Symbol:
Ndufb10
Name:
NADH:ubiquinone oxidoreductase subunit B10
RGD ID:
1310782
Description:
Predicted to be located in mitochondrion. Predicted to be part of respiratory chain complex I. Predicted to be active in mitochondrial inner membrane. Human ortholog(s) of this gene implicated in nuclear type mitochondrial complex I deficiency 35. Orthologous to human NDUFB10 (NADH:ubiquinone oxidoreductase subunit B10); PARTICIPATES IN Alzheimer's disease pathway; Huntington's disease pathway; oxidative phosphorylation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC287121; LOC681418; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10; similar to NADH-ubiquinone oxidoreductase PDSW subunit (Complex I-PDSW) (CI-PDSW)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NDUFB10 (NADH:ubiquinone oxidoreductase subunit B10)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ndufb10 (NADH:ubiquinone oxidoreductase subunit B10)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ndufb10 (NADH:ubiquinone oxidoreductase subunit B10)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NDUFB10 (NADH:ubiquinone oxidoreductase subunit B10)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NDUFB10 (NADH:ubiquinone oxidoreductase subunit B10)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ndufb10 (NADH:ubiquinone oxidoreductase subunit B10)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NDUFB10 (NADH:ubiquinone oxidoreductase subunit B10)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NDUFB10 (NADH:ubiquinone oxidoreductase subunit B10)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ndufb10 (NADH:ubiquinone oxidoreductase subunit B10)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NDUFB10 (NADH:ubiquinone oxidoreductase subunit B10)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ndufb10 (NADH:ubiquinone oxidoreductase subunit B10)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ndufb10 (NADH:ubiquinone oxidoreductase subunit B10)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F59C6.5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
ND-PDSW
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ndufb10
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 14,253,805 - 14,255,966 (-) NCBI GRCr8 mRatBN7.2 10 13,749,273 - 13,751,434 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 13,749,275 - 13,751,442 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 18,496,065 - 18,498,341 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 17,984,925 - 17,987,201 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 13,484,121 - 13,486,397 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 14,090,128 - 14,092,289 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 14,090,128 - 14,092,289 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 13,905,856 - 13,908,017 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 13,977,307 - 13,979,468 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 13,428,991 - 13,431,152 (-) NCBI Celera Cytogenetic Map 10 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ndufb10 Rat 1,2-dimethylhydrazine multiple interactions ISO Ndufb10 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NDUFB10 mRNA CTD PMID:22206623 Ndufb10 Rat 17beta-estradiol decreases expression ISO Ndufb10 (Mus musculus) 6480464 Estradiol results in decreased expression of NDUFB10 mRNA CTD PMID:39298647 Ndufb10 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NDUFB10 mRNA CTD PMID:21215274 Ndufb10 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NDUFB10 mRNA CTD PMID:33387578 Ndufb10 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ndufb10 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NDUFB10 mRNA CTD PMID:21570461 Ndufb10 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ndufb10 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NDUFB10 mRNA CTD PMID:20399798 Ndufb10 Rat 2-hydroxypropanoic acid decreases expression ISO NDUFB10 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of NDUFB10 mRNA CTD PMID:30851411 Ndufb10 Rat 4,4'-sulfonyldiphenol increases expression ISO Ndufb10 (Mus musculus) 6480464 bisphenol S results in increased expression of NDUFB10 mRNA CTD PMID:39298647 Ndufb10 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NDUFB10 mRNA CTD PMID:36041667 Ndufb10 Rat 4,4'-sulfonyldiphenol increases expression ISO NDUFB10 (Homo sapiens) 6480464 bisphenol S results in increased expression of NDUFB10 protein CTD PMID:34186270 Ndufb10 Rat 5-fluorouracil affects expression ISO NDUFB10 (Homo sapiens) 6480464 Fluorouracil affects the expression of NDUFB10 mRNA CTD PMID:34151400 Ndufb10 Rat actinomycin D multiple interactions ISO NDUFB10 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of NDUFB10 protein CTD PMID:38460933 Ndufb10 Rat arsane multiple interactions ISO NDUFB10 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NDUFB10 mRNA CTD PMID:39836092 Ndufb10 Rat arsenic atom multiple interactions ISO NDUFB10 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NDUFB10 mRNA CTD PMID:39836092 Ndufb10 Rat arsenite(3-) multiple interactions ISO NDUFB10 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to NDUFB10 mRNA] CTD PMID:32406909 Ndufb10 Rat aspartame multiple interactions ISO Ndufb10 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Ndufb10 Rat atrazine decreases expression ISO NDUFB10 (Homo sapiens) 6480464 Atrazine results in decreased expression of NDUFB10 mRNA CTD PMID:22378314 Ndufb10 Rat benzo[a]pyrene increases expression ISO Ndufb10 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of NDUFB10 mRNA CTD PMID:19770486 and PMID:22228805 Ndufb10 Rat benzo[a]pyrene increases methylation ISO NDUFB10 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NDUFB10 promoter CTD PMID:27901495 Ndufb10 Rat beta-lapachone decreases expression ISO NDUFB10 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of NDUFB10 mRNA CTD PMID:38218311 Ndufb10 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ndufb10 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of NDUFB10 mRNA CTD PMID:35550907 Ndufb10 Rat bis(2-ethylhexyl) phthalate increases expression ISO Ndufb10 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of NDUFB10 mRNA CTD PMID:33754040 Ndufb10 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NDUFB10 mRNA CTD PMID:25181051 Ndufb10 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NDUFB10 mRNA CTD PMID:36041667 Ndufb10 Rat bisphenol A decreases expression ISO NDUFB10 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NDUFB10 protein CTD PMID:34186270 Ndufb10 Rat bisphenol A decreases methylation ISO NDUFB10 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of NDUFB10 gene CTD PMID:31601247 Ndufb10 Rat bisphenol A decreases expression ISO Ndufb10 (Mus musculus) 6480464 bisphenol A results in decreased expression of NDUFB10 mRNA and bisphenol A results in decreased expression of NDUFB10 protein CTD PMID:33221593 and PMID:35598803 Ndufb10 Rat bisphenol A increases expression ISO NDUFB10 (Homo sapiens) 6480464 bisphenol A results in increased expression of NDUFB10 protein CTD PMID:37567409 Ndufb10 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NDUFB10 mRNA CTD PMID:30816183 and PMID:34947998 Ndufb10 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of NDUFB10 gene CTD PMID:28505145 Ndufb10 Rat bisphenol AF increases expression ISO NDUFB10 (Homo sapiens) 6480464 bisphenol AF results in increased expression of NDUFB10 protein CTD PMID:34186270 Ndufb10 Rat Bisphenol B increases expression ISO NDUFB10 (Homo sapiens) 6480464 bisphenol B results in increased expression of NDUFB10 protein CTD PMID:34186270 Ndufb10 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NDUFB10 mRNA CTD PMID:36041667 Ndufb10 Rat bisphenol F increases expression ISO NDUFB10 (Homo sapiens) 6480464 bisphenol F results in increased expression of NDUFB10 protein CTD PMID:34186270 Ndufb10 Rat captan increases expression ISO Ndufb10 (Mus musculus) 6480464 Captan results in increased expression of NDUFB10 mRNA CTD PMID:31558096 Ndufb10 Rat carbon nanotube decreases expression ISO Ndufb10 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of NDUFB10 mRNA CTD PMID:25620056 Ndufb10 Rat chloropicrin increases expression ISO NDUFB10 (Homo sapiens) 6480464 chloropicrin results in increased expression of NDUFB10 mRNA CTD PMID:26352163 Ndufb10 Rat clobetasol increases expression ISO Ndufb10 (Mus musculus) 6480464 Clobetasol results in increased expression of NDUFB10 mRNA CTD PMID:27462272 Ndufb10 Rat clofibrate decreases expression ISO Ndufb10 (Mus musculus) 6480464 Clofibrate results in decreased expression of NDUFB10 mRNA CTD PMID:17585979 Ndufb10 Rat copper(II) sulfate decreases expression ISO NDUFB10 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of NDUFB10 mRNA CTD PMID:19549813 Ndufb10 Rat corosolic acid decreases expression ISO NDUFB10 (Homo sapiens) 6480464 corosolic acid results in decreased expression of NDUFB10 mRNA CTD PMID:37939859 Ndufb10 Rat cyclosporin A decreases expression ISO NDUFB10 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NDUFB10 mRNA CTD PMID:20106945 and PMID:25562108 Ndufb10 Rat diazinon increases methylation ISO NDUFB10 (Homo sapiens) 6480464 Diazinon results in increased methylation of NDUFB10 gene CTD PMID:22964155 Ndufb10 Rat Dibutyl phosphate affects expression ISO NDUFB10 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NDUFB10 mRNA CTD PMID:37042841 Ndufb10 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of NDUFB10 mRNA CTD PMID:21266533 Ndufb10 Rat dibutyl phthalate decreases expression ISO Ndufb10 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of NDUFB10 mRNA CTD PMID:17361019 Ndufb10 Rat disodium selenite increases expression ISO NDUFB10 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of NDUFB10 mRNA CTD PMID:18175754 Ndufb10 Rat doxorubicin increases expression ISO NDUFB10 (Homo sapiens) 6480464 Doxorubicin results in increased expression of NDUFB10 mRNA CTD PMID:29803840 Ndufb10 Rat epoxiconazole increases expression ISO Ndufb10 (Mus musculus) 6480464 epoxiconazole results in increased expression of NDUFB10 mRNA CTD PMID:35436446 Ndufb10 Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of NDUFB10 protein CTD PMID:33656234 Ndufb10 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of NDUFB10 mRNA CTD PMID:24136188 Ndufb10 Rat folic acid multiple interactions ISO Ndufb10 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NDUFB10 mRNA CTD PMID:22206623 Ndufb10 Rat folpet increases expression ISO Ndufb10 (Mus musculus) 6480464 folpet results in increased expression of NDUFB10 mRNA CTD PMID:31558096 Ndufb10 Rat fumonisin B1 decreases expression ISO Ndufb10 (Mus musculus) 6480464 fumonisin B1 results in decreased expression of NDUFB10 mRNA CTD PMID:16221962 Ndufb10 Rat hydralazine multiple interactions ISO NDUFB10 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of NDUFB10 mRNA CTD PMID:17183730 Ndufb10 Rat isoniazide affects expression ISO Ndufb10 (Mus musculus) 6480464 Isoniazid affects the expression of NDUFB10 mRNA CTD PMID:24848797 Ndufb10 Rat ivermectin decreases expression ISO NDUFB10 (Homo sapiens) 6480464 Ivermectin results in decreased expression of NDUFB10 protein CTD PMID:32959892 Ndufb10 Rat lipopolysaccharide multiple interactions ISO NDUFB10 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of NDUFB10 mRNA CTD PMID:31059760 Ndufb10 Rat melittin decreases expression ISO Ndufb10 (Mus musculus) 6480464 Melitten results in decreased expression of NDUFB10 mRNA CTD PMID:37678661 Ndufb10 Rat methyl methanesulfonate decreases expression ISO NDUFB10 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of NDUFB10 mRNA CTD PMID:23649840 Ndufb10 Rat methylparaben decreases expression ISO NDUFB10 (Homo sapiens) 6480464 methylparaben results in decreased expression of NDUFB10 mRNA CTD PMID:38568856 Ndufb10 Rat monosodium L-glutamate multiple interactions ISO Ndufb10 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Ndufb10 Rat niclosamide decreases expression ISO NDUFB10 (Homo sapiens) 6480464 Niclosamide results in decreased expression of NDUFB10 mRNA CTD PMID:22576131 Ndufb10 Rat nitrates multiple interactions ISO Ndufb10 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NDUFB10 mRNA CTD PMID:35964746 Ndufb10 Rat Nutlin-3 multiple interactions ISO NDUFB10 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of NDUFB10 protein CTD PMID:38460933 Ndufb10 Rat oxybenzone increases expression EXP 6480464 oxybenzone results in increased expression of NDUFB10 mRNA CTD PMID:30316929 Ndufb10 Rat paracetamol affects expression ISO Ndufb10 (Mus musculus) 6480464 Acetaminophen affects the expression of NDUFB10 mRNA CTD PMID:17562736 Ndufb10 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NDUFB10 mRNA CTD PMID:33387578 Ndufb10 Rat paracetamol multiple interactions ISO NDUFB10 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of NDUFB10 mRNA CTD PMID:31059760 Ndufb10 Rat paracetamol decreases expression ISO NDUFB10 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of NDUFB10 mRNA CTD PMID:25704631 and PMID:31059760 Ndufb10 Rat perfluorooctanoic acid decreases expression ISO NDUFB10 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of NDUFB10 protein CTD PMID:26879310 Ndufb10 Rat pirinixic acid increases expression ISO Ndufb10 (Mus musculus) 6480464 pirinixic acid results in increased expression of NDUFB10 mRNA CTD PMID:16221962 Ndufb10 Rat pyrogallol increases expression ISO Ndufb10 (Mus musculus) 6480464 Pyrogallol results in increased expression of NDUFB10 mRNA CTD PMID:20362636 Ndufb10 Rat rac-lactic acid decreases expression ISO NDUFB10 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of NDUFB10 mRNA CTD PMID:30851411 Ndufb10 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of NDUFB10 protein CTD PMID:29459688 Ndufb10 Rat sodium arsenite multiple interactions ISO NDUFB10 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NDUFB10 mRNA CTD PMID:39836092 Ndufb10 Rat sodium arsenite decreases expression ISO NDUFB10 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NDUFB10 mRNA CTD PMID:38568856 Ndufb10 Rat sodium dichromate increases expression ISO Ndufb10 (Mus musculus) 6480464 sodium bichromate results in increased expression of NDUFB10 mRNA CTD PMID:31558096 Ndufb10 Rat sodium fluoride increases expression ISO Ndufb10 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of NDUFB10 protein CTD PMID:28918527 Ndufb10 Rat temozolomide increases expression ISO NDUFB10 (Homo sapiens) 6480464 Temozolomide results in increased expression of NDUFB10 mRNA CTD PMID:31758290 Ndufb10 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of NDUFB10 mRNA CTD PMID:31150632 Ndufb10 Rat tetrachloromethane decreases expression ISO Ndufb10 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of NDUFB10 mRNA CTD PMID:31919559 Ndufb10 Rat thapsigargin decreases expression ISO Ndufb10 (Mus musculus) 6480464 Thapsigargin results in decreased expression of NDUFB10 protein CTD PMID:24648495 Ndufb10 Rat thiram decreases expression ISO NDUFB10 (Homo sapiens) 6480464 Thiram results in decreased expression of NDUFB10 mRNA CTD PMID:38568856 Ndufb10 Rat titanium dioxide decreases methylation ISO Ndufb10 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NDUFB10 gene CTD PMID:35295148 Ndufb10 Rat triphenyl phosphate affects expression ISO NDUFB10 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NDUFB10 mRNA CTD PMID:37042841 Ndufb10 Rat valproic acid increases methylation ISO NDUFB10 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NDUFB10 gene CTD PMID:29154799 Ndufb10 Rat valproic acid multiple interactions ISO NDUFB10 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of NDUFB10 mRNA CTD PMID:17183730 Ndufb10 Rat valproic acid decreases expression ISO NDUFB10 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NDUFB10 mRNA CTD PMID:29154799 and PMID:29501571 Ndufb10 Rat valproic acid increases expression ISO NDUFB10 (Homo sapiens) 6480464 Valproic Acid results in increased expression of NDUFB10 mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 5-fluorouracil (ISO) actinomycin D (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) aspartame (ISO) atrazine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) captan (ISO) carbon nanotube (ISO) chloropicrin (ISO) clobetasol (ISO) clofibrate (ISO) copper(II) sulfate (ISO) corosolic acid (ISO) cyclosporin A (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) disodium selenite (ISO) doxorubicin (ISO) epoxiconazole (ISO) fenvalerate (EXP) flutamide (EXP) folic acid (ISO) folpet (ISO) fumonisin B1 (ISO) hydralazine (ISO) isoniazide (ISO) ivermectin (ISO) lipopolysaccharide (ISO) melittin (ISO) methyl methanesulfonate (ISO) methylparaben (ISO) monosodium L-glutamate (ISO) niclosamide (ISO) nitrates (ISO) Nutlin-3 (ISO) oxybenzone (EXP) paracetamol (EXP,ISO) perfluorooctanoic acid (ISO) pirinixic acid (ISO) pyrogallol (ISO) rac-lactic acid (ISO) sodium arsenite (EXP,ISO) sodium dichromate (ISO) sodium fluoride (ISO) temozolomide (ISO) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) valproic acid (ISO)
Ndufb10 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 14,253,805 - 14,255,966 (-) NCBI GRCr8 mRatBN7.2 10 13,749,273 - 13,751,434 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 13,749,275 - 13,751,442 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 18,496,065 - 18,498,341 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 17,984,925 - 17,987,201 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 13,484,121 - 13,486,397 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 14,090,128 - 14,092,289 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 14,090,128 - 14,092,289 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 13,905,856 - 13,908,017 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 13,977,307 - 13,979,468 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 13,428,991 - 13,431,152 (-) NCBI Celera Cytogenetic Map 10 q12 NCBI
NDUFB10 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 1,959,538 - 1,961,975 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 1,959,538 - 1,961,975 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 2,009,539 - 2,011,976 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 1,949,520 - 1,951,977 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 1,949,519 - 1,951,977 NCBI Celera 16 2,221,698 - 2,224,158 (+) NCBI Celera Cytogenetic Map 16 p13.3 NCBI HuRef 16 1,933,643 - 1,936,103 (+) NCBI HuRef CHM1_1 16 2,009,462 - 2,011,922 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 1,979,496 - 1,981,934 (+) NCBI T2T-CHM13v2.0
Ndufb10 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 24,941,034 - 24,943,397 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 24,941,034 - 24,943,452 (-) Ensembl GRCm39 Ensembl GRCm38 17 24,722,060 - 24,724,423 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 24,722,060 - 24,724,478 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 24,859,012 - 24,861,333 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 24,449,667 - 24,451,988 (-) NCBI MGSCv36 mm8 Celera 17 25,245,195 - 25,247,516 (-) NCBI Celera Cytogenetic Map 17 A3.3 NCBI cM Map 17 12.51 NCBI
Ndufb10 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955442 15,306,741 - 15,309,167 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955442 15,306,688 - 15,309,281 (-) NCBI ChiLan1.0 ChiLan1.0
NDUFB10 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 2,385,452 - 2,389,332 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 6,167,362 - 6,171,242 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 742,402 - 744,850 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 2,048,550 - 2,051,005 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 2,048,550 - 2,051,005 (+) Ensembl panpan1.1 panPan2
NDUFB10 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 38,968,737 - 38,971,214 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 38,968,742 - 38,971,196 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 40,208,429 - 40,210,907 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 39,285,757 - 39,288,235 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 39,282,767 - 39,288,119 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 38,962,532 - 38,965,010 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 38,934,840 - 38,937,318 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 39,413,727 - 39,416,205 (-) NCBI UU_Cfam_GSD_1.0
Ndufb10 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 104,633,467 - 104,635,982 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936694 2,073,354 - 2,076,043 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936694 2,073,481 - 2,075,989 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NDUFB10 (Sus scrofa - pig)
NDUFB10 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 1,856,476 - 1,859,336 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 1,856,157 - 1,862,529 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 29,217,128 - 29,219,978 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ndufb10 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 47 Count of miRNA genes: 46 Interacting mature miRNAs: 46 Transcripts: ENSRNOT00000019624 Prediction methods: Microtar, Rnahybrid Result types: miRGate_prediction
9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 634329 Pia15 Pristane induced arthritis QTL 15 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 1 24158324 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 737820 Alc9 Alcohol consumption QTL 9 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 19233348 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 631828 Alc5 Alcohol consumption QTL 5 2.4 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 10 5144027 17245662 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 631660 Hcar1 Hepatocarcinoma resistance QTL 1 3.4 0.0001 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 10 6154182 15990232 Rat 1576304 Schws7 Schwannoma susceptibility QTL 7 0.0115 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 4765527 19816042 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat
RH128247
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 14,253,891 - 14,254,198 (+) Marker Load Pipeline mRatBN7.2 10 13,749,359 - 13,749,666 (+) MAPPER mRatBN7.2 Rnor_6.0 10 14,090,215 - 14,090,521 NCBI Rnor6.0 Rnor_5.0 10 13,905,943 - 13,906,249 UniSTS Rnor5.0 RGSC_v3.4 10 13,977,394 - 13,977,700 UniSTS RGSC3.4 Celera 10 13,429,078 - 13,429,384 UniSTS RH 3.4 Map 10 191.3 UniSTS Cytogenetic Map 10 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019624 ⟹ ENSRNOP00000019624
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 13,749,275 - 13,751,442 (-) Ensembl Rnor_6.0 Ensembl 10 14,090,128 - 14,092,289 (-) Ensembl
RefSeq Acc Id:
NM_001109443 ⟹ NP_001102913
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 14,253,805 - 14,255,966 (-) NCBI mRatBN7.2 10 13,749,273 - 13,751,434 (-) NCBI Rnor_6.0 10 14,090,128 - 14,092,289 (-) NCBI Rnor_5.0 10 13,905,856 - 13,908,017 (-) NCBI RGSC_v3.4 10 13,977,307 - 13,979,468 (-) RGD Celera 10 13,428,991 - 13,431,152 (-) RGD
Sequence:
GCGCAGGCGTAGAGGTCCCGCGTCCTTAGCAGGCCGAGCCGACCCAGACACAGAACGAGTGGAAGGTCCGCAGGGGTTCGCTTAAACCATGCCGGACTCTTGGGACAAGGATGTGTACCCGGAGCCCC CGCGCCGCACGCCTGCTCCCTCGCCGCAGACCTCGATCCCTAACCCCATCACCTACTTGACGAAGGCCTACGACCTCGTCGTGGACTGGCCCGTGACCCTCGTGAGAGAGTTCATTGAACAACAGCAC GCCAAGAACCGAACCTACTACTACCACCGACAGTACCGTCGAGTGCCAGACATCACGGAATGCAAAGAGGGTGATGTCATCTGTATCTATGAGGCTGAGATGCAGTGGAGAAGGGACTTCAAAGTGGA CCAAGAAATCATCAACATCATCCAGGAGAGACTTAAGGCTTGTCAGCAGAGGGAAGGAGAGAGTGCACTGCAGAACTGTGCCAAGGAATTGGAGCAATTCACCCAAGTGTCTAAAGCCTACCAGGACC GCTACCAGGACCTGGGAGCCTACTATTCTGCCAGGAAGTGCCTGGCAAAGCAGAAGCAGAGGATGCTGGAAGAGAGAAAGGCTGCCAAGGAGACTGCTGCCGCCTAAGACACCAGACAAAGAACTCTT GTTCATCCACTGCTGAAATAAAATGACAGGCCTGGCCATCACC
hide sequence
RefSeq Acc Id:
NP_001102913 ⟸ NM_001109443
- UniProtKB:
A6HCX0 (UniProtKB/TrEMBL), D4A0T0 (UniProtKB/TrEMBL)
- Sequence:
MPDSWDKDVYPEPPRRTPAPSPQTSIPNPITYLTKAYDLVVDWPVTLVREFIEQQHAKNRTYYYHRQYRRVPDITECKEGDVICIYEAEMQWRRDFKVDQEIINIIQERLKACQQREGESALQNCAKE LEQFTQVSKAYQDRYQDLGAYYSARKCLAKQKQRMLEERKAAKETAAA
hide sequence
Ensembl Acc Id:
ENSRNOP00000019624 ⟸ ENSRNOT00000019624
RGD ID: 13697025
Promoter ID: EPDNEW_R7550
Type: initiation region
Name: Ndufb10_1
Description: NADH:ubiquinone oxidoreductase subunit B10
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 14,092,268 - 14,092,328 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-12
Ndufb10
NADH:ubiquinone oxidoreductase subunit B10
Ndufb10
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2009-06-15
Ndufb10
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10
LOC681867
similar to NADH-ubiquinone oxidoreductase PDSW subunit (Complex I-PDSW) (CI-PDSW)
Data merged from RGD:1590497
1643240
APPROVED
2008-12-12
Ndufb10
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10
LOC681418
similar to NADH-ubiquinone oxidoreductase PDSW subunit (Complex I-PDSW) (CI-PDSW)
Data merged from RGD:1595406
737654
APPROVED
2008-04-30
Ndufb10
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10
Ndufb10_predicted
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10 (predicted)
'predicted' is removed
2292626
APPROVED
2006-11-20
LOC681418
similar to NADH-ubiquinone oxidoreductase PDSW subunit (Complex I-PDSW) (CI-PDSW)
Symbol and Name status set to provisional
70820
PROVISIONAL
2006-11-20
LOC681867
similar to NADH-ubiquinone oxidoreductase PDSW subunit (Complex I-PDSW) (CI-PDSW)
Symbol and Name status set to provisional
70820
PROVISIONAL
2005-01-12
Ndufb10_predicted
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10 (predicted)
Symbol and Name status set to approved
70820
APPROVED