Chr16:21576803..30177240 [GRCh37] Chr16:16p12.2-11.2	pathogenic
NM_005003.3(NDUFAB1):c.196C>T (p.Arg66Cys)	single nucleotide variant	not specified [RCV004205713]	Chr16:23587292 [GRCh38] Chr16:23598613 [GRCh37] Chr16:16p12.2	uncertain significance
NM_005003.3(NDUFAB1):c.91C>A (p.Pro31Thr)	single nucleotide variant	not specified [RCV004234171]	Chr16:23596200 [GRCh38] Chr16:23607521 [GRCh37] Chr16:16p12.2	uncertain significance
NM_005003.3(NDUFAB1):c.289A>G (p.Lys97Glu)	single nucleotide variant	not specified [RCV004167207]	Chr16:23587199 [GRCh38] Chr16:23598520 [GRCh37] Chr16:16p12.2	uncertain significance
NM_005003.3(NDUFAB1):c.16C>T (p.Leu6Phe)	single nucleotide variant	not specified [RCV004231805]	Chr16:23596275 [GRCh38] Chr16:23607596 [GRCh37] Chr16:16p12.2	uncertain significance
NM_005003.3(NDUFAB1):c.106C>G (p.Leu36Val)	single nucleotide variant	not specified [RCV004072731]	Chr16:23596185 [GRCh38] Chr16:23607506 [GRCh37] Chr16:16p12.2	uncertain significance
NM_005003.3(NDUFAB1):c.245G>A (p.Arg82His)	single nucleotide variant	not specified [RCV004350579]	Chr16:23587243 [GRCh38] Chr16:23598564 [GRCh37] Chr16:16p12.2	uncertain significance
NM_005003.3(NDUFAB1):c.37C>G (p.Leu13Val)	single nucleotide variant	not specified [RCV004484662]	Chr16:23596254 [GRCh38] Chr16:23607575 [GRCh37] Chr16:16p12.2	uncertain significance
NM_005003.3(NDUFAB1):c.65G>T (p.Arg22Leu)	single nucleotide variant	not specified [RCV004484668]	Chr16:23596226 [GRCh38] Chr16:23607547 [GRCh37] Chr16:16p12.2	uncertain significance
NM_005003.3(NDUFAB1):c.99C>A (p.Ser33Arg)	single nucleotide variant	not specified [RCV004484676]	Chr16:23596192 [GRCh38] Chr16:23607513 [GRCh37] Chr16:16p12.2	uncertain significance
NC_000016.9:g.(?_23605874)_(23640542_?)del	deletion	Familial cancer of breast [RCV004581596]	Chr16:23605874..23640542 [GRCh37] Chr16:16p12.2	pathogenic
GRCh37/hg19 16p12.2(chr16:22920852-24124026)x3	copy number gain	not provided [RCV004819623]	Chr16:22920852..24124026 [GRCh37] Chr16:16p12.2	uncertain significance
NM_005003.3(NDUFAB1):c.411G>C (p.Lys137Asn)	single nucleotide variant	not specified [RCV004829534]	Chr16:23582344 [GRCh38] Chr16:23593665 [GRCh37] Chr16:16p12.2	uncertain significance
NM_005003.3(NDUFAB1):c.419G>A (p.Cys140Tyr)	single nucleotide variant	not specified [RCV004829533]	Chr16:23582336 [GRCh38] Chr16:23593657 [GRCh37] Chr16:16p12.2	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	676
Count of miRNA genes:	391
Interacting mature miRNAs:	422
Transcripts:	ENST00000007516, ENST00000484769, ENST00000562133, ENST00000567761, ENST00000570319
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

RH64954

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	16	23,595,893 - 23,596,051	UniSTS	GRCh37
Build 36	16	23,503,394 - 23,503,552	RGD	NCBI36
Celera	16	22,374,066 - 22,374,224	RGD
Cytogenetic Map	16	p12.2	UniSTS
HuRef	16	21,686,480 - 21,686,638	UniSTS

RH93191

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	16	23,592,386 - 23,592,507	UniSTS	GRCh37
Build 36	16	23,499,887 - 23,500,008	RGD	NCBI36
Celera	16	22,370,559 - 22,370,680	RGD
Cytogenetic Map	16	p12.2	UniSTS
HuRef	16	21,682,945 - 21,683,066	UniSTS
GeneMap99-GB4 RH Map	16	194.86	UniSTS

SHGC-32823

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	16	23,592,382 - 23,592,483	UniSTS	GRCh37
Build 36	16	23,499,883 - 23,499,984	RGD	NCBI36
Celera	16	22,370,555 - 22,370,656	RGD
Cytogenetic Map	16	p12.2	UniSTS
HuRef	16	21,682,941 - 21,683,042	UniSTS
TNG Radiation Hybrid Map	16	13683.0	UniSTS
Stanford-G3 RH Map	16	1264.0	UniSTS
GeneMap99-G3 RH Map	16	1224.0	UniSTS

G20300

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	16	23,595,961 - 23,596,087	UniSTS	GRCh37
Build 36	16	23,503,462 - 23,503,588	RGD	NCBI36
Celera	16	22,374,134 - 22,374,260	RGD
Cytogenetic Map	16	p12.2	UniSTS
HuRef	16	21,686,548 - 21,686,674	UniSTS

A005L06

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	16	23,595,961 - 23,596,087	UniSTS	GRCh37
Build 36	16	23,503,462 - 23,503,588	RGD	NCBI36
Celera	16	22,374,134 - 22,374,260	RGD
Cytogenetic Map	16	p12.2	UniSTS
HuRef	16	21,686,548 - 21,686,674	UniSTS
GeneMap99-GB4 RH Map	16	197.65	UniSTS
NCBI RH Map	16	229.3	UniSTS

SGC33525

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	16	23,595,824 - 23,595,949	UniSTS	GRCh37
Build 36	16	23,503,325 - 23,503,450	RGD	NCBI36
Celera	16	22,373,997 - 22,374,122	RGD
Cytogenetic Map	16	p12.2	UniSTS
HuRef	16	21,686,411 - 21,686,536	UniSTS
GeneMap99-GB4 RH Map	16	193.96	UniSTS
Whitehead-RH Map	16	113.5	UniSTS
NCBI RH Map	16	230.2	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2439	2788	2253	4974	1726	2351	6	624	1951	465	2270	7306	6472	53	3734	1	852	1744	1617	175	1


RefSeq Transcripts	NM_005003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_011545856	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054380402	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC002400	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC008870	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF087660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK311877	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC058920	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BI603093	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068262	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF036489	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF036490	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000007516 ⟹ ENSP00000007516

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	16	23,581,014 - 23,596,316 (-)	Ensembl

Ensembl Acc Id:

ENST00000484769 ⟹ ENSP00000454812

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	16	23,581,033 - 23,596,303 (-)	Ensembl

Ensembl Acc Id:

ENST00000562133 ⟹ ENSP00000454891

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	16	23,581,014 - 23,596,277 (-)	Ensembl

Ensembl Acc Id:

ENST00000567761 ⟹ ENSP00000461693

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	16	23,582,335 - 23,591,153 (-)	Ensembl

Ensembl Acc Id:

ENST00000570319 ⟹ ENSP00000458770

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	16	23,581,871 - 23,596,291 (-)	Ensembl

RefSeq Acc Id:

NM_005003 ⟹ NP_004994

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	23,581,014 - 23,596,316 (-)	NCBI
GRCh37	16	23,592,335 - 23,607,639 (-)	RGD
Build 36	16	23,499,836 - 23,515,140 (-)	NCBI Archive
Celera	16	22,370,508 - 22,385,819 (-)	RGD
HuRef	16	21,682,894 - 21,697,748 (-)	RGD
CHM1_1	16	24,603,886 - 24,619,351 (-)	NCBI
T2T-CHM13v2.0	16	23,856,813 - 23,872,125 (-)	NCBI

Sequence:

show sequence

GCAGTGCATCCTGGGTTGGCGTAGCCATGGCGTCTCGTGTCCTTTCAGCCTATGTCAGCCGCCTGCCCGCGGCCTTTGCGCCGCTGCCCCGGGTCCGGATGCTGGCCGTGGCCCGGCCTCTCAGCACC
GCTCTCTGCTCCGCGGGGACCCAGACGAGGCTCGGGACTTTGCAGCCGGCCTTAGTGCTCGCGCAGGTTCCTGGTAGAGTTACACAGTTGTGCCGCCAGTATAGCGACATGCCTCCTTTGACGTTAGA
GGGCATCCAGGACCGTGTTCTTTACGTATTGAAACTCTATGACAAGATTGACCCAGAGAAGCTTTCAGTAAATTCTCATTTTATGAAAGACCTGGGCTTAGACAGTTTGGACCAAGTGGAGATTATCA
TGGCCATGGAAGACGAATTTGGGTTTGAAATTCCTGATATAGATGCTGAAAAGTTAATGTGTCCACAAGAAATTGTAGATTACATTGCAGATAAGAAGGATGTATATGAATAAAGTATCAGACCCTTT
GGCTTTGCTGAGAGAGGACTCAGATGATAGTGACGAATGTCTGGCAGTGAGGACACATTTTGGCATTCTTGCTGACTCTGACAGAGTGATTCTGATGGACTTGTATTTAAATTGTATGTGTTTTACTC
TTTGAAAATAAATCTATAAAACCAA

hide sequence

RefSeq Acc Id:

XM_011545856 ⟹ XP_011544158

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	23,581,014 - 23,596,316 (-)	NCBI

Sequence:

show sequence

CGGAGGCGGCGGCGCAGTGCATCCTGGGTTGGCGTAGCCATGGCGTCTCGTGTCCTTTCAGCCT
ATGTCAGCCGCCTGCCCGCGGCCTTTGCGCCGCTGCCCCGGGTCCGGATGCTGGCCGTGGCCCGGCCTCTCAGCACCGCTCTCTGCTCCGCGGGGACCCAGACGAGGCTCGGGACTTTGCAGCCGGCC
TTAGTGCTCGCGCAGGTGACTCGTGGTGACTTTGCTGCCGCTTGGCAAGGAGATCCAGTTAGAAGGAGCAGCAAGACCTTCCAGGAGGCCATGCTGGAAGGACATGGGGTTCCTGGTAGAGTTACACA
GTTGTGCCGCCAGTATAGCGACATGCCTCCTTTGACGTTAGAGGGCATCCAGGACCGTGTTCTTTACGTATTGAAACTCTATGACAAGATTGACCCAGAGAAGCTTTCAGTAAATTCTCATTTTATGA
AAGACCTGGGCTTAGACAGTTTGGACCAAGTGGAGATTATCATGGCCATGGAAGACGAATTTGGGTTTGAAATTCCTGATATAGATGCTGAAAAGTTAATGTGTCCACAAGAAATTGTAGATTACATT
GCAGATAAGAAGGATGTATATGAATAAAGTATCAGACCCTTTGGCTTTGCTGAGAGAGGACTCAGATGATAGTGACGAATGTCTGGCAGTGAGGACACATTTTGGCATTCTTGCTGACTCTGACAGAG
TGATTCTGATGGACTTGTATTTAAATTGTATGTGTTTTACTCTTTGAAAATAAATCTATAAAACCAACA

hide sequence

RefSeq Acc Id:

XM_054380402 ⟹ XP_054236377

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	16	23,856,813 - 23,872,135 (-)	NCBI


Protein RefSeqs	NP_004994	(Get FASTA)	NCBI Sequence Viewer
	XP_011544158	(Get FASTA)	NCBI Sequence Viewer
	XP_054236377	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC05814	(Get FASTA)	NCBI Sequence Viewer
	AAD23566	(Get FASTA)	NCBI Sequence Viewer
	AAH58920	(Get FASTA)	NCBI Sequence Viewer
	ABO65075	(Get FASTA)	NCBI Sequence Viewer
	ABO65076	(Get FASTA)	NCBI Sequence Viewer
	BAG34818	(Get FASTA)	NCBI Sequence Viewer
	EAW55815	(Get FASTA)	NCBI Sequence Viewer
	EAW55816	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000007516
	ENSP00000007516.2
	ENSP00000458770.1
GenBank Protein	O14561	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_004994 ⟸ NM_005003
- Peptide Label:	precursor
- UniProtKB:	B2R4M1 (UniProtKB/Swiss-Prot), Q9UNV1 (UniProtKB/Swiss-Prot), O14561 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGF EIPDIDAEKLMCPQEIVDYIADKKDVYE hide sequence

RefSeq Acc Id:	XP_011544158 ⟸ XM_011545856
- Peptide Label:	isoform X1
- Sequence:	show sequence MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVTRGDFAA AWQGDPVRRSSKTFQEAMLEGHGVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE hide sequence

Ensembl Acc Id:

ENSP00000458770 ⟸ ENST00000570319

Ensembl Acc Id:

ENSP00000007516 ⟸ ENST00000007516

Ensembl Acc Id:

ENSP00000454891 ⟸ ENST00000562133

Protein Domains

Carrier

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O14561-F1-model_v2	AlphaFold	O14561	1-156	view protein structure

RGD ID:

6793310

Promoter ID:

HG_KWN:23311

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4

Transcripts:

OTTHUMT00000214058, OTTHUMT00000214059

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	16	23,514,856 - 23,515,356 (-)	MPROMDB

RGD ID:

6851504

Promoter ID:

EP73553

Type:

single initiation site

Name:

HS_NDUFAB1

Description:

NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1,8kDa.

SO ACC ID:

SO:0000170

Source:

EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

NEDO full length human cDNA sequencing project.; Oligo-capping

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	16	23,515,136 - 23,515,196	EPD

RGD ID:

7231609

Promoter ID:

EPDNEW_H21549

Type:

initiation region

Name:

NDUFAB1_1

Description:

NADH:ubiquinone oxidoreductase subunit AB1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	16	23,596,316 - 23,596,376	EPDNEW

Database	Acc Id	Source(s)
COSMIC	NDUFAB1	COSMIC
Ensembl Genes	ENSG00000004779	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000007516	ENTREZGENE
	ENST00000007516.8	UniProtKB/Swiss-Prot
	ENST00000570319.5	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.1200.10	UniProtKB/Swiss-Prot
GTEx	ENSG00000004779	GTEx
HGNC ID	HGNC:7694	ENTREZGENE
Human Proteome Map	NDUFAB1	Human Proteome Map
InterPro	ACP-like_sf	UniProtKB/Swiss-Prot
	Acyl_carrier	UniProtKB/Swiss-Prot
	PP-bd_ACP	UniProtKB/Swiss-Prot
	Ppantetheine_attach_site	UniProtKB/Swiss-Prot
KEGG Report	hsa:4706	UniProtKB/Swiss-Prot
NCBI Gene	4706	ENTREZGENE
OMIM	603836	OMIM
PANTHER	ACYL CARRIER PROTEIN, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	PTHR20863	UniProtKB/Swiss-Prot
Pfam	PP-binding	UniProtKB/Swiss-Prot
PharmGKB	PA31500	PharmGKB
PROSITE	CARRIER	UniProtKB/Swiss-Prot
	PHOSPHOPANTETHEINE	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47336	UniProtKB/Swiss-Prot
UniProt	ACPM_HUMAN	UniProtKB/Swiss-Prot
	B2R4M1	ENTREZGENE
	H3BNE8_HUMAN	UniProtKB/TrEMBL
	H3BNK3_HUMAN	UniProtKB/TrEMBL
	I3L505_HUMAN	UniProtKB/TrEMBL
	O14561	ENTREZGENE
	Q9UNV1	ENTREZGENE
UniProt Secondary	B2R4M1	UniProtKB/Swiss-Prot
	Q9UNV1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-24	NDUFAB1	NADH:ubiquinone oxidoreductase subunit AB1		NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)