Symbol:
Klhl25
Name:
kelch-like family member 25
RGD ID:
1310815
Description:
Predicted to enable ubiquitin-like ligase-substrate adaptor activity. Predicted to be involved in several processes, including positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation; regulation of fatty acid metabolic process; and ubiquitin-dependent protein catabolic process. Predicted to be located in cytoplasm. Predicted to be part of Cul3-RING ubiquitin ligase complex. Orthologous to human KLHL25 (kelch like family member 25); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; acrylamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ectoderm-neural cortex protein 2; ENC-2; kelch-like 25; kelch-like 25 (Drosophila); kelch-like protein 25; LOC293023; MGC116251; RGD1310815; similar to hypothetical protein FLJ12587
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KLHL25 (kelch like family member 25) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Klhl25 (kelch-like 25) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Klhl25 (kelch like family member 25) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KLHL25 (kelch like family member 25) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KLHL25 (kelch like family member 25) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Klhl25 (kelch like family member 25) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KLHL25 (kelch like family member 25) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KLHL25 (kelch like family member 25) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Klhl25 (kelch like family member 25) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
METTL22 (methyltransferase 22, Kin17 lysine) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Klhl25 (kelch-like 25)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
KLHL25 (kelch like family member 25)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
enc2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
klhl25
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 139,134,655 - 139,159,898 (+) NCBI GRCr8 mRatBN7.2 1 129,724,894 - 129,750,142 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 129,722,026 - 129,750,227 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 137,630,051 - 137,655,206 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 144,800,323 - 144,825,478 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 137,689,819 - 137,714,976 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 137,333,880 - 137,359,107 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 137,333,881 - 137,359,072 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 138,322,710 - 138,355,032 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 131,540,949 - 131,566,141 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 131,636,985 - 131,638,938 (+) NCBI Celera 1 121,829,642 - 121,854,834 (+) NCBI Celera Cytogenetic Map 1 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Klhl25 Rat 1,2-dichloroethane decreases expression ISO RGD:1321935 6480464 ethylene dichloride results in decreased expression of KLHL25 mRNA CTD PMID:28960355 Klhl25 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1321935 6480464 Tetrachlorodibenzodioxin results in decreased expression of KLHL25 mRNA CTD PMID:19770486 Klhl25 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1321935 6480464 Tetrachlorodibenzodioxin affects the expression of KLHL25 mRNA CTD PMID:21570461|PMID:24680724 Klhl25 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of KLHL25 mRNA CTD PMID:22298810 Klhl25 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of KLHL25 mRNA CTD PMID:21346803 Klhl25 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1321935 6480464 bisphenol S results in increased expression of KLHL25 mRNA CTD PMID:39298647 Klhl25 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of KLHL25 mRNA CTD PMID:28959563 Klhl25 Rat acrylamide increases expression ISO RGD:1605054 6480464 Acrylamide results in increased expression of KLHL25 mRNA CTD PMID:32763439 Klhl25 Rat aflatoxin B1 increases methylation ISO RGD:1605054 6480464 Aflatoxin B1 results in increased methylation of KLHL25 gene CTD PMID:27153756 Klhl25 Rat aflatoxin B1 affects methylation ISO RGD:1605054 6480464 Aflatoxin B1 affects the methylation of KLHL25 intron CTD PMID:30157460 Klhl25 Rat aristolochic acid A increases expression ISO RGD:1605054 6480464 aristolochic acid I results in increased expression of KLHL25 mRNA CTD PMID:33212167 Klhl25 Rat atrazine increases expression ISO RGD:1605054 6480464 Atrazine results in increased expression of KLHL25 mRNA CTD PMID:22378314 Klhl25 Rat benzo[a]pyrene decreases expression ISO RGD:1321935 6480464 Benzo(a)pyrene results in decreased expression of KLHL25 mRNA CTD PMID:19770486 Klhl25 Rat benzo[a]pyrene increases methylation ISO RGD:1605054 6480464 Benzo(a)pyrene results in increased methylation of KLHL25 5' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Klhl25 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KLHL25 mRNA CTD PMID:25181051|PMID:30816183|PMID:32528016|PMID:38750585 Klhl25 Rat bisphenol A decreases methylation ISO RGD:1605054 6480464 bisphenol A results in decreased methylation of KLHL25 gene CTD PMID:31601247 Klhl25 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of KLHL25 mRNA CTD PMID:34947998 Klhl25 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of KLHL25 mRNA CTD PMID:19167457 Klhl25 Rat cadmium dichloride decreases expression ISO RGD:1605054 6480464 Cadmium Chloride results in decreased expression of KLHL25 mRNA CTD PMID:38568856 Klhl25 Rat carbon nanotube increases expression ISO RGD:1321935 6480464 Nanotubes, Carbon analog results in increased expression of KLHL25 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681|PMID:25620056 Klhl25 Rat cefaloridine decreases expression EXP 6480464 Cephaloridine results in decreased expression of KLHL25 mRNA CTD PMID:18500788 Klhl25 Rat CGP 52608 multiple interactions ISO RGD:1605054 6480464 CGP 52608 promotes the reaction [RORA protein binds to KLHL25 gene] CTD PMID:28238834 Klhl25 Rat chlordecone decreases expression ISO RGD:1321935 6480464 Chlordecone results in decreased expression of KLHL25 mRNA CTD PMID:29980752 Klhl25 Rat cisplatin increases expression ISO RGD:1605054 6480464 Cisplatin results in increased expression of KLHL25 mRNA CTD PMID:27594783 Klhl25 Rat Dibutyl phosphate affects expression ISO RGD:1605054 6480464 di-n-butylphosphoric acid affects the expression of KLHL25 mRNA CTD PMID:37042841 Klhl25 Rat dibutyl phthalate decreases expression ISO RGD:1321935 6480464 Dibutyl Phthalate results in decreased expression of KLHL25 mRNA CTD PMID:21266533 Klhl25 Rat ethanol increases expression ISO RGD:1321935 6480464 Ethanol results in increased expression of KLHL25 mRNA CTD PMID:19167417 Klhl25 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of KLHL25 mRNA CTD PMID:24136188 Klhl25 Rat furan increases expression ISO RGD:1321935 6480464 furan results in increased expression of KLHL25 mRNA CTD PMID:24183702 Klhl25 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of KLHL25 mRNA CTD PMID:33387578 Klhl25 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of KLHL25 mRNA CTD PMID:24136188 Klhl25 Rat Licochalcone B increases expression ISO RGD:1605054 6480464 licochalcone B results in increased expression of KLHL25 mRNA CTD PMID:33647349 Klhl25 Rat okadaic acid increases expression ISO RGD:1605054 6480464 Okadaic Acid results in increased expression of KLHL25 mRNA CTD PMID:38832940 Klhl25 Rat paracetamol affects expression ISO RGD:1321935 6480464 Acetaminophen affects the expression of KLHL25 mRNA CTD PMID:17562736 Klhl25 Rat paracetamol increases expression ISO RGD:1605054 6480464 Acetaminophen results in increased expression of KLHL25 mRNA CTD PMID:21420995 Klhl25 Rat perfluorohexanesulfonic acid decreases expression ISO RGD:1321935 6480464 perfluorohexanesulfonic acid results in decreased expression of KLHL25 mRNA CTD PMID:37995155 Klhl25 Rat phenobarbital affects expression ISO RGD:1321935 6480464 Phenobarbital affects the expression of KLHL25 mRNA CTD PMID:23091169 Klhl25 Rat pirinixic acid multiple interactions ISO RGD:1321935 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Klhl25 Rat pirinixic acid increases expression ISO RGD:1321935 6480464 pirinixic acid results in increased expression of KLHL25 mRNA CTD PMID:23811191 Klhl25 Rat resveratrol multiple interactions ISO RGD:1605054 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of KLHL25 mRNA CTD PMID:23557933 Klhl25 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of KLHL25 mRNA CTD PMID:34492290 Klhl25 Rat thiram increases expression ISO RGD:1605054 6480464 Thiram results in increased expression of KLHL25 mRNA CTD PMID:38568856 Klhl25 Rat trichostatin A affects expression ISO RGD:1605054 6480464 trichostatin A affects the expression of KLHL25 mRNA CTD PMID:28542535 Klhl25 Rat trimellitic anhydride increases expression ISO RGD:1321935 6480464 trimellitic anhydride results in increased expression of KLHL25 mRNA CTD PMID:19042947 Klhl25 Rat triphenyl phosphate affects expression ISO RGD:1605054 6480464 triphenyl phosphate affects the expression of KLHL25 mRNA CTD PMID:37042841 Klhl25 Rat urethane increases expression ISO RGD:1605054 6480464 Urethane results in increased expression of KLHL25 mRNA CTD PMID:28818685 Klhl25 Rat zinc atom multiple interactions ISO RGD:1605054 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of KLHL25 mRNA CTD PMID:18593933 Klhl25 Rat zinc(0) multiple interactions ISO RGD:1605054 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of KLHL25 mRNA CTD PMID:18593933
Biological Process
Only show annotations with direct experimental evidence (0 objects hidden)
Klhl25 Rat negative regulation of fatty acid biosynthetic process involved_in ISO RGD:1605054 1624291 PMID:27664236 RGD PMID:27664236 Klhl25 Rat positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved_in ISO RGD:1321935 1624291 PMID:34491895 RGD PMID:34491895 Klhl25 Rat positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved_in IEA UniProtKB:Q8R2P1|ensembl:ENSMUSP00000133175 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Klhl25 Rat positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved_in ISS UniProtKB:Q8R2P1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Klhl25 Rat positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved_in ISO RGD:1605054 1624291 PMID:34491895 RGD PMID:34491895 Klhl25 Rat positive regulation of fatty acid oxidation involved_in ISS UniProtKB:Q8R2P1 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Klhl25 Rat positive regulation of fatty acid oxidation involved_in IEA UniProtKB:Q8R2P1|ensembl:ENSMUSP00000133175 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Klhl25 Rat positive regulation of fatty acid oxidation involved_in ISO RGD:1605054 1624291 PMID:34491895 RGD PMID:34491895 Klhl25 Rat positive regulation of fatty acid oxidation involved_in ISO RGD:1321935 1624291 PMID:34491895 RGD PMID:34491895 Klhl25 Rat protein ubiquitination involved_in IEA UniPathway:UPA00143 1600115 GO_REF:0000041 UniProt GO_REF:0000041 Klhl25 Rat protein ubiquitination involved_in ISS UniProtKB:Q9H0H3 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Klhl25 Rat protein ubiquitination involved_in ISO RGD:1605054 1624291 PMID:22578813 RGD PMID:22578813 Klhl25 Rat regulation of translation involved_in IEA UniProtKB-KW:KW-0810 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Klhl25 Rat regulation of translational initiation involved_in ISO RGD:1605054 1624291 PMID:22578813 RGD PMID:22578813 Klhl25 Rat regulation of translational initiation involved_in ISS UniProtKB:Q9H0H3 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Klhl25 Rat ubiquitin-dependent protein catabolic process involved_in ISS UniProtKB:Q9H0H3 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Klhl25 Rat ubiquitin-dependent protein catabolic process involved_in IEA UniProtKB:Q8R2P1|ensembl:ENSMUSP00000133175 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Klhl25 Rat ubiquitin-dependent protein catabolic process involved_in ISO RGD:1605054 1624291 PMID:22578813, PMID:27664236, PMID:34491895 RGD PMID:22578813|PMID:27664236|PMID:34491895 Klhl25 Rat ubiquitin-dependent protein catabolic process involved_in ISO RGD:1321935 1624291 PMID:34491895 RGD PMID:34491895
Biological Process
negative regulation of fatty acid biosynthetic process (ISO) positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation (IEA,ISO,ISS) positive regulation of fatty acid oxidation (IEA,ISO,ISS) protein ubiquitination (IEA,ISO,ISS) regulation of translation (IEA) regulation of translational initiation (ISO,ISS) ubiquitin-dependent protein catabolic process (IEA,ISO,ISS)
Klhl25 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 139,134,655 - 139,159,898 (+) NCBI GRCr8 mRatBN7.2 1 129,724,894 - 129,750,142 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 129,722,026 - 129,750,227 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 137,630,051 - 137,655,206 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 144,800,323 - 144,825,478 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 137,689,819 - 137,714,976 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 137,333,880 - 137,359,107 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 137,333,881 - 137,359,072 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 138,322,710 - 138,355,032 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 131,540,949 - 131,566,141 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 131,636,985 - 131,638,938 (+) NCBI Celera 1 121,829,642 - 121,854,834 (+) NCBI Celera Cytogenetic Map 1 q31 NCBI
KLHL25 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 85,759,326 - 85,794,925 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 85,759,326 - 85,794,925 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 86,302,557 - 86,338,156 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 84,103,561 - 84,139,193 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 15 62,702,507 - 62,738,117 (-) NCBI Celera Cytogenetic Map 15 q25.3 NCBI HuRef 15 62,365,689 - 62,401,305 (-) NCBI HuRef CHM1_1 15 86,144,000 - 86,179,590 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 83,511,457 - 83,547,035 (-) NCBI T2T-CHM13v2.0
Klhl25 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 75,498,086 - 75,523,881 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 75,498,058 - 75,523,879 (+) Ensembl GRCm39 Ensembl GRCm38 7 75,848,338 - 75,874,133 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 75,848,310 - 75,874,131 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 82,993,224 - 83,019,016 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 75,721,910 - 75,741,004 (+) NCBI MGSCv36 mm8 Celera 7 73,298,548 - 73,327,582 (+) NCBI Celera Cytogenetic Map 7 D1 NCBI cM Map 7 43.81 NCBI
Klhl25 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955416 18,965,966 - 18,991,099 (+) NCBI ChiLan1.0 ChiLan1.0
KLHL25 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 75,302,695 - 75,340,844 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 79,007,350 - 79,045,503 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 64,448,130 - 64,486,254 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 83,661,360 - 83,671,886 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 83,670,090 - 83,671,859 (-) Ensembl panpan1.1 panPan2
KLHL25 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 49,339,576 - 49,375,473 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 49,348,982 - 49,351,663 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 51,978,492 - 52,014,269 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 49,760,167 - 49,795,982 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 49,760,169 - 49,795,968 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 49,258,177 - 49,293,852 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 49,486,578 - 49,522,306 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 49,832,848 - 49,868,610 (-) NCBI UU_Cfam_GSD_1.0
Klhl25 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 134,301,314 - 134,334,028 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936483 12,000,514 - 12,009,705 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936483 12,001,111 - 12,033,158 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KLHL25 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 88,262,385 - 88,264,691 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 88,249,009 - 88,291,958 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 94,609,175 - 94,657,162 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KLHL25 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 4,376,292 - 4,412,778 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 4,385,011 - 4,386,780 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 42,604,595 - 42,640,945 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Klhl25
.
Predicted Target Of
Count of predictions: 226 Count of miRNA genes: 150 Interacting mature miRNAs: 181 Transcripts: ENSRNOT00000014553 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 631570 Bp94 Blood pressure QTL 94 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123479780 142990467 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
RH138666
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 129,749,880 - 129,750,031 (-) MAPPER mRatBN7.2 mRatBN7.2 1 129,629,953 - 129,630,104 (+) MAPPER mRatBN7.2 Rnor_6.0 1 137,333,991 - 137,334,141 NCBI Rnor6.0 Rnor_6.0 1 137,325,570 - 137,325,720 NCBI Rnor6.0 Rnor_5.0 1 138,329,910 - 138,330,060 UniSTS Rnor5.0 Rnor_5.0 1 138,322,821 - 138,322,971 UniSTS Rnor5.0 RGSC_v3.4 1 131,370,820 - 131,370,970 UniSTS RGSC3.4 RGSC_v3.4 1 131,565,880 - 131,566,030 UniSTS RGSC3.4 Celera 1 121,854,573 - 121,854,723 UniSTS Celera 1 121,737,771 - 121,737,921 UniSTS RH 3.4 Map 1 1032.0 UniSTS Cytogenetic Map 1 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014553 ⟹ ENSRNOP00000014553
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 129,724,856 - 129,750,227 (+) Ensembl Rnor_6.0 Ensembl 1 137,333,881 - 137,359,072 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097328 ⟹ ENSRNOP00000089869
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 129,730,573 - 129,750,227 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111640 ⟹ ENSRNOP00000097538
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 129,722,026 - 129,750,227 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112874 ⟹ ENSRNOP00000090402
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 129,731,036 - 129,750,227 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112989 ⟹ ENSRNOP00000091951
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 129,735,457 - 129,746,366 (+) Ensembl
RefSeq Acc Id:
NM_001039006 ⟹ NP_001034095
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 139,134,706 - 139,159,898 (+) NCBI mRatBN7.2 1 129,724,950 - 129,750,142 (+) NCBI Rnor_6.0 1 137,333,880 - 137,359,072 (-) NCBI Rnor_5.0 1 138,322,710 - 138,355,032 (-) NCBI RGSC_v3.4 1 131,540,949 - 131,566,141 (+) RGD Celera 1 121,829,642 - 121,854,834 (+) RGD
Sequence:
TGCGGTTCGGCTACGGGATCGCGGCCGGGACTGGAGAGCCGGCCGGGGACGGCGGCAGCGGCGGGGACTGCGGAGCCTGTGGGGCCCCACGGTGGATACACAATGTCAGTCAGCGTTCACGAGACCCG
hide sequence
RefSeq Acc Id:
XM_006229380 ⟹ XP_006229442
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 139,145,157 - 139,159,898 (+) NCBI mRatBN7.2 1 129,735,417 - 129,750,142 (+) NCBI Rnor_6.0 1 137,333,880 - 137,352,882 (-) NCBI Rnor_5.0 1 138,322,710 - 138,355,032 (-) NCBI
Sequence:
GTGTCTGAGTGGGGGCCCTTCTAAACGGTATCTTAGTGACAGGTGGCTTTGCCTAGGTGAGGTGCAGGTGGCTTATCGTGTGTGGTATATGTTACCGTGAGGTTCTTTGTCTGTTTTCCTGTGGCAAA
hide sequence
RefSeq Acc Id:
XM_008759505 ⟹ XP_008757727
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 139,134,655 - 139,159,898 (+) NCBI mRatBN7.2 1 129,724,894 - 129,750,142 (+) NCBI Rnor_6.0 1 137,333,880 - 137,359,107 (-) NCBI
Sequence:
GAAGGCCGGAGAAACTAGTTTGTTGGCGGCGCCGGTGCGGTTCGGCTACGGGATCGCGGCCGGGACTGGAGAGCCGGCCGGGGACGGCGGCAGCGGCGGGGACTGCGGAGCCTGTGGGGCCCCACGGT
hide sequence
RefSeq Acc Id:
XM_063284515 ⟹ XP_063140585
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 139,138,627 - 139,159,898 (+) NCBI
RefSeq Acc Id:
NP_001034095 ⟸ NM_001039006
- UniProtKB:
Q4KLM4 (UniProtKB/Swiss-Prot), A6JC16 (UniProtKB/TrEMBL)
- Sequence:
MSVSVHETRKSRSSTGSMNISVFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIVINEENAESLLEAGDMLQ
hide sequence
RefSeq Acc Id:
XP_006229442 ⟸ XM_006229380
- Peptide Label:
isoform X1
- UniProtKB:
Q4KLM4 (UniProtKB/Swiss-Prot), A6JC16 (UniProtKB/TrEMBL)
- Sequence:
MSVSVHETRKSRSSTGSMNISVFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIVINEENAESLLEAGDMLQ
hide sequence
RefSeq Acc Id:
XP_008757727 ⟸ XM_008759505
- Peptide Label:
isoform X1
- UniProtKB:
Q4KLM4 (UniProtKB/Swiss-Prot), A6JC16 (UniProtKB/TrEMBL)
- Sequence:
MSVSVHETRKSRSSTGSMNISVFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIVINEENAESLLEAGDMLQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000014553 ⟸ ENSRNOT00000014553
Ensembl Acc Id:
ENSRNOP00000089869 ⟸ ENSRNOT00000097328
Ensembl Acc Id:
ENSRNOP00000097538 ⟸ ENSRNOT00000111640
Ensembl Acc Id:
ENSRNOP00000090402 ⟸ ENSRNOT00000112874
Ensembl Acc Id:
ENSRNOP00000091951 ⟸ ENSRNOT00000112989
RefSeq Acc Id:
XP_063140585 ⟸ XM_063284515
- Peptide Label:
isoform X1
- UniProtKB:
Q4KLM4 (UniProtKB/Swiss-Prot), A6JC16 (UniProtKB/TrEMBL)
RGD ID: 13690119 Promoter ID: EPDNEW_R644 Type: initiation region Name: Klhl25_1 Description: kelch-like family member 25 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 137,359,091 - 137,359,151 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-02-27
Klhl25
kelch-like family member 25
Klhl25
kelch-like 25 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Klhl25
kelch-like 25 (Drosophila)
RGD1310815
similar to hypothetical protein FLJ12587
Symbol and Name updated
1299863 APPROVED
2005-12-06
RGD1310815
similar to hypothetical protein FLJ12587
RGD1310815_predicted
similar to hypothetical protein FLJ12587 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1310815_predicted
similar to hypothetical protein FLJ12587 (predicted)
LOC293023_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC293023_predicted
similar to hypothetical protein FLJ12587 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
