Symbol:
Olfml1
Name:
olfactomedin-like 1
RGD ID:
1311854
Description:
Predicted to be involved in signal transduction. Predicted to be active in extracellular space. Orthologous to human OLFML1 (olfactomedin like 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC361621; olfactomedin-like protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 170,889,912 - 170,914,300 (+) NCBI GRCr8 mRatBN7.2 1 161,478,129 - 161,502,541 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 161,478,242 - 161,502,537 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 169,747,308 - 169,771,491 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 176,933,303 - 176,957,486 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 169,618,081 - 169,642,351 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 171,793,782 - 171,818,074 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 171,793,782 - 171,818,068 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 178,792,340 - 178,816,636 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 164,953,064 - 164,977,360 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 165,048,540 - 165,072,958 (+) NCBI Celera 1 159,382,450 - 159,406,508 (+) NCBI Celera Cytogenetic Map 1 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Olfml1 Rat 17beta-estradiol multiple interactions ISO OLFML1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of OLFML1 mRNA CTD PMID:20660070 Olfml1 Rat 17beta-estradiol decreases expression ISO Olfml1 (Mus musculus) 6480464 Estradiol results in decreased expression of OLFML1 mRNA CTD PMID:39298647 Olfml1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Olfml1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of OLFML1 mRNA CTD PMID:19770486 Olfml1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of OLFML1 mRNA CTD PMID:34747641 Olfml1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Olfml1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of OLFML1 mRNA CTD PMID:21570461 Olfml1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Olfml1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of OLFML1 mRNA CTD PMID:28522335 Olfml1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO OLFML1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of OLFML1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of OLFML1 mRNA CTD PMID:28628672 Olfml1 Rat 4,4'-sulfonyldiphenol increases expression ISO Olfml1 (Mus musculus) 6480464 bisphenol S results in increased expression of OLFML1 mRNA CTD PMID:30951980 Olfml1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Olfml1 (Mus musculus) 6480464 Fenretinide results in decreased expression of OLFML1 mRNA CTD PMID:28973697 Olfml1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of OLFML1 mRNA CTD PMID:24780913 Olfml1 Rat aflatoxin B1 decreases expression ISO Olfml1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of OLFML1 mRNA CTD PMID:19770486 Olfml1 Rat aflatoxin B1 increases methylation ISO OLFML1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of OLFML1 gene CTD PMID:27153756 Olfml1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of OLFML1 mRNA CTD PMID:23630614 Olfml1 Rat aldehydo-D-glucose multiple interactions ISO Olfml1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of OLFML1 mRNA CTD PMID:37567420 Olfml1 Rat arsane affects methylation ISO OLFML1 (Homo sapiens) 6480464 Arsenic affects the methylation of OLFML1 gene CTD PMID:25304211 Olfml1 Rat arsenic atom affects methylation ISO OLFML1 (Homo sapiens) 6480464 Arsenic affects the methylation of OLFML1 gene CTD PMID:25304211 Olfml1 Rat benzene-1,2,4-triol decreases expression ISO OLFML1 (Homo sapiens) 6480464 hydroxyhydroquinone results in decreased expression of OLFML1 mRNA CTD PMID:39245080 Olfml1 Rat benzo[a]pyrene increases mutagenesis ISO OLFML1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of OLFML1 gene CTD PMID:25435355 Olfml1 Rat benzo[a]pyrene affects methylation ISO OLFML1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of OLFML1 5' UTR and Benzo(a)pyrene affects the methylation of OLFML1 promoter CTD PMID:27901495 Olfml1 Rat benzo[a]pyrene decreases expression ISO OLFML1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of OLFML1 mRNA CTD PMID:21632981 Olfml1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of OLFML1 mRNA CTD PMID:18164116 Olfml1 Rat bis(2-ethylhexyl) phthalate increases expression ISO OLFML1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of OLFML1 mRNA CTD PMID:31163220 Olfml1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Olfml1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of OLFML1 mRNA CTD PMID:34319233 Olfml1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of OLFML1 mRNA CTD PMID:25181051 Olfml1 Rat bisphenol A increases expression ISO Olfml1 (Mus musculus) 6480464 bisphenol A results in increased expression of OLFML1 mRNA CTD PMID:30951980 Olfml1 Rat bisphenol A multiple interactions ISO OLFML1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of OLFML1 mRNA CTD PMID:28628672 Olfml1 Rat bisphenol F multiple interactions ISO OLFML1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of OLFML1 mRNA CTD PMID:28628672 Olfml1 Rat bisphenol F increases expression ISO Olfml1 (Mus musculus) 6480464 bisphenol F results in increased expression of OLFML1 mRNA CTD PMID:30951980 Olfml1 Rat calcitriol decreases expression ISO OLFML1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of OLFML1 mRNA CTD PMID:26485663 Olfml1 Rat carbon nanotube decreases expression ISO Olfml1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Olfml1 Rat cyclosporin A decreases expression ISO Olfml1 (Mus musculus) 6480464 Cyclosporine results in decreased expression of OLFML1 mRNA CTD PMID:19770486 Olfml1 Rat cyclosporin A decreases expression ISO OLFML1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of OLFML1 mRNA CTD PMID:25562108 Olfml1 Rat D-glucose multiple interactions ISO Olfml1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of OLFML1 mRNA CTD PMID:37567420 Olfml1 Rat dexamethasone multiple interactions ISO OLFML1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of OLFML1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of OLFML1 mRNA CTD PMID:28628672 Olfml1 Rat dibenz[a,h]anthracene increases expression ISO Olfml1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Olfml1 Rat dichloroacetic acid decreases expression ISO Olfml1 (Mus musculus) 6480464 Dichloroacetic Acid results in decreased expression of OLFML1 mRNA CTD PMID:28962523 Olfml1 Rat dioxygen multiple interactions ISO Olfml1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of OLFML1 mRNA CTD PMID:30529165 Olfml1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of OLFML1 mRNA CTD PMID:25152437 Olfml1 Rat dorsomorphin multiple interactions ISO OLFML1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Olfml1 Rat doxorubicin decreases expression ISO OLFML1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of OLFML1 mRNA CTD PMID:29803840 Olfml1 Rat entinostat increases expression ISO OLFML1 (Homo sapiens) 6480464 entinostat results in increased expression of OLFML1 mRNA CTD PMID:27188386 Olfml1 Rat ethanol increases expression ISO Olfml1 (Mus musculus) 6480464 Ethanol results in increased expression of OLFML1 mRNA CTD PMID:30319688 Olfml1 Rat folic acid decreases expression ISO OLFML1 (Homo sapiens) 6480464 Folic Acid results in decreased expression of OLFML1 mRNA CTD PMID:21867686 Olfml1 Rat fonofos increases methylation ISO OLFML1 (Homo sapiens) 6480464 Fonofos results in increased methylation of OLFML1 promoter CTD PMID:22847954 Olfml1 Rat fructose multiple interactions ISO Olfml1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of OLFML1 mRNA CTD PMID:37567420 Olfml1 Rat furan decreases expression ISO Olfml1 (Mus musculus) 6480464 furan results in decreased expression of OLFML1 mRNA CTD PMID:24183702 Olfml1 Rat furan increases expression EXP 6480464 furan results in increased expression of OLFML1 mRNA CTD PMID:27387713 Olfml1 Rat glucose multiple interactions ISO Olfml1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of OLFML1 mRNA CTD PMID:37567420 Olfml1 Rat GW 4064 increases expression ISO Olfml1 (Mus musculus) 6480464 GW 4064 results in increased expression of OLFML1 mRNA CTD PMID:26655953 Olfml1 Rat hydroquinone O-beta-D-glucopyranoside decreases expression ISO OLFML1 (Homo sapiens) 6480464 Arbutin results in decreased expression of OLFML1 mRNA CTD PMID:17103032 Olfml1 Rat indometacin multiple interactions ISO OLFML1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of OLFML1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of OLFML1 mRNA CTD PMID:28628672 Olfml1 Rat inulin multiple interactions ISO Olfml1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of OLFML1 mRNA CTD PMID:36331819 Olfml1 Rat kojic acid decreases expression ISO OLFML1 (Homo sapiens) 6480464 kojic acid results in decreased expression of OLFML1 mRNA CTD PMID:16595896 Olfml1 Rat mercury dibromide increases expression ISO OLFML1 (Homo sapiens) 6480464 mercuric bromide results in increased expression of OLFML1 mRNA CTD PMID:26272509 Olfml1 Rat mercury dibromide multiple interactions ISO OLFML1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of OLFML1 mRNA CTD PMID:27188386 Olfml1 Rat mercury dichloride decreases expression EXP 6480464 Mercuric Chloride results in decreased expression of OLFML1 mRNA CTD PMID:16507785 Olfml1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of OLFML1 mRNA CTD PMID:18164116 Olfml1 Rat nickel atom decreases expression ISO OLFML1 (Homo sapiens) 6480464 Nickel results in decreased expression of OLFML1 mRNA CTD PMID:25583101 Olfml1 Rat ozone multiple interactions ISO Olfml1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of OLFML1 mRNA CTD PMID:34911549 Olfml1 Rat parathion increases methylation ISO OLFML1 (Homo sapiens) 6480464 Parathion results in increased methylation of OLFML1 promoter CTD PMID:22847954 Olfml1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Olfml1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of OLFML1 mRNA CTD PMID:36331819 Olfml1 Rat phenobarbital increases expression ISO Olfml1 (Mus musculus) 6480464 Phenobarbital results in increased expression of OLFML1 mRNA CTD PMID:19270015 Olfml1 Rat phenylmercury acetate increases expression ISO OLFML1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of OLFML1 mRNA CTD PMID:26272509 Olfml1 Rat phenylmercury acetate multiple interactions ISO OLFML1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of OLFML1 mRNA CTD PMID:27188386 Olfml1 Rat pioglitazone multiple interactions ISO Olfml1 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of OLFML1 mRNA CTD PMID:27935865 Olfml1 Rat pirinixic acid multiple interactions ISO Olfml1 (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in decreased expression of OLFML1 mRNA CTD PMID:20813756 Olfml1 Rat pirinixic acid decreases expression ISO Olfml1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of OLFML1 mRNA CTD PMID:20813756 and PMID:23811191 Olfml1 Rat progesterone multiple interactions ISO OLFML1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of OLFML1 mRNA CTD PMID:20660070 Olfml1 Rat propiconazole decreases expression ISO Olfml1 (Mus musculus) 6480464 propiconazole results in decreased expression of OLFML1 mRNA CTD PMID:21278054 Olfml1 Rat quercetin decreases expression ISO OLFML1 (Homo sapiens) 6480464 Quercetin results in decreased expression of OLFML1 mRNA CTD PMID:21632981 Olfml1 Rat SB 431542 multiple interactions ISO OLFML1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Olfml1 Rat silicon dioxide increases expression ISO OLFML1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of OLFML1 mRNA CTD PMID:25895662 Olfml1 Rat silicon dioxide decreases expression ISO Olfml1 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of OLFML1 mRNA CTD PMID:23221170 Olfml1 Rat sodium arsenite decreases expression ISO Olfml1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of OLFML1 mRNA CTD PMID:37682722 Olfml1 Rat sulforaphane decreases expression ISO OLFML1 (Homo sapiens) 6480464 sulforaphane results in decreased expression of OLFML1 mRNA CTD PMID:31838189 Olfml1 Rat terbufos increases methylation ISO OLFML1 (Homo sapiens) 6480464 terbufos results in increased methylation of OLFML1 promoter CTD PMID:22847954 Olfml1 Rat tetrachloromethane affects expression ISO Olfml1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of OLFML1 mRNA CTD PMID:17484886 Olfml1 Rat tetrachloromethane decreases expression ISO Olfml1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of OLFML1 mRNA CTD PMID:27339419 and PMID:31919559 Olfml1 Rat Triptolide decreases expression ISO Olfml1 (Mus musculus) 6480464 triptolide results in decreased expression of OLFML1 mRNA CTD PMID:32835833 Olfml1 Rat valproic acid affects expression ISO OLFML1 (Homo sapiens) 6480464 Valproic Acid affects the expression of OLFML1 mRNA CTD PMID:25979313 Olfml1 Rat valproic acid increases expression ISO OLFML1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of OLFML1 mRNA CTD PMID:23179753 and PMID:26272509 Olfml1 Rat valproic acid multiple interactions ISO OLFML1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of OLFML1 mRNA CTD PMID:27188386 Olfml1 Rat XL147 multiple interactions ISO Olfml1 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with XL147] results in decreased expression of OLFML1 mRNA CTD PMID:27935865
17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (EXP,ISO) aldehydo-D-glucose (ISO) arsane (ISO) arsenic atom (ISO) benzene-1,2,4-triol (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) calcitriol (ISO) carbon nanotube (ISO) cyclosporin A (ISO) D-glucose (ISO) dexamethasone (ISO) dibenz[a,h]anthracene (ISO) dichloroacetic acid (ISO) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) folic acid (ISO) fonofos (ISO) fructose (ISO) furan (EXP,ISO) glucose (ISO) GW 4064 (ISO) hydroquinone O-beta-D-glucopyranoside (ISO) indometacin (ISO) inulin (ISO) kojic acid (ISO) mercury dibromide (ISO) mercury dichloride (EXP) N-nitrosodiethylamine (EXP) nickel atom (ISO) ozone (ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pioglitazone (ISO) pirinixic acid (ISO) progesterone (ISO) propiconazole (ISO) quercetin (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulforaphane (ISO) terbufos (ISO) tetrachloromethane (ISO) Triptolide (ISO) valproic acid (ISO) XL147 (ISO)
Olfml1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 170,889,912 - 170,914,300 (+) NCBI GRCr8 mRatBN7.2 1 161,478,129 - 161,502,541 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 161,478,242 - 161,502,537 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 169,747,308 - 169,771,491 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 176,933,303 - 176,957,486 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 169,618,081 - 169,642,351 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 171,793,782 - 171,818,074 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 171,793,782 - 171,818,068 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 178,792,340 - 178,816,636 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 164,953,064 - 164,977,360 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 165,048,540 - 165,072,958 (+) NCBI Celera 1 159,382,450 - 159,406,508 (+) NCBI Celera Cytogenetic Map 1 q33 NCBI
OLFML1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 7,485,506 - 7,511,377 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 7,485,388 - 7,511,377 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 7,506,737 - 7,532,608 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 7,463,331 - 7,489,140 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 7,463,573 - 7,489,137 NCBI Celera 11 7,625,730 - 7,651,738 (+) NCBI Celera Cytogenetic Map 11 p15.4 NCBI HuRef 11 7,165,129 - 7,191,140 (+) NCBI HuRef CHM1_1 11 7,505,519 - 7,531,529 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 7,543,862 - 7,569,737 (+) NCBI T2T-CHM13v2.0
Olfml1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 107,166,640 - 107,190,572 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 107,166,653 - 107,190,301 (+) Ensembl GRCm39 Ensembl GRCm38 7 107,567,433 - 107,591,365 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 107,567,446 - 107,591,094 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 114,710,947 - 114,734,879 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 107,358,623 - 107,382,271 (+) NCBI MGSCv36 mm8 Celera 7 107,543,398 - 107,567,221 (+) NCBI Celera Cytogenetic Map 7 E3 NCBI cM Map 7 57.21 NCBI
Olfml1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 23,240,205 - 23,269,620 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 23,240,469 - 23,267,380 (+) NCBI ChiLan1.0 ChiLan1.0
OLFML1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 9,880,047 - 9,912,924 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 9,843,463 - 9,876,040 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 7,580,561 - 7,606,630 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 7,261,192 - 7,288,514 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 7,261,192 - 7,288,508 (+) Ensembl panpan1.1 panPan2
OLFML1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 31,136,218 - 31,162,405 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 30,986,521 - 31,162,414 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 30,706,146 - 30,732,298 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 32,001,461 - 32,027,657 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 31,737,706 - 32,027,664 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 31,273,734 - 31,299,861 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 31,436,581 - 31,462,743 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 31,732,238 - 31,758,591 (+) NCBI UU_Cfam_GSD_1.0
Olfml1
OLFML1
OLFML1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 57,327,951 - 57,354,150 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 57,329,146 - 57,353,471 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 155,059,123 - 155,085,516 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Olfml1
.
Predicted Target Of
Count of predictions: 517 Count of miRNA genes: 245 Interacting mature miRNAs: 302 Transcripts: ENSRNOT00000050951 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 631206 Niddm40 Non-insulin dependent diabetes mellitus QTL 40 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 136745990 163747690 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634315 Niddm45 Non-insulin dependent diabetes mellitus QTL 45 7.16 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 144267916 172949660 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 61379 Bp44 Blood pressure QTL 44 19.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144267916 174133260 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1582204 Livw1 Liver weight QTL 1 3.6 0.0003 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 1 155422851 172949803 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8693608 Alc24 Alcohol consumption QTL 24 2.3 0.74 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 150452391 168228760 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 631548 Bp88 Blood pressure QTL 88 5 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 156677124 176484451 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
BB056894
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 161,502,331 - 161,502,456 (+) MAPPER mRatBN7.2 Rnor_6.0 1 171,817,865 - 171,817,989 NCBI Rnor6.0 Rnor_5.0 1 178,816,427 - 178,816,551 UniSTS Rnor5.0 RGSC_v3.4 1 164,977,151 - 164,977,275 UniSTS RGSC3.4 Celera 1 159,406,299 - 159,406,423 UniSTS Cytogenetic Map 1 q33 UniSTS
AA892509
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 161,501,050 - 161,501,226 (+) MAPPER mRatBN7.2 Rnor_6.0 1 171,816,584 - 171,816,759 NCBI Rnor6.0 Rnor_5.0 1 178,815,146 - 178,815,321 UniSTS Rnor5.0 RGSC_v3.4 1 164,975,870 - 164,976,045 UniSTS RGSC3.4 Celera 1 159,405,018 - 159,405,193 UniSTS RH 3.4 Map 1 1387.2 UniSTS Cytogenetic Map 1 q33 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000081351 ⟹ ENSRNOP00000073433
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 161,478,242 - 161,502,537 (+) Ensembl Rnor_6.0 Ensembl 1 171,793,782 - 171,818,068 (+) Ensembl
RefSeq Acc Id:
NM_001013192 ⟹ NP_001013210
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 170,890,010 - 170,914,300 (+) NCBI mRatBN7.2 1 161,478,246 - 161,502,541 (+) NCBI Rnor_6.0 1 171,793,782 - 171,818,074 (+) NCBI Rnor_5.0 1 178,792,340 - 178,816,636 (+) NCBI RGSC_v3.4 1 164,953,064 - 164,977,360 (+) RGD Celera 1 159,382,450 - 159,406,508 (+) RGD
Sequence:
GTAGCCACTAGCCTGAGAGGGTCTGTGCATGTCCAAGCTGAGGGCAGCAGATGCTGGACCTCGGGAGCCCTCTGCACCAAGTGAACAAGGCAGGCCTGCAGAGACCAGCTTGCCAACAGCTGGACTTG
hide sequence
RefSeq Acc Id:
XM_039082556 ⟹ XP_038938484
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 170,889,912 - 170,902,284 (+) NCBI mRatBN7.2 1 161,478,129 - 161,491,107 (+) NCBI
RefSeq Acc Id:
NP_001013210 ⟸ NM_001013192
- Peptide Label:
precursor
- UniProtKB:
Q66H86 (UniProtKB/Swiss-Prot), A6I7R9 (UniProtKB/TrEMBL)
- Sequence:
MMVALPGASASLVLFLAAFLPPLQHAQDPAMVHYIYQRFQVLEQGLEKCAQTTRAYIQDFQEFSKNLSTMLGRCQTHTNEYRSAVDNLALRVERAQREIDYLQYLRESDFCVESEEKTSAEKVLQEAE
hide sequence
Ensembl Acc Id:
ENSRNOP00000073433 ⟸ ENSRNOT00000081351
RefSeq Acc Id:
XP_038938484 ⟸ XM_039082556
- Peptide Label:
isoform X1
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Olfml1
olfactomedin-like 1
Olfml1_predicted
olfactomedin-like 1 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Olfml1_predicted
olfactomedin-like 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
