Advanced Search (OLGA)

Gene: KLHL25 (kelch like family member 25) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

KLHL25

Name:

kelch like family member 25

RGD ID:

1605054

HGNC Page

HGNC:25732

Description:

Enables ubiquitin-like ligase-substrate adaptor activity. Involved in several processes, including positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation; regulation of fatty acid metabolic process; and ubiquitin-dependent protein catabolic process. Located in cytoplasm. Part of Cul3-RING ubiquitin ligase complex.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

BTB/POZ KELCH domain protein; ectoderm-neural cortex protein 2; ectodermal-neural cortex 2; ENC-2; ENC2; FLJ12587; FLJ45015; kelch-like 25; kelch-like family member 25; kelch-like protein 25

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Klhl25 (kelch-like 25)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Klhl25 (kelch-like family member 25)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Klhl25 (kelch like family member 25)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	KLHL25 (kelch like family member 25)	NCBI	Ortholog
Canis lupus familiaris (dog):	KLHL25 (kelch like family member 25)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Klhl25 (kelch like family member 25)	NCBI	Ortholog
Sus scrofa (pig):	KLHL25 (kelch like family member 25)	HGNC	EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):	KLHL25 (kelch like family member 25)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Klhl25 (kelch like family member 25)	NCBI	Ortholog
Other homologs ²
Mus musculus (house mouse):	Enc1 (ectodermal-neural cortex 1)	HGNC	OrthoMCL
Rattus norvegicus (Norway rat):	Smim12 (small integral membrane protein 12)	HGNC	OMA
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Klhl25 (kelch-like family member 25)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Klhl25 (kelch-like 25)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	enc2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus laevis (African clawed frog):	klhl25.L	Alliance	DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):	klhl25	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus laevis (African clawed frog):	klhl25.S	Alliance	DIOPT (Xenbase)

Related Pseudogenes:

KLHL25P1

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	85,759,326 - 85,794,925 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	85,759,326 - 85,794,925 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	86,302,557 - 86,338,156 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	84,103,561 - 84,139,193 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	15	62,702,507 - 62,738,117 (-)	NCBI		Celera
Cytogenetic Map	15	q25.3	NCBI
HuRef	15	62,365,689 - 62,401,305 (-)	NCBI		HuRef
CHM1_1	15	86,144,000 - 86,179,590 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	83,511,457 - 83,547,035 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
KLHL25	Human	Bloom syndrome		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Bloom syndrome	ClinVar	PMID:28492532
KLHL25	Human	colorectal cancer		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial colorectal cancer	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
KLHL25	Human	1,2-dichloroethane	decreases expression	ISO	Klhl25 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of KLHL25 mRNA	CTD	PMID:28960355
KLHL25	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Klhl25 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of KLHL25 mRNA	CTD	PMID:19770486
KLHL25	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Klhl25 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of KLHL25 mRNA	CTD	PMID:21570461 and PMID:24680724
KLHL25	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Klhl25 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin affects the expression of KLHL25 mRNA	CTD	PMID:22298810
KLHL25	Human	2,4-dinitrotoluene	affects expression	ISO	Klhl25 (Rattus norvegicus)	6480464	2 and 4-dinitrotoluene affects the expression of KLHL25 mRNA	CTD	PMID:21346803
KLHL25	Human	4,4'-sulfonyldiphenol	increases expression	ISO	Klhl25 (Mus musculus)	6480464	bisphenol S results in increased expression of KLHL25 mRNA	CTD	PMID:39298647
KLHL25	Human	acrylamide	increases expression	ISO	Klhl25 (Rattus norvegicus)	6480464	Acrylamide results in increased expression of KLHL25 mRNA	CTD	PMID:28959563
KLHL25	Human	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of KLHL25 mRNA	CTD	PMID:32763439
KLHL25	Human	aflatoxin B1	increases methylation	EXP		6480464	Aflatoxin B1 results in increased methylation of KLHL25 gene	CTD	PMID:27153756
KLHL25	Human	aflatoxin B1	affects methylation	EXP		6480464	Aflatoxin B1 affects the methylation of KLHL25 intron	CTD	PMID:30157460
KLHL25	Human	aristolochic acid A	increases expression	EXP		6480464	aristolochic acid I results in increased expression of KLHL25 mRNA	CTD	PMID:33212167
KLHL25	Human	atrazine	increases expression	EXP		6480464	Atrazine results in increased expression of KLHL25 mRNA	CTD	PMID:22378314
KLHL25	Human	benzo[a]pyrene	decreases expression	ISO	Klhl25 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of KLHL25 mRNA	CTD	PMID:19770486
KLHL25	Human	benzo[a]pyrene	increases methylation	EXP		6480464	Benzo(a)pyrene results in increased methylation of KLHL25 5' UTR and Benzo(a)pyrene results in increased methylation of KLHL25 promoter	CTD	PMID:27901495
KLHL25	Human	bisphenol A	increases expression	ISO	Klhl25 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of KLHL25 mRNA	CTD	PMID:25181051 more ...
KLHL25	Human	bisphenol A	decreases methylation	EXP		6480464	bisphenol A results in decreased methylation of KLHL25 gene	CTD	PMID:31601247
KLHL25	Human	bisphenol A	affects expression	ISO	Klhl25 (Rattus norvegicus)	6480464	bisphenol A affects the expression of KLHL25 mRNA	CTD	PMID:34947998
KLHL25	Human	C60 fullerene	increases expression	ISO	Klhl25 (Rattus norvegicus)	6480464	fullerene C60 results in increased expression of KLHL25 mRNA	CTD	PMID:19167457
KLHL25	Human	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of KLHL25 mRNA	CTD	PMID:38568856
KLHL25	Human	carbon nanotube	increases expression	ISO	Klhl25 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681 and PMID:25620056
KLHL25	Human	cefaloridine	decreases expression	ISO	Klhl25 (Rattus norvegicus)	6480464	Cephaloridine results in decreased expression of KLHL25 mRNA	CTD	PMID:18500788
KLHL25	Human	CGP 52608	multiple interactions	EXP		6480464	CGP 52608 promotes the reaction [RORA protein binds to KLHL25 gene]	CTD	PMID:28238834
KLHL25	Human	chlordecone	decreases expression	ISO	Klhl25 (Mus musculus)	6480464	Chlordecone results in decreased expression of KLHL25 mRNA	CTD	PMID:29980752
KLHL25	Human	cisplatin	increases expression	EXP		6480464	Cisplatin results in increased expression of KLHL25 mRNA	CTD	PMID:27594783
KLHL25	Human	Dibutyl phosphate	affects expression	EXP		6480464	di-n-butylphosphoric acid affects the expression of KLHL25 mRNA	CTD	PMID:37042841
KLHL25	Human	dibutyl phthalate	decreases expression	ISO	Klhl25 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of KLHL25 mRNA	CTD	PMID:21266533
KLHL25	Human	ethanol	increases expression	ISO	Klhl25 (Mus musculus)	6480464	Ethanol results in increased expression of KLHL25 mRNA	CTD	PMID:19167417
KLHL25	Human	flutamide	decreases expression	ISO	Klhl25 (Rattus norvegicus)	6480464	Flutamide results in decreased expression of KLHL25 mRNA	CTD	PMID:24136188
KLHL25	Human	furan	increases expression	ISO	Klhl25 (Mus musculus)	6480464	furan results in increased expression of KLHL25 mRNA	CTD	PMID:24183702
KLHL25	Human	gentamycin	decreases expression	ISO	Klhl25 (Rattus norvegicus)	6480464	Gentamicins results in decreased expression of KLHL25 mRNA	CTD	PMID:33387578
KLHL25	Human	glafenine	decreases expression	ISO	Klhl25 (Rattus norvegicus)	6480464	Glafenine results in decreased expression of KLHL25 mRNA	CTD	PMID:24136188
KLHL25	Human	Licochalcone B	increases expression	EXP		6480464	licochalcone B results in increased expression of KLHL25 mRNA	CTD	PMID:33647349
KLHL25	Human	paracetamol	affects expression	ISO	Klhl25 (Mus musculus)	6480464	Acetaminophen affects the expression of KLHL25 mRNA	CTD	PMID:17562736
KLHL25	Human	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of KLHL25 mRNA	CTD	PMID:21420995
KLHL25	Human	perfluorohexanesulfonic acid	decreases expression	ISO	Klhl25 (Mus musculus)	6480464	perfluorohexanesulfonic acid results in decreased expression of KLHL25 mRNA	CTD	PMID:37995155
KLHL25	Human	phenobarbital	affects expression	ISO	Klhl25 (Mus musculus)	6480464	Phenobarbital affects the expression of KLHL25 mRNA	CTD	PMID:23091169
KLHL25	Human	pirinixic acid	multiple interactions	ISO	Klhl25 (Mus musculus)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of KLHL25 mRNA	CTD	PMID:19710929
KLHL25	Human	pirinixic acid	increases expression	ISO	Klhl25 (Mus musculus)	6480464	pirinixic acid results in increased expression of KLHL25 mRNA	CTD	PMID:23811191
KLHL25	Human	resveratrol	multiple interactions	EXP		6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of KLHL25 mRNA	CTD	PMID:23557933
KLHL25	Human	thioacetamide	decreases expression	ISO	Klhl25 (Rattus norvegicus)	6480464	Thioacetamide results in decreased expression of KLHL25 mRNA	CTD	PMID:34492290
KLHL25	Human	thiram	increases expression	EXP		6480464	Thiram results in increased expression of KLHL25 mRNA	CTD	PMID:38568856
KLHL25	Human	trichostatin A	affects expression	EXP		6480464	trichostatin A affects the expression of KLHL25 mRNA	CTD	PMID:28542535
KLHL25	Human	trimellitic anhydride	increases expression	ISO	Klhl25 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of KLHL25 mRNA	CTD	PMID:19042947
KLHL25	Human	triphenyl phosphate	affects expression	EXP		6480464	triphenyl phosphate affects the expression of KLHL25 mRNA	CTD	PMID:37042841
KLHL25	Human	urethane	increases expression	EXP		6480464	Urethane results in increased expression of KLHL25 mRNA	CTD	PMID:28818685
KLHL25	Human	zinc atom	multiple interactions	EXP		6480464	[PCI 5002 co-treated with Zinc] results in increased expression of KLHL25 mRNA	CTD	PMID:18593933
KLHL25	Human	zinc(0)	multiple interactions	EXP		6480464	[PCI 5002 co-treated with Zinc] results in increased expression of KLHL25 mRNA	CTD	PMID:18593933

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
KLHL25	Human	negative regulation of fatty acid biosynthetic process	involved_in	IDA		150520179	PMID:27664236	UniProt	PMID:27664236
KLHL25	Human	positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	involved_in	IDA		150520179	PMID:34491895	UniProt	PMID:34491895
KLHL25	Human	positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	involved_in	IEA	UniProtKB:Q8R2P1 and ensembl:ENSMUSP00000133175	150520179		Ensembl	GO_REF:0000107
KLHL25	Human	positive regulation of fatty acid oxidation	involved_in	ISS	UniProtKB:Q8R2P1	150520179		UniProt	GO_REF:0000024
KLHL25	Human	positive regulation of fatty acid oxidation	involved_in	IDA		150520179	PMID:34491895	UniProt	PMID:34491895
KLHL25	Human	positive regulation of fatty acid oxidation	involved_in	IEA	UniProtKB:Q8R2P1 and ensembl:ENSMUSP00000133175	150520179		Ensembl	GO_REF:0000107
KLHL25	Human	protein ubiquitination	involved_in	IEA	UniPathway:UPA00143	150520179		UniProt	GO_REF:0000041
KLHL25	Human	protein ubiquitination	involved_in	IDA		150520179	PMID:22578813	UniProt	PMID:22578813
KLHL25	Human	regulation of translation	involved_in	IEA	UniProtKB-KW:KW-0810	150520179		UniProt	GO_REF:0000043
KLHL25	Human	regulation of translational initiation	involved_in	IDA		150520179	PMID:22578813	UniProt	PMID:22578813
KLHL25	Human	ubiquitin-dependent protein catabolic process	involved_in	IEA	UniProtKB:Q8R2P1 and ensembl:ENSMUSP00000133175	150520179		Ensembl	GO_REF:0000107
KLHL25	Human	ubiquitin-dependent protein catabolic process	involved_in	IDA		150520179	PMID:22578813 more ...	UniProt	PMID:22578813 more ...

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
KLHL25	Human	Cul3-RING ubiquitin ligase complex	part_of	IEA	UniProtKB:Q8R2P1 and ensembl:ENSMUSP00000133175	150520179		Ensembl	GO_REF:0000107
KLHL25	Human	Cul3-RING ubiquitin ligase complex	part_of	IDA		150520179	PMID:22578813 and PMID:27664236	UniProt	PMID:22578813 and PMID:27664236
KLHL25	Human	cytoplasm	located_in	IDA		150520179		LIFEdb	GO_REF:0000054
KLHL25	Human	cytosol	located_in	TAS		150520179		Reactome	Reactome:R-HSA-8952630 more ...

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
KLHL25	Human	ubiquitin-like ligase-substrate adaptor activity	enables	IEA	UniProtKB:Q8R2P1 and ensembl:ENSMUSP00000133175	150520179		Ensembl	GO_REF:0000107
KLHL25	Human	ubiquitin-like ligase-substrate adaptor activity	enables	IDA		150520179	PMID:22578813 more ...	UniProt	PMID:22578813 more ...

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11076863	PMID:11230166	PMID:11256614	PMID:12477932	PMID:14702039	PMID:15489334	PMID:15489336	PMID:16344560	PMID:16381901	PMID:17903295	PMID:19490893	PMID:21145461
PMID:21873635	PMID:22578813	PMID:22939624	PMID:23594818	PMID:23676014	PMID:24025145	PMID:26186194	PMID:27565346	PMID:27664236	PMID:28514442	PMID:28786561	PMID:31253590
PMID:33130828	PMID:33961781	PMID:34491895	PMID:34878901	PMID:35563538	PMID:35748872	PMID:37495603

KLHL25
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	85,759,326 - 85,794,925 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	85,759,326 - 85,794,925 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	86,302,557 - 86,338,156 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	84,103,561 - 84,139,193 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	15	62,702,507 - 62,738,117 (-)	NCBI		Celera
Cytogenetic Map	15	q25.3	NCBI
HuRef	15	62,365,689 - 62,401,305 (-)	NCBI		HuRef
CHM1_1	15	86,144,000 - 86,179,590 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	83,511,457 - 83,547,035 (-)	NCBI		T2T-CHM13v2.0

Klhl25
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	75,498,086 - 75,523,881 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	75,498,058 - 75,523,879 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	75,848,338 - 75,874,133 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	75,848,310 - 75,874,131 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	82,993,224 - 83,019,016 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	75,721,910 - 75,741,004 (+)	NCBI		MGSCv36	mm8
Celera	7	73,298,548 - 73,327,582 (+)	NCBI		Celera
Cytogenetic Map	7	D1	NCBI
cM Map	7	43.81	NCBI

Klhl25
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	139,134,655 - 139,159,898 (+)	NCBI		GRCr8
mRatBN7.2	1	129,724,894 - 129,750,142 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	129,722,026 - 129,750,227 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	137,630,051 - 137,655,206 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	144,800,323 - 144,825,478 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	137,689,819 - 137,714,976 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	137,333,880 - 137,359,107 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	137,333,881 - 137,359,072 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	138,322,710 - 138,355,032 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	131,540,949 - 131,566,141 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	131,636,985 - 131,638,938 (+)	NCBI
Celera	1	121,829,642 - 121,854,834 (+)	NCBI		Celera
Cytogenetic Map	1	q31	NCBI

Klhl25
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955416	18,965,966 - 18,991,099 (+)	NCBI	ChiLan1.0	ChiLan1.0

KLHL25
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	75,302,695 - 75,340,844 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	79,007,350 - 79,045,503 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	64,448,130 - 64,486,254 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	83,661,360 - 83,671,886 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	83,670,090 - 83,671,859 (-)	Ensembl	panpan1.1		panPan2

KLHL25
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	49,339,576 - 49,375,473 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	49,348,982 - 49,351,663 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	51,978,492 - 52,014,269 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	49,760,167 - 49,795,982 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	49,760,169 - 49,795,968 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	49,258,177 - 49,293,852 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	49,486,578 - 49,522,306 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	49,832,848 - 49,868,610 (-)	NCBI		UU_Cfam_GSD_1.0

Klhl25
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	134,301,314 - 134,334,028 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936483	12,000,514 - 12,009,705 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936483	12,001,111 - 12,033,158 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KLHL25
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	88,262,385 - 88,264,691 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	88,249,009 - 88,291,958 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	94,609,175 - 94,657,162 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KLHL25
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	4,376,292 - 4,412,778 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	4,385,011 - 4,386,780 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	42,604,595 - 42,640,945 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Klhl25
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624768	13,110,912 - 13,121,206 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624768	13,112,589 - 13,134,855 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in KLHL25
85 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 15q24.2-26.3(chr15:75307767-101723215)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052346]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052346]\|See cases [RCV000052346]	Chr15:75307767..101723215 [GRCh38] Chr15:75600108..102263418 [GRCh37] Chr15:73387161..100080941 [NCBI36] Chr15:15q24.2-26.3	pathogenic
GRCh38/hg38 15q24.3-26.3(chr15:77543797-101843411)x3	copy number gain	See cases [RCV000052347]	Chr15:77543797..101843411 [GRCh38] Chr15:77836139..102383614 [GRCh37] Chr15:75623194..100201137 [NCBI36] Chr15:15q24.3-26.3	pathogenic
GRCh38/hg38 15q25.2-26.3(chr15:84169153-101904929)x3	copy number gain	See cases [RCV000052352]	Chr15:84169153..101904929 [GRCh38] Chr15:84837905..102445132 [GRCh37] Chr15:82628909..100262655 [NCBI36] Chr15:15q25.2-26.3	pathogenic
NM_022480.3(KLHL25):c.50C>T (p.Ser17Phe)	single nucleotide variant	Malignant melanoma [RCV000070934]	Chr15:85769761 [GRCh38] Chr15:86312992 [GRCh37] Chr15:84113996 [NCBI36] Chr15:15q25.3	not provided
GRCh38/hg38 15q25.2-26.3(chr15:83711377-101843270)x3	copy number gain	See cases [RCV000135858]	Chr15:83711377..101843270 [GRCh38] Chr15:84380129..102383473 [GRCh37] Chr15:82171133..100200996 [NCBI36] Chr15:15q25.2-26.3	pathogenic
GRCh38/hg38 15q25.2-26.3(chr15:82859676-101810992)x3	copy number gain	See cases [RCV000136849]	Chr15:82859676..101810992 [GRCh38] Chr15:83528428..102351195 [GRCh37] Chr15:81325482..100168718 [NCBI36] Chr15:15q25.2-26.3	pathogenic
GRCh38/hg38 15q25.3-26.3(chr15:85397539-101888909)x3	copy number gain	See cases [RCV000141899]	Chr15:85397539..101888909 [GRCh38] Chr15:85940770..102429112 [GRCh37] Chr15:83741774..100246635 [NCBI36] Chr15:15q25.3-26.3	pathogenic
GRCh38/hg38 15q23-26.3(chr15:72154949-101920998)x3	copy number gain	See cases [RCV000143019]	Chr15:72154949..101920998 [GRCh38] Chr15:72447290..102461201 [GRCh37] Chr15:70234344..100278724 [NCBI36] Chr15:15q23-26.3	pathogenic
GRCh38/hg38 15q22.2-26.3(chr15:59828460-101920998)x3	copy number gain	See cases [RCV000142915]	Chr15:59828460..101920998 [GRCh38] Chr15:60120659..102461201 [GRCh37] Chr15:57907951..100278724 [NCBI36] Chr15:15q22.2-26.3	pathogenic
GRCh37/hg19 15q24.2-26.3(chr15:76061144-102429112)x3	copy number gain	See cases [RCV000511332]	Chr15:76061144..102429112 [GRCh37] Chr15:15q24.2-26.3	pathogenic
GRCh37/hg19 15q22.31-26.3(chr15:64637227-102509910)x3	copy number gain	See cases [RCV000240602]	Chr15:64637227..102509910 [GRCh37] Chr15:15q22.31-26.3	pathogenic
GRCh37/hg19 15q22.1-26.3(chr15:59297293-102480888)x3	copy number gain	not provided [RCV000415836]	Chr15:59297293..102480888 [GRCh37] Chr15:15q22.1-26.3	likely pathogenic
GRCh37/hg19 15q25.2-26.3(chr15:85089467-102495441)x3	copy number gain	See cases [RCV000449119]	Chr15:85089467..102495441 [GRCh37] Chr15:15q25.2-26.3	pathogenic
GRCh37/hg19 15q15.1-26.3(chr15:41745084-102354798)x4	copy number gain	See cases [RCV000447123]	Chr15:41745084..102354798 [GRCh37] Chr15:15q15.1-26.3	pathogenic
GRCh37/hg19 15q25.1-26.3(chr15:80648093-102429112)x3	copy number gain	See cases [RCV000445705]	Chr15:80648093..102429112 [GRCh37] Chr15:15q25.1-26.3	pathogenic
GRCh37/hg19 15q11.2-26.3(chr15:20733395-102511616)x4	copy number gain	See cases [RCV000447765]	Chr15:20733395..102511616 [GRCh37] Chr15:15q11.2-26.3	pathogenic
GRCh37/hg19 15q25.3-26.3(chr15:86148286-102511616)x3	copy number gain	See cases [RCV000448044]	Chr15:86148286..102511616 [GRCh37] Chr15:15q25.3-26.3	pathogenic
GRCh37/hg19 15q11.2-26.3(chr15:22770422-102429112)x3	copy number gain	See cases [RCV000510717]	Chr15:22770422..102429112 [GRCh37] Chr15:15q11.2-26.3	pathogenic
GRCh37/hg19 15q11.2-26.3(chr15:22770422-102429112)	copy number gain	See cases [RCV000512019]	Chr15:22770422..102429112 [GRCh37] Chr15:15q11.2-26.3	pathogenic
NM_022480.4(KLHL25):c.44C>T (p.Thr15Met)	single nucleotide variant	not specified [RCV004296574]	Chr15:85769767 [GRCh38] Chr15:86312998 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.394G>A (p.Val132Met)	single nucleotide variant	not specified [RCV004293046]	Chr15:85769417 [GRCh38] Chr15:86312648 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1733C>T (p.Thr578Met)	single nucleotide variant	not specified [RCV004296071]	Chr15:85768078 [GRCh38] Chr15:86311309 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1034C>T (p.Thr345Met)	single nucleotide variant	not specified [RCV004324568]	Chr15:85768777 [GRCh38] Chr15:86312008 [GRCh37] Chr15:15q25.3	uncertain significance
Single allele	duplication	not provided [RCV000677926]	Chr15:31115047..102354857 [GRCh37] Chr15:15q13.2-26.3	pathogenic
GRCh37/hg19 15q23-26.3(chr15:71329220-102270758)x3	copy number gain	not provided [RCV000683703]	Chr15:71329220..102270758 [GRCh37] Chr15:15q23-26.3	pathogenic
GRCh37/hg19 15q25.1-25.3(chr15:79023343-87158823)x1,2	copy number gain	not provided [RCV000683712]	Chr15:79023343..87158823 [GRCh37] Chr15:15q25.1-25.3	pathogenic
GRCh37/hg19 15q24.3-26.3(chr15:77479244-102429112)x3	copy number gain	not provided [RCV000683710]	Chr15:77479244..102429112 [GRCh37] Chr15:15q24.3-26.3	pathogenic
GRCh37/hg19 15q11.1-26.3(chr15:20016811-102493540)x3	copy number gain	not provided [RCV000751155]	Chr15:20016811..102493540 [GRCh37] Chr15:15q11.1-26.3	pathogenic
GRCh37/hg19 15q11.1-26.3(chr15:20071673-102461162)x3	copy number gain	not provided [RCV000751156]	Chr15:20071673..102461162 [GRCh37] Chr15:15q11.1-26.3	pathogenic
GRCh37/hg19 15q25.2-26.1(chr15:83883823-92165844)	copy number loss	not provided [RCV000767759]	Chr15:83883823..92165844 [GRCh37] Chr15:15q25.2-26.1	pathogenic
NM_022480.4(KLHL25):c.973G>A (p.Asp325Asn)	single nucleotide variant	not specified [RCV004282428]	Chr15:85768838 [GRCh38] Chr15:86312069 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1715C>T (p.Pro572Leu)	single nucleotide variant	not specified [RCV004294865]	Chr15:85768096 [GRCh38] Chr15:86311327 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.700C>T (p.Arg234Cys)	single nucleotide variant	not specified [RCV004313177]	Chr15:85769111 [GRCh38] Chr15:86312342 [GRCh37] Chr15:15q25.3	uncertain significance
GRCh37/hg19 15q25.3(chr15:86321274-87025980)x3	copy number gain	not provided [RCV001006717]	Chr15:86321274..87025980 [GRCh37] Chr15:15q25.3	uncertain significance
GRCh37/hg19 15q25.3(chr15:86299113-86724844)x3	copy number gain	not provided [RCV001006716]	Chr15:86299113..86724844 [GRCh37] Chr15:15q25.3	uncertain significance
NC_000015.9:g.(?_32964879)_(91358519_?)dup	duplication	Bloom syndrome [RCV001343104]\|Familial colorectal cancer [RCV001325176]	Chr15:32964879..91358519 [GRCh37] Chr15:15q13.3-26.1	uncertain significance
GRCh37/hg19 15q25.3(chr15:86299840-86725153)	copy number gain	not specified [RCV002052485]	Chr15:86299840..86725153 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1514C>G (p.Ala505Gly)	single nucleotide variant	not specified [RCV004193795]	Chr15:85768297 [GRCh38] Chr15:86311528 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.485G>A (p.Arg162His)	single nucleotide variant	not specified [RCV004237668]	Chr15:85769326 [GRCh38] Chr15:86312557 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.678G>C (p.Lys226Asn)	single nucleotide variant	not specified [RCV004125972]	Chr15:85769133 [GRCh38] Chr15:86312364 [GRCh37] Chr15:15q25.3	uncertain significance
GRCh37/hg19 15q24.3-26.3(chr15:77512817-102035027)x3	copy number gain	not provided [RCV002475797]	Chr15:77512817..102035027 [GRCh37] Chr15:15q24.3-26.3	pathogenic
NM_022480.4(KLHL25):c.811C>T (p.Arg271Cys)	single nucleotide variant	not specified [RCV004191996]	Chr15:85769000 [GRCh38] Chr15:86312231 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.866G>C (p.Arg289Pro)	single nucleotide variant	not specified [RCV004170086]	Chr15:85768945 [GRCh38] Chr15:86312176 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1072G>A (p.Val358Ile)	single nucleotide variant	not specified [RCV004140108]	Chr15:85768739 [GRCh38] Chr15:86311970 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.275A>G (p.Asn92Ser)	single nucleotide variant	not specified [RCV004206542]	Chr15:85769536 [GRCh38] Chr15:86312767 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.119G>A (p.Arg40His)	single nucleotide variant	not specified [RCV004175831]	Chr15:85769692 [GRCh38] Chr15:86312923 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.64C>A (p.Leu22Ile)	single nucleotide variant	not specified [RCV004120809]	Chr15:85769747 [GRCh38] Chr15:86312978 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.584A>G (p.Asp195Gly)	single nucleotide variant	not specified [RCV004113089]	Chr15:85769227 [GRCh38] Chr15:86312458 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1708A>G (p.Thr570Ala)	single nucleotide variant	not specified [RCV004232712]	Chr15:85768103 [GRCh38] Chr15:86311334 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1382A>G (p.Lys461Arg)	single nucleotide variant	not specified [RCV004160152]	Chr15:85768429 [GRCh38] Chr15:86311660 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1447C>T (p.Arg483Trp)	single nucleotide variant	not specified [RCV004177284]	Chr15:85768364 [GRCh38] Chr15:86311595 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1643G>T (p.Gly548Val)	single nucleotide variant	not specified [RCV004128282]	Chr15:85768168 [GRCh38] Chr15:86311399 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.62C>T (p.Thr21Ile)	single nucleotide variant	not specified [RCV004166640]	Chr15:85769749 [GRCh38] Chr15:86312980 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1090G>A (p.Val364Ile)	single nucleotide variant	not specified [RCV004201460]	Chr15:85768721 [GRCh38] Chr15:86311952 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.409G>A (p.Ala137Thr)	single nucleotide variant	not specified [RCV004181289]	Chr15:85769402 [GRCh38] Chr15:86312633 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1211C>T (p.Pro404Leu)	single nucleotide variant	not specified [RCV004076577]	Chr15:85768600 [GRCh38] Chr15:86311831 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1142A>G (p.His381Arg)	single nucleotide variant	not specified [RCV004165004]	Chr15:85768669 [GRCh38] Chr15:86311900 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1403C>T (p.Ser468Leu)	single nucleotide variant	not specified [RCV004130311]	Chr15:85768408 [GRCh38] Chr15:86311639 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1429G>A (p.Glu477Lys)	single nucleotide variant	not specified [RCV004217976]	Chr15:85768382 [GRCh38] Chr15:86311613 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.793A>T (p.Ile265Phe)	single nucleotide variant	not specified [RCV004077775]	Chr15:85769018 [GRCh38] Chr15:86312249 [GRCh37] Chr15:15q25.3	uncertain significance
GRCh37/hg19 15q22.33-26.1(chr15:67358491-91644328)x3	copy number gain	not provided [RCV003222839]	Chr15:67358491..91644328 [GRCh37] Chr15:15q22.33-26.1	pathogenic
NM_022480.4(KLHL25):c.1726A>G (p.Ile576Val)	single nucleotide variant	not specified [RCV004258090]	Chr15:85768085 [GRCh38] Chr15:86311316 [GRCh37] Chr15:15q25.3	uncertain significance
GRCh37/hg19 15q25.2-26.3(chr15:84228005-102264590)x3	copy number gain	not provided [RCV003222840]	Chr15:84228005..102264590 [GRCh37] Chr15:15q25.2-26.3	pathogenic
NM_022480.4(KLHL25):c.239G>A (p.Arg80Gln)	single nucleotide variant	not specified [RCV004262736]	Chr15:85769572 [GRCh38] Chr15:86312803 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.488G>A (p.Arg163Gln)	single nucleotide variant	not specified [RCV004267087]	Chr15:85769323 [GRCh38] Chr15:86312554 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.796A>G (p.Met266Val)	single nucleotide variant	not specified [RCV004279392]	Chr15:85769015 [GRCh38] Chr15:86312246 [GRCh37] Chr15:15q25.3	likely benign
NM_022480.4(KLHL25):c.446G>T (p.Cys149Phe)	single nucleotide variant	not specified [RCV004329848]	Chr15:85769365 [GRCh38] Chr15:86312596 [GRCh37] Chr15:15q25.3	uncertain significance
GRCh37/hg19 15q24.1-26.3(chr15:75165490-102520892)x3	copy number gain	See cases [RCV003329502]	Chr15:75165490..102520892 [GRCh37] Chr15:15q24.1-26.3	pathogenic
NM_022480.4(KLHL25):c.547G>A (p.Glu183Lys)	single nucleotide variant	not specified [RCV004356330]	Chr15:85769264 [GRCh38] Chr15:86312495 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.226A>G (p.Ser76Gly)	single nucleotide variant	not specified [RCV004336291]	Chr15:85769585 [GRCh38] Chr15:86312816 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1153G>A (p.Glu385Lys)	single nucleotide variant	not specified [RCV004409369]	Chr15:85768658 [GRCh38] Chr15:86311889 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1180G>A (p.Gly394Arg)	single nucleotide variant	not specified [RCV004409370]	Chr15:85768631 [GRCh38] Chr15:86311862 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1201G>C (p.Gly401Arg)	single nucleotide variant	not specified [RCV004409371]	Chr15:85768610 [GRCh38] Chr15:86311841 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1423A>G (p.Lys475Glu)	single nucleotide variant	not specified [RCV004409372]	Chr15:85768388 [GRCh38] Chr15:86311619 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1465G>A (p.Val489Ile)	single nucleotide variant	not specified [RCV004409373]	Chr15:85768346 [GRCh38] Chr15:86311577 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1486A>T (p.Ile496Phe)	single nucleotide variant	not specified [RCV004409374]	Chr15:85768325 [GRCh38] Chr15:86311556 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1678C>G (p.Pro560Ala)	single nucleotide variant	not specified [RCV004409375]	Chr15:85768133 [GRCh38] Chr15:86311364 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1721C>T (p.Ser574Leu)	single nucleotide variant	not specified [RCV004409376]	Chr15:85768090 [GRCh38] Chr15:86311321 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.206G>A (p.Arg69His)	single nucleotide variant	not specified [RCV004409377]	Chr15:85769605 [GRCh38] Chr15:86312836 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.358C>G (p.Leu120Val)	single nucleotide variant	not specified [RCV004409379]	Chr15:85769453 [GRCh38] Chr15:86312684 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.373G>A (p.Asp125Asn)	single nucleotide variant	not specified [RCV004409380]	Chr15:85769438 [GRCh38] Chr15:86312669 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.388C>T (p.His130Tyr)	single nucleotide variant	not specified [RCV004409381]	Chr15:85769423 [GRCh38] Chr15:86312654 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.409G>C (p.Ala137Pro)	single nucleotide variant	not specified [RCV004409382]	Chr15:85769402 [GRCh38] Chr15:86312633 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.469G>A (p.Asp157Asn)	single nucleotide variant	not specified [RCV004409383]	Chr15:85769342 [GRCh38] Chr15:86312573 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.508C>A (p.Arg170Ser)	single nucleotide variant	not specified [RCV004409385]	Chr15:85769303 [GRCh38] Chr15:86312534 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.613G>A (p.Glu205Lys)	single nucleotide variant	not specified [RCV004409386]	Chr15:85769198 [GRCh38] Chr15:86312429 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.619G>A (p.Glu207Lys)	single nucleotide variant	not specified [RCV004409387]	Chr15:85769192 [GRCh38] Chr15:86312423 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.661G>A (p.Asp221Asn)	single nucleotide variant	not specified [RCV004409388]	Chr15:85769150 [GRCh38] Chr15:86312381 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.669G>T (p.Glu223Asp)	single nucleotide variant	not specified [RCV004409390]	Chr15:85769142 [GRCh38] Chr15:86312373 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.679G>T (p.Val227Phe)	single nucleotide variant	not specified [RCV004409391]	Chr15:85769132 [GRCh38] Chr15:86312363 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.988C>T (p.Arg330Trp)	single nucleotide variant	not specified [RCV004409392]	Chr15:85768823 [GRCh38] Chr15:86312054 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.385T>A (p.Phe129Ile)	single nucleotide variant	not specified [RCV004631557]	Chr15:85769426 [GRCh38] Chr15:86312657 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.338A>G (p.Asn113Ser)	single nucleotide variant	not specified [RCV004631558]	Chr15:85769473 [GRCh38] Chr15:86312704 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.761C>T (p.Ala254Val)	single nucleotide variant	not specified [RCV004631560]	Chr15:85769050 [GRCh38] Chr15:86312281 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.593C>T (p.Ser198Leu)	single nucleotide variant	not specified [RCV004644122]	Chr15:85769218 [GRCh38] Chr15:86312449 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1630G>A (p.Gly544Arg)	single nucleotide variant	not specified [RCV004941468]	Chr15:85768181 [GRCh38] Chr15:86311412 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.86C>T (p.Pro29Leu)	single nucleotide variant	not specified [RCV004941470]	Chr15:85769725 [GRCh38] Chr15:86312956 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1422C>G (p.Ile474Met)	single nucleotide variant	not specified [RCV004941473]	Chr15:85768389 [GRCh38] Chr15:86311620 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.607G>A (p.Glu203Lys)	single nucleotide variant	not specified [RCV004941475]	Chr15:85769204 [GRCh38] Chr15:86312435 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.180C>A (p.His60Gln)	single nucleotide variant	not specified [RCV004941476]	Chr15:85769631 [GRCh38] Chr15:86312862 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.674G>A (p.Arg225Gln)	single nucleotide variant	not specified [RCV004941469]	Chr15:85769137 [GRCh38] Chr15:86312368 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.745G>A (p.Ala249Thr)	single nucleotide variant	not specified [RCV004941474]	Chr15:85769066 [GRCh38] Chr15:86312297 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1400C>A (p.Pro467His)	single nucleotide variant	not specified [RCV004941478]	Chr15:85768411 [GRCh38] Chr15:86311642 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.473C>T (p.Ala158Val)	single nucleotide variant	not specified [RCV004941479]	Chr15:85769338 [GRCh38] Chr15:86312569 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.697C>A (p.Leu233Ile)	single nucleotide variant	not specified [RCV004941477]	Chr15:85769114 [GRCh38] Chr15:86312345 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.122A>G (p.Lys41Arg)	single nucleotide variant	not specified [RCV004941471]	Chr15:85769689 [GRCh38] Chr15:86312920 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1364A>G (p.His455Arg)	single nucleotide variant	not specified [RCV004941472]	Chr15:85768447 [GRCh38] Chr15:86311678 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.911C>A (p.Thr304Asn)	single nucleotide variant	not specified [RCV004644121]	Chr15:85768900 [GRCh38] Chr15:86312131 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.335T>C (p.Ile112Thr)	single nucleotide variant	not specified [RCV004316112]	Chr15:85769476 [GRCh38] Chr15:86312707 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.1766C>T (p.Ala589Val)	single nucleotide variant	not specified [RCV004340828]	Chr15:85768045 [GRCh38] Chr15:86311276 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.247C>T (p.Arg83Trp)	single nucleotide variant	not specified [RCV004644118]	Chr15:85769564 [GRCh38] Chr15:86312795 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.706G>A (p.Val236Met)	single nucleotide variant	not specified [RCV004644119]	Chr15:85769105 [GRCh38] Chr15:86312336 [GRCh37] Chr15:15q25.3	uncertain significance
NM_022480.4(KLHL25):c.348C>G (p.Asn116Lys)	single nucleotide variant	not specified [RCV004644120]	Chr15:85769463 [GRCh38] Chr15:86312694 [GRCh37] Chr15:15q25.3	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	2430
Count of miRNA genes:	769
Interacting mature miRNAs:	876
Transcripts:	ENST00000337975, ENST00000536947, ENST00000559131
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597347355	GWAS1443429_H	lean body mass QTL GWAS1443429 (human)		6e-19	body lean mass (VT:0010483)	total body lean mass (CMO:0003950)	15	85783117	85783118	Human
597249880	GWAS1345954_H	legionella seropositivity QTL GWAS1345954 (human)		2e-08	legionella seropositivity		15	85785162	85785163	Human
597042852	GWAS1138926_H	appendicular lean mass QTL GWAS1138926 (human)		4e-16	appendicular lean mass		15	85783117	85783118	Human
597056546	GWAS1152620_H	FEV/FVC ratio QTL GWAS1152620 (human)		2e-09	FEV/FVC ratio	forced expiratory volume to forced vital capacity ratio (CMO:0000241)	15	85768967	85768968	Human
597164045	GWAS1260119_H	gut microbiome measurement QTL GWAS1260119 (human)		1e-08	gut microbiome measurement		15	85773629	85773630	Human
597211071	GWAS1307145_H	birth weight, parental genotype effect measurement QTL GWAS1307145 (human)		8e-12	birth weight, parental genotype effect measurement	neonatal body weight (CMO:0002079)	15	85773339	85773340	Human
407048474	GWAS697450_H	uridine measurement QTL GWAS697450 (human)		0.000004	uridine measurement		15	85786197	85786198	Human
597208482	GWAS1304556_H	birth weight QTL GWAS1304556 (human)		1e-08	birth weight	neonatal body weight (CMO:0002079)	15	85773339	85773340	Human
597255010	GWAS1351084_H	aspartate aminotransferase measurement QTL GWAS1351084 (human)		6e-11	aspartate aminotransferase measurement	blood aspartate aminotransferase activity level (CMO:0000580)	15	85779319	85779320	Human

WI-13910

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	15	86,302,580 - 86,302,679	UniSTS	GRCh37
Build 36	15	84,103,584 - 84,103,683	RGD	NCBI36
Celera	15	62,702,530 - 62,702,629	RGD
Cytogenetic Map	15	q25.3	UniSTS
HuRef	15	62,365,712 - 62,365,811	UniSTS
GeneMap99-GB4 RH Map	15	307.09	UniSTS
Whitehead-RH Map	15	326.3	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2439	2788	2253	4973	1726	2351	6	624	1946	465	2269	7301	6467	53	3734	1	852	1744	1617	175	1


RefSeq Transcripts	NM_022480	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_047432937	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_047432938	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054378614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054378615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC021739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK022649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK056663	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK092231	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK126962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK315541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL109693	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL136796	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY764034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC028100	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068263	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DA337553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DB063745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000337975 ⟹ ENSP00000336800

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	15	85,759,326 - 85,794,925 (-)	Ensembl

Ensembl Acc Id:

ENST00000536947

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	15	85,759,330 - 85,764,472 (-)	Ensembl

Ensembl Acc Id:

ENST00000559131

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	15	85,760,617 - 85,794,918 (-)	Ensembl

RefSeq Acc Id:

NM_022480 ⟹ NP_071925

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	15	85,759,326 - 85,794,925 (-)	NCBI
GRCh37	15	86,302,557 - 86,338,189 (-)	RGD
Build 36	15	84,103,561 - 84,139,193 (-)	NCBI Archive
Celera	15	62,702,507 - 62,738,117 (-)	RGD
HuRef	15	62,365,689 - 62,401,305 (-)	RGD
CHM1_1	15	86,144,000 - 86,179,590 (-)	NCBI
T2T-CHM13v2.0	15	83,511,457 - 83,547,035 (-)	NCBI

Sequence:

show sequence

AGAAACTAGTTTGTTGGCGGCGCCTAGGCTGTATCGCAGCGAGAGCGTTTTTGCCTGTGGAGAGCCGGCCGACGGGAGCCGCGGCGGAGCCTGTTGAGCTCGCGCGGGCTGCCGGGAGTGGTCTCTGA
GGCGGCGGCGGCGGCGGGGATCGTCTCCGGCACTGACGCACCATGTCGGTCAGTGTCCATGAGACCCGCAAGTCGCGGAGCAGCACGGGGTCCATGAACGTCACCCTCTTCCACAAGGCCTCCCACCC
GGACTGTGTGCTGGCCCACCTCAACACGCTTCGCAAGCACTGCATGTTCACCGACGTCACACTCTGGGCGGGCGACCGTGCCTTCCCCTGTCACCGTGCCGTGCTGGCCGCCTCTAGCCGCTATTTTG
AGGCCATGTTCAGCCATGGCCTTCGGGAGAGCCGGGATGACACTGTCAACTTCCAGGACAACCTGCACCCGGAGGTGCTGGAGCTGCTGCTGGACTTTGCCTACTCCTCACGCATCGCCATCAACGAG
GAGAACGCTGAGTCACTGCTGGAGGCAGGCGACATGCTGCAGTTCCACGATGTGCGGGATGCTGCCGCCGAGTTCCTGGAGAAGAACCTTTTCCCCTCCAACTGCCTGGGCATGATGCTGCTCTCGGA
CGCCCACCAGTGCCGCCGGCTGTATGAGTTCTCCTGGCGCATGTGCCTGGTGCACTTTGAGACGGTGAGGCAGAGCGAGGACTTCAACAGCCTGTCCAAGGACACACTGCTGGACCTCATCTCGAGTG
ATGAGCTGGAGACCGAGGACGAGCGGGTGGTCTTCGAGGCCATCCTCCAGTGGGTGAAGCACGACCTGGAGCCACGGAAGGTCCACTTGCCCGAGCTCCTCCGCAGCGTGCGTCTGGCCTTGCTGCCG
TCCGACTGCCTGCAGGAGGCCGTCTCCAGCGAGGCCCTCCTCATGGCAGACGAGCGCACCAAGCTTATCATGGATGAGGCCCTGCGCTGCAAGACCAGGATCCTGCAGAATGATGGCGTGGTCACCAG
CCCCTGTGCCCGGCCACGCAAGGCGGGCCACACGCTACTCATCCTGGGGGGCCAGACCTTCATGTGTGACAAGATCTACCAGGTGGACCACAAGGCCAAGGAGATCATCCCCAAGGCCGACCTGCCCA
GCCCCCGGAAGGAGTTCAGCGCCTCAGCGATCGGCTGCAAGGTCTATGTGACGGGGGGCAGGGGCTCCGAGAACGGGGTCTCCAAGGATGTCTGGGTGTACGACACCGTACATGAGGAATGGTCCAAG
GCGGCGCCCATGCTGATTGCCCGCTTTGGCCATGGCTCAGCTGAGCTGGAGAACTGCCTCTATGTGGTGGGGGGACACACATCCCTGGCAGGGGTCTTCCCGGCCTCGCCTTCTGTCTCCCTGAAACA
AGTGGAGAAATACGACCCTGGGGCCAACAAGTGGATGATGGTGGCCCCCTTGCGGGATGGCGTCAGCAATGCCGCAGTGGTGAGTGCCAAGCTGAAGCTCTTTGTTTTCGGAGGAACCAGCATCCACC
GGGACATGGTGTCCAAGGTCCAGTGCTATGACCCCTCGGAGAACAGGTGGACGATCAAGGCCGAGTGCCCCCAGCCTTGGCGGTACACAGCCGCTGCCGTCCTGGGCAGCCAGATCTTCATCATGGGA
GGTGACACGGAATTCACAGCCGCCTCGGCCTACCGCTTTGACTGTGAGACCAACCAGTGGACGCGGATTGGGGACATGACTGCCAAGCGCATGTCCTGCCATGCCCTGGCTTCCGGCAACAAGCTCTA
TGTGGTCGGGGGCTACTTTGGGACCCAGAGGTGTAAGACTCTGGACTGCTATGACCCCACTTCAGATACATGGAACTGCATCACCACAGTGCCCTACTCACTTATCCCCACGGCCTTTGTCAGCACCT
GGAAGCACCTGCCCGCGTGAGGAGCACCTGCTGAGCCCAGCCAGACCGCGGCCTTCAGTGTCACAGCGTGGCCTTGCTTGTCTGCCACAGCGGGAGCTAAGCCGGCCCTGGGCCAGCACTCCGAGAGG
TGGAAGGGGCCCTGCCAGCTCTGGGGAGCAGCAGCCTTGGGCTGTTCTGAGCTTTAGGCAAGAGAAGAGAAGCATCTCTTGCATCCGTGCCCCTGGGGGCCTCTTCAGCTTTGCAGTGGTTTGTGGGA
AGACATACCTCCCAGAGGGGCATGGACTGCCACCAGGACTGACCCTGGCGTCGGGGAGAAGGACACTTGCAGAGCCTTGAGATCACCTGTTTGGCAGGTCCTGGACTGGGGCCGGGCAGGCAGGGGCA
GGGAGGCGCCCCGGGTGGGCTTTGGGGCTGCGGCACTGCCACACATCCTTTCCCTCCTGGCCTGCCCTGCTGGGGCTCTACTGCCATCTATAGATGGTGTCCTGGGCCTGGGAAACTAGGTTCCCAGG
GGTTGAGACCAGAAAGGTGACCAAGACAGATTTTTTAAGGTGCAGAAACTGCAGGGGGGCCTCAGTGACATCCATGAGGCCTTATTAGCAAAGGACACCCAGACCTCCAAGGTTTGTGGGCCCCTTCC
ACAAAGCTGTAAGTCCCAGCCCACCTACTCAGGGCCTTGCTCAGTGCTGTGGCCCGGTGGGGACACAGTTGCTCGTGGCCACTCAGTGGAGCTGGGCCTGCAGCAGACTCAAGGCTCCGAGTGCCCTG
GGGGTCACCCCTCCCCTCCCCTCCTCAGAGCCCACCCTGAGAGGCAGCAGTGACCCCCATGGCACACACCTGCCAACAGCACTGGGGGCTTCTCCCCAGGAGACCACGCTGCCCTCCAAGACCAGGAG
CAGCTGTGAGCTGGAGACAGCAGAGGGACCCCAGGGTGTCCCCTGCAGATCCCACCAGGGCCGCATCCATCTCAGTGTGGAGGACAGTGACGGGACCCTCACCATCCTCTTGCGTTTTGGCCCCCATT
TGCTCCCTGAGCTCCAAGATAAGAATGGCCCCGAGAGAACTGCTGAACATTTGTTCATTGCTGTCACCTCCTGAGTCACTGGGGTCCCTCACCAGCACCTCCCTGACACCTGGGCTATGGAGAGGTTG
GCGCCTGTCAGTGACCATCCTAATGCCTCTCGCTCACTCCCAAGCCACCATTTGAGAGGGAGGGGTGTTGGTGCCCTGACAGGGACTGGGCAGGGTGTCCAAACTTGGGGCTTCCCAGGCACCTGCAG
TGTGAACACTGCTTGGCTGGCTCAAGATTAGGGCCGCGGAGGGGGCTGTGCACATACCAGTTACTTAAGCAGCCACGAGTGTCCCCCATGCCTTGGTGCGGGTCCTGGAGGCCTCTTGGGGGTGGGAC
CTTTGGGCAGGGTTTGCCCACTGACACGCCCGCCATGGGGCACTGGCTGCATGGGGCTCCTTGGACCCTGTAGACCCAGCAGACCCCGCCTGTGTCAGGCCAGCTGCCCGAAGGCACTTGGCTGTGGT
CCCAGGGGACGGCTCTGCTGGCACACTCAGGAGCCTGGCCGCGGGGACTGCAGGGAGGGTGCCTGGACCCGTGGGGTTGCTTCATTGAGATAAAGCACACTTATCACATAGCACAAAGGACGTGCCAT
GGTGCTTTCCCCAAAAGTTGTGTTGCTTTTATCAGTTTTCTAACTTAATAAAAAGAGTTGAGAAAA

hide sequence

RefSeq Acc Id:

XM_047432937 ⟹ XP_047288893

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	15	85,759,326 - 85,780,710 (-)	NCBI

RefSeq Acc Id:

XM_047432938 ⟹ XP_047288894

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	15	85,759,326 - 85,794,683 (-)	NCBI

RefSeq Acc Id:

XM_054378614 ⟹ XP_054234589

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	15	83,511,457 - 83,546,793 (-)	NCBI

RefSeq Acc Id:

XM_054378615 ⟹ XP_054234590

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	15	83,511,457 - 83,533,210 (-)	NCBI


Protein RefSeqs	NP_071925	(Get FASTA)	NCBI Sequence Viewer
	XP_047288893	(Get FASTA)	NCBI Sequence Viewer
	XP_047288894	(Get FASTA)	NCBI Sequence Viewer
	XP_054234589	(Get FASTA)	NCBI Sequence Viewer
	XP_054234590	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH28100	(Get FASTA)	NCBI Sequence Viewer
	AAV51405	(Get FASTA)	NCBI Sequence Viewer
	BAB14155	(Get FASTA)	NCBI Sequence Viewer
	BAG37919	(Get FASTA)	NCBI Sequence Viewer
	BAG51779	(Get FASTA)	NCBI Sequence Viewer
	BAG52499	(Get FASTA)	NCBI Sequence Viewer
	CAB66730	(Get FASTA)	NCBI Sequence Viewer
	EAX01979	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000336800
	ENSP00000336800.5
GenBank Protein	Q9H0H3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071925 ⟸ NM_022480

- UniProtKB:

B2RDH2 (UniProtKB/Swiss-Prot), B3KRT7 (UniProtKB/Swiss-Prot), Q9H0H3 (UniProtKB/Swiss-Prot), B3KPR7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSVSVHETRKSRSSTGSMNVTLFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENAESLLEAGDMLQ
FHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSDCLQEAVSSEALL
MADERTKLIMDEALRCKTRILQNDGVVTSPCARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPRKEFSASAIGCKVYVTGGRGSENGVSKDVWVYDTVHEEWSKAAPMLIARFGHGSA
ELENCLYVVGGHTSLAGVFPASPSVSLKQVEKYDPGANKWMMVAPLRDGVSNAAVVSAKLKLFVFGGTSIHRDMVSKVQCYDPSENRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEFTAASAYRFD
CETNQWTRIGDMTAKRMSCHALASGNKLYVVGGYFGTQRCKTLDCYDPTSDTWNCITTVPYSLIPTAFVSTWKHLPA

hide sequence

Ensembl Acc Id:

ENSP00000336800 ⟸ ENST00000337975

RefSeq Acc Id:	XP_047288894 ⟸ XM_047432938
- Peptide Label:	isoform X1
- UniProtKB:	Q9H0H3 (UniProtKB/Swiss-Prot), B2RDH2 (UniProtKB/Swiss-Prot), B3KRT7 (UniProtKB/Swiss-Prot), B3KPR7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_047288893 ⟸ XM_047432937
- Peptide Label:	isoform X1
- UniProtKB:	Q9H0H3 (UniProtKB/Swiss-Prot), B2RDH2 (UniProtKB/Swiss-Prot), B3KRT7 (UniProtKB/Swiss-Prot), B3KPR7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_054234589 ⟸ XM_054378614
- Peptide Label:	isoform X2
- UniProtKB:	B3KPR7 (UniProtKB/TrEMBL)

Protein Domains

BACK BTB

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9H0H3-F1-model_v2	AlphaFold	Q9H0H3	1-589	view protein structure

RGD ID:

6792410

Promoter ID:

HG_KWN:22258

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4

Transcripts:

OTTHUMT00000309023

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	15	84,139,066 - 84,139,632 (-)	MPROMDB

RGD ID:

7230419

Promoter ID:

EPDNEW_H20955

Type:

initiation region

Name:

KLHL25_1

Description:

kelch like family member 25

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	15	85,794,936 - 85,794,996	EPDNEW

Database	Acc Id	Source(s)
COSMIC	KLHL25	COSMIC
Ensembl Genes	ENSG00000183655	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000337975	ENTREZGENE
	ENST00000337975.6	UniProtKB/Swiss-Prot
Gene3D-CATH	1.25.40.420	UniProtKB/Swiss-Prot
	2.120.10.80	UniProtKB/Swiss-Prot
	Potassium Channel Kv1.1, Chain A	UniProtKB/Swiss-Prot
GTEx	ENSG00000183655	GTEx
HGNC ID	HGNC:25732	ENTREZGENE
Human Proteome Map	KLHL25	Human Proteome Map
InterPro	BACK	UniProtKB/Swiss-Prot
	BTB-kelch_protein	UniProtKB/Swiss-Prot
	BTB/POZ_dom	UniProtKB/Swiss-Prot
	Kelch-typ_b-propeller	UniProtKB/Swiss-Prot
	Kelch_1	UniProtKB/Swiss-Prot
	KLHL25	UniProtKB/Swiss-Prot
	SKP1/BTB/POZ_sf	UniProtKB/Swiss-Prot
KEGG Report	hsa:64410	UniProtKB/Swiss-Prot
NCBI Gene	64410	ENTREZGENE
OMIM	619893	OMIM
PANTHER	KELCH PROTEIN	UniProtKB/Swiss-Prot
	KELCH-LIKE PROTEIN 25	UniProtKB/Swiss-Prot
Pfam	BACK	UniProtKB/Swiss-Prot
	BTB	UniProtKB/Swiss-Prot
	Kelch_1	UniProtKB/Swiss-Prot
PharmGKB	PA142671577	PharmGKB
PIRSF	Kelch-like_protein_gigaxonin	UniProtKB/Swiss-Prot
PROSITE	BTB	UniProtKB/Swiss-Prot
SMART	BACK	UniProtKB/Swiss-Prot
	BTB	UniProtKB/Swiss-Prot
	Kelch	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF117281	UniProtKB/Swiss-Prot
	SSF54695	UniProtKB/Swiss-Prot
UniProt	B2RDH2	ENTREZGENE
	B3KPR7	ENTREZGENE, UniProtKB/TrEMBL
	B3KRT7	ENTREZGENE
	KLH25_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	B2RDH2	UniProtKB/Swiss-Prot
	B3KRT7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-24	KLHL25	kelch like family member 25		kelch-like family member 25	Symbol and/or name change	5135510	APPROVED
2013-02-27	KLHL25	kelch-like family member 25		kelch-like 25 (Drosophila)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar