Advanced Search (OLGA)

Gene: B3gnt9 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

B3gnt9

Name:

UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9

RGD ID:

1310170

Description:

Predicted to enable UDP-glycosyltransferase activity. Predicted to be involved in poly-N-acetyllactosamine biosynthetic process and protein O-linked glycosylation. Predicted to be active in Golgi membrane. Orthologous to human B3GNT9 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9); INTERACTS WITH 6-propyl-2-thiouracil; acetamiprid; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC291958; RGD1310170; similar to beta-1,3-galactosyltransferase-related protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	50,039,649 - 50,042,206 (-)	NCBI		GRCr8
mRatBN7.2	19	33,129,740 - 33,134,048 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	33,128,142 - 33,132,344 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	39,944,667 - 39,947,224 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	40,598,575 - 40,601,132 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	42,888,235 - 42,890,792 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	37,208,061 - 37,212,400 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	37,208,825 - 37,210,412 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	48,073,878 - 48,077,216 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	35,067,447 - 35,068,901 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	35,072,327 - 35,073,782 (-)	NCBI
Celera	19	32,558,918 - 32,560,795 (-)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
B3gnt9	Rat	autosomal dominant dyskeratosis congenita 6		ISO	B3GNT9 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dyskeratosis congenita and autosomal dominant 6	ClinVar	PMID:28492532
B3gnt9	Rat	cataract 5 multiple types		ISO	B3GNT9 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cataract 5 multiple types	ClinVar	PMID:15959809 more ...
B3gnt9	Rat	Chromosome 16q12 Duplication Syndrome		ISO	B3GNT9 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 16q12 duplication syndrome	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
B3gnt9	Rat	rheumatoid arthritis		ISO	B3GNT9 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:17379860

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
B3gnt9	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	B3GNT9 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of B3GNT9 mRNA	CTD	PMID:28628672
B3gnt9	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	B3gnt9 (Mus musculus)	6480464	bisphenol S affects the methylation of B3GNT9 exon	CTD	PMID:33297965
B3gnt9	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	B3gnt9 (Mus musculus)	6480464	Fenretinide results in decreased expression of B3GNT9 mRNA	CTD	PMID:28973697
B3gnt9	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of B3GNT9 mRNA	CTD	PMID:24780913
B3gnt9	Rat	acetamiprid	increases expression	EXP		6480464	acetamiprid results in increased expression of B3GNT9 mRNA	CTD	PMID:27782041
B3gnt9	Rat	all-trans-retinoic acid	increases expression	ISO	B3GNT9 (Homo sapiens)	6480464	Tretinoin results in increased expression of B3GNT9 mRNA	CTD	PMID:23724009
B3gnt9	Rat	aristolochic acid A	decreases expression	ISO	B3GNT9 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of B3GNT9 mRNA	CTD	PMID:33212167
B3gnt9	Rat	benzo[a]pyrene	affects methylation	ISO	B3GNT9 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of B3GNT9 promoter	CTD	PMID:27901495
B3gnt9	Rat	benzo[a]pyrene	increases methylation	ISO	B3GNT9 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of B3GNT9 3' UTR	CTD	PMID:27901495
B3gnt9	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of B3GNT9 mRNA	CTD	PMID:25181051
B3gnt9	Rat	bisphenol A	increases expression	ISO	B3gnt9 (Mus musculus)	6480464	bisphenol A results in increased expression of B3GNT9 mRNA	CTD	PMID:32156529
B3gnt9	Rat	bisphenol A	multiple interactions	ISO	B3GNT9 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of B3GNT9 mRNA	CTD	PMID:28628672
B3gnt9	Rat	bisphenol F	decreases expression	ISO	B3gnt9 (Mus musculus)	6480464	bisphenol F results in decreased expression of B3GNT9 mRNA	CTD	PMID:38685157
B3gnt9	Rat	chloroprene	decreases expression	ISO	B3gnt9 (Mus musculus)	6480464	Chloroprene results in decreased expression of B3GNT9 mRNA	CTD	PMID:23125180
B3gnt9	Rat	clofibrate	multiple interactions	ISO	B3gnt9 (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of B3GNT9 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of B3GNT9 mRNA]	CTD	PMID:17585979
B3gnt9	Rat	copper(II) sulfate	decreases expression	ISO	B3GNT9 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of B3GNT9 mRNA	CTD	PMID:19549813
B3gnt9	Rat	cyclosporin A	decreases expression	ISO	B3GNT9 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of B3GNT9 mRNA	CTD	PMID:27989131
B3gnt9	Rat	DDE	decreases expression	ISO	B3GNT9 (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in decreased expression of B3GNT9 mRNA	CTD	PMID:38568856
B3gnt9	Rat	dexamethasone	decreases expression	ISO	B3gnt9 (Mus musculus)	6480464	Dexamethasone results in decreased expression of B3GNT9 mRNA	CTD	PMID:22733784
B3gnt9	Rat	dexamethasone	multiple interactions	ISO	B3GNT9 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of B3GNT9 mRNA	CTD	PMID:28628672
B3gnt9	Rat	doxorubicin	decreases expression	ISO	B3GNT9 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of B3GNT9 mRNA	CTD	PMID:29803840
B3gnt9	Rat	entinostat	increases expression	ISO	B3GNT9 (Homo sapiens)	6480464	entinostat results in increased expression of B3GNT9 mRNA	CTD	PMID:27188386
B3gnt9	Rat	folic acid	decreases expression	ISO	B3gnt9 (Mus musculus)	6480464	Folic Acid results in decreased expression of B3GNT9 mRNA	CTD	PMID:25629700
B3gnt9	Rat	indole-3-methanol	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of B3GNT9 mRNA and [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of B3GNT9 mRNA	CTD	PMID:22129741
B3gnt9	Rat	indometacin	multiple interactions	ISO	B3GNT9 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of B3GNT9 mRNA	CTD	PMID:28628672
B3gnt9	Rat	lead(0)	affects expression	ISO	B3GNT9 (Homo sapiens)	6480464	Lead affects the expression of B3GNT9 mRNA	CTD	PMID:28903495
B3gnt9	Rat	methotrexate	increases expression	ISO	B3GNT9 (Homo sapiens)	6480464	Methotrexate results in increased expression of B3GNT9 mRNA	CTD	PMID:17379860
B3gnt9	Rat	N-acetyl-L-cysteine	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of B3GNT9 mRNA	CTD	PMID:22129741
B3gnt9	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of B3GNT9 mRNA and [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of B3GNT9 mRNA	CTD	PMID:22129741
B3gnt9	Rat	niclosamide	increases expression	ISO	B3GNT9 (Homo sapiens)	6480464	Niclosamide results in increased expression of B3GNT9 mRNA	CTD	PMID:36318118
B3gnt9	Rat	orphenadrine	affects expression	EXP		6480464	Orphenadrine affects the expression of B3GNT9 mRNA	CTD	PMID:23665939
B3gnt9	Rat	paracetamol	multiple interactions	ISO	B3gnt9 (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of B3GNT9 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of B3GNT9 mRNA]	CTD	PMID:17585979
B3gnt9	Rat	paracetamol	decreases expression	ISO	B3GNT9 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of B3GNT9 mRNA	CTD	PMID:26690555
B3gnt9	Rat	pirinixic acid	multiple interactions	ISO	B3GNT9 (Homo sapiens)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of B3GNT9 mRNA	CTD	PMID:19710929
B3gnt9	Rat	sodium arsenite	decreases expression	ISO	B3gnt9 (Mus musculus)	6480464	sodium arsenite results in decreased expression of B3GNT9 mRNA	CTD	PMID:37682722
B3gnt9	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of B3GNT9 mRNA	CTD	PMID:23411599
B3gnt9	Rat	thiram	decreases expression	ISO	B3GNT9 (Homo sapiens)	6480464	Thiram results in decreased expression of B3GNT9 mRNA	CTD	PMID:38568856
B3gnt9	Rat	titanium dioxide	decreases methylation	ISO	B3gnt9 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of B3GNT9 gene	CTD	PMID:35295148
B3gnt9	Rat	triphenyl phosphate	affects expression	ISO	B3GNT9 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of B3GNT9 mRNA	CTD	PMID:37042841
B3gnt9	Rat	valproic acid	increases methylation	ISO	B3GNT9 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of B3GNT9 gene	CTD	PMID:29154799
B3gnt9	Rat	valproic acid	decreases expression	ISO	B3GNT9 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of B3GNT9 mRNA	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
B3gnt9	Rat	poly-N-acetyllactosamine biosynthetic process	involved_in	IBA	PANTHER:PTN008317874 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
B3gnt9	Rat	protein glycosylation	involved_in	IEA	InterPro:IPR002659	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
B3gnt9	Rat	protein O-linked glycosylation	involved_in	IBA	PANTHER:PTN000130250 and UniProtKB:Q8NCR0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
B3gnt9	Rat	Golgi apparatus	located_in	IEA	UniProtKB-KW:KW-0333	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
B3gnt9	Rat	Golgi membrane	located_in	IEA	UniProtKB-SubCell:SL-0134	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
B3gnt9	Rat	Golgi membrane	is_active_in	IBA	MGI:1349403 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
B3gnt9	Rat	membrane	located_in	IEA	InterPro:IPR002659	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
B3gnt9	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
B3gnt9	Rat	glycosyltransferase activity	enables	IEA	UniProtKB-KW:KW-0328	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
B3gnt9	Rat	hexosyltransferase activity	enables	IEA	InterPro:IPR002659	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
B3gnt9	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
B3gnt9	Rat	UDP-glycosyltransferase activity	enables	IBA	PANTHER:PTN002477218 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

B3gnt9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	50,039,649 - 50,042,206 (-)	NCBI		GRCr8
mRatBN7.2	19	33,129,740 - 33,134,048 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	33,128,142 - 33,132,344 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	39,944,667 - 39,947,224 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	40,598,575 - 40,601,132 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	42,888,235 - 42,890,792 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	37,208,061 - 37,212,400 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	37,208,825 - 37,210,412 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	48,073,878 - 48,077,216 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	35,067,447 - 35,068,901 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	35,072,327 - 35,073,782 (-)	NCBI
Celera	19	32,558,918 - 32,560,795 (-)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

B3GNT9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	67,148,104 - 67,150,998 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	67,148,104 - 67,150,998 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	67,182,007 - 67,184,901 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	65,739,506 - 65,742,403 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	51,690,248 - 51,693,145 (-)	NCBI		Celera
Cytogenetic Map	16	q22.1	NCBI
HuRef	16	53,055,522 - 53,058,419 (-)	NCBI		HuRef
CHM1_1	16	68,589,324 - 68,592,221 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	72,942,396 - 72,945,290 (-)	NCBI		T2T-CHM13v2.0

B3gnt9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	105,979,270 - 105,981,895 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	105,979,270 - 105,981,785 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	105,252,638 - 105,255,250 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	105,252,638 - 105,255,153 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	107,776,538 - 107,779,051 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	108,141,768 - 108,144,282 (-)	NCBI		MGSCv36	mm8
Celera	8	109,475,421 - 109,477,934 (-)	NCBI		Celera
Cytogenetic Map	8	D3	NCBI
cM Map	8	53.04	NCBI

B3gnt9
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955484	9,462,517 - 9,467,314 (+)	NCBI	ChiLan1.0	ChiLan1.0

B3GNT9
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	76,677,877 - 76,681,033 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	82,590,706 - 82,596,387 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	47,493,804 - 47,497,908 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	66,882,780 - 66,885,891 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	66,883,954 - 66,885,162 (-)	Ensembl	panpan1.1		panPan2

B3GNT9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	82,212,940 - 82,215,918 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	82,212,922 - 82,214,679 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	82,201,546 - 82,204,552 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	82,647,250 - 82,650,254 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	82,647,255 - 82,650,527 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	82,473,319 - 82,476,321 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	82,158,688 - 82,161,653 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	82,798,151 - 82,801,155 (+)	NCBI		UU_Cfam_GSD_1.0

B3gnt9
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	41,958,270 - 41,965,471 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	17,624,842 - 17,626,050 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	17,624,327 - 17,627,944 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

B3GNT9
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	27,792,134 - 27,795,361 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	27,791,387 - 27,797,458 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

B3GNT9
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	60,305,875 - 60,309,264 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	60,306,893 - 60,308,101 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	23,057,772 - 23,061,392 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

B3gnt9
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624746	19,165,895 - 19,170,539 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in B3gnt9
5 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	90
Count of miRNA genes:	79
Interacting mature miRNAs:	83
Transcripts:	ENSRNOT00000020349
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	15114598	34521833	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	24817978	39654489	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
1354633	Bw28	Body weight QTL 28	6.04		body mass (VT:0001259)	body weight (CMO:0000012)	19	27530207	37947399	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1354607	Gmadr1	Adrenal mass QTL 1	5.83		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	19	27530207	37947399	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
1354600	Salc2	Saline consumption QTL 2	9.91	0.001	drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	19	27530207	37947399	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001400948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006222795	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120484	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000083097 ⟹ ENSRNOP00000071937

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	33,128,142 - 33,132,344 (-)	Ensembl
Rnor_6.0 Ensembl	19	37,208,825 - 37,210,412 (-)	Ensembl

RefSeq Acc Id:

NM_001400948 ⟹ NP_001387877

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	50,039,649 - 50,042,206 (-)	NCBI
mRatBN7.2	19	33,129,740 - 33,132,297 (-)	NCBI

RefSeq Acc Id:

XM_008772557 ⟹ XP_008770779

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	50,039,649 - 50,042,186 (-)	NCBI
mRatBN7.2	19	33,129,740 - 33,134,048 (-)	NCBI
Rnor_6.0	19	37,208,061 - 37,212,400 (-)	NCBI

Sequence:

show sequence

TGCTAGGCAAGCGCTCTACCACTGAGCTAAATCCCCAACCCCCTGGGCTCTGTTTCTTAACCTCAAGTTAAACCTCTTCCTCCAGTTCTTTTGAGAGTTCACTTTTTGATCCTTTACTGCCTTCTACA
CAACACCCAAGCCCAGTTAGAAAGTACAGAGCAGCATGTTCAGTCCAAGGAAGTCAGATTCTAACTCACTGCTCCACCTCCTGACCCCATACACTACACTTGCACATCTGTGTGTGCATGTGTGCACA
CCTATCCCTGAAGTTCCCCCTTCAGGAGCTGTTTAGAGAGTCCAGAGTTTGGATTTTGCCCCTGCCCCCTTTTCTGAGATAATGTCTCATTTAGCTCAGGTTGGCATCAAGTTTCCTGTGAAACCAAG
AATGACCCTGAGCTTGTGATCCTCCTGAGTGCTAGGGTTACAGGTATGTACCACCATGCCTAGTTTATAGGATGCTGGGGCCTAAATTCAGGGCTTCTCACTTGCTAGGTCTGCCCTCTACCAACTGA
GTTACACCCCCAACCCCCAGCGTTCCAGAGTTTGGATTTTATAACTATGCCAGTGAGATGTCTTTGAAGGCATTTGGGATGGAAGCCTGAAACACGAGAAACAGAGAGGCCAAGGTAGTGACTACAGA
GACAGAAAAGGGCATGAATATCAACAGCAGTTGGGGAGGAAGAATGCAGCAGGACTGTGAGCCTGGCTGAGGACTGGGGTAAGGTGATAGATCAGGAGTTTATAACTGCCAGTGGGATGAAGGCCTGG
AGGAGGCCCTGATGGCTCTATTCACTGAGAATGAGTAACCTGCAGGACCTTCGGGTAAACCTGGAGTTCAGCTGTCTCTATAGTTCCGAGGAAACCAATCAAGATTGGAGCCAGGAATACTAGTGCAG
GCTTGTAATCCATCCCAATAGTTGCGGGCAGGTCATTAGTTGAGACTATCTATGCAGGGTGCATAGCATAGCCTGTCCTCAAAAACCTAAAAGACTAGTGGGAAGAGTGGGTGGTTTGGCCTGAATGA
CAAAGCAACTCAAAGAGGTAGGAAAACCAGGGGATTTGGAATACAGGGGAAAGCCTACCTTGGCTGAATGGGCCTTTCTAGAAGCCCTCAAACACCTATCCCTGATAGCCCAAACTATACTGCAGAGA
CAACAATATGGACATTTCTACCCTCAAGGATGCTATGTTGGGAAGCAGGAAACTCTGAACTGAATCTGGGCATGGAGAGACAGGAATGAAGTATTTGTCTCGGAAATTACTGTGAGCAGAGTGGTTCC
ATTTTCTGGGGGCAGTACTTTCTGGCTGTGTCATCCAGCAGCAAGTCACTTAACTACCTAAGTATTGGTCCTCTTTGGGTAGAGCTTCTGGCAAGTCTACAGGAAGAGAACTTGCTGTCTTGATTGTT
GGGGTGTGTATGCTTGTGTTTACTGGTGGCAAGCAGGGCAGAGTTCAGAGTAAGTAGACAGCGTTATGTCACTGGGGCAATCTGAGGCTACAGCTTGGTGAACCGGGGCTGCTGAAAGAGATGGCCCT
GGATAGTGGCCAAAAGAACTGAGAGTTAAAAGCGCTCAGGCCTAGGGGTTTGGAGCCCATTAGCCATACACTTCCTGAGCTTTAGAAACTCGGAATTCAGCACCCAATAAAAAAGACTAGGCTTTCCC
AGGGAAAGTCGCCCGTGAGAAAGTCTTTCAGGGATCAGTTCTCAGTCAGAGATGGCACTCCTTGCACCAGGGCGGAGTTGAGCTCCAGATGTCGGGGCGTACACATCTGGAGGATCACGTGGCACAGC
CTCAGTCCCCTTCCTGCCAACGCTGCATTTGGCTCAAGCCCGGGTCATGGCTGCCCTTGGGACCCTGAGCTGACAGTCGGAGTGTCCTGCGTTTCAGGGACTGTGACTCCACCCCCGCGGTCAAGCGT
GAGTTCTGGGGTCCCAAGGACCAAGGCTGCTGCGGTGGGGCAGGCCCAGAGGTCGACAGAGTGGATGAAGGAAGGATAGAGGACCCCGGGAAGGGCGGGGCTGGACATGAGGAGGAGGCCGCGCCTTT
GCCGGGATGCGTGGCTTACGCTGTTGCTCAGCGCCGCCCTCGGACTCCTGCTCTATGCGCAGCGCGACGGGGTATCCCCCACGACCAGAGCACCACCAGCGCGAGGACGACAGCTCCCGCGGCCTACT
CCTGGTCGCCGAGCACTGGAGCTCCCCAACACCGCCCACGCGGCCCCGCCAGCCTACGAAGGGGAGACCCCGGTGCCACCCACACCTACGGACCCCTTTGACTTCCGCAGGTATCTGCGCGCCAAGGA
CCAACGGCGCTTTCCGCTACTAATTAACCAGCCGCGCAAATGCCACAGCGACGGCGCATCTGGCGGCTCGCTCGACTTGCTCATCGCAGTCAAGTCTGTGGCCGCCGACTTCGAGCGGCGGGAAGCCG
TTCGCCAAACTTGGGGCGCCGAGGGTCGCGTGCAGGGGGCACTCGTGCGCCGAGTGTTCTTATTAGGCGTGCCTAAGGGGGCGGGCTCCGGCGGGGCAGGCACGCGGACGCACTGGCGCGCCCTACTG
GAAGCTGAGAGCCGAGCTTATGCAGACATCCTGCTCTGGGCTTTCGAAGACACCTTTTTCAATCTAACGCTCAAGGAGATTCACTTTCTATCTTGGGCCTCAGCATTCTGTCCGGATGTACACTTTGT
TTTTAAGGGCGATGCAGATGTGTTCGTGCACGTGAGGAACCTGCTGCAGTTTCTGGAGCCGCGGGATCCAGCCCAGGATCTTCTTGCAGGTGATGTGATTGTGCAGGCAAGGCCGATCCGAGCTAGAG
CCAGCAAGTACTTCATTCCCCAGGCTGTGTATGGACTGCCGGTTTACCCTGCCTACGCAGGTGGTGGTGGGTTTGTTCTTTCGGGAGCCACACTCCATCGCCTAGCTCATGCCTGCACGCAAGTTGAG
CTCTTTCCCATAGATGATGTCTTTCTGGGCATGTGTTTGCAGCGCTTGCGGCTCACACCTGAGCCTCATCCAGCATTTCGCACCTTTGGCATCTCCCAGCCTTCGGCTGCACCACATCTTCGAACCTT
CGACCCCTGTTTCTACCGAGAACTGGTGGTAGTGCACGGGCTATCTGCAGCTGACATTTGGCTTATGTGGCGCTTGCTGCATGGGCCTCAGGGGCCAGTCTGTGCACACCCACAGCCTGTGGCAACAG
GTCCCTTCCAATGGAATTCCTAGCTATCTCTCACGATATCAAACCTCTTACTCAGCTCCAGGACAGAACATGAAAAAGTCCAAAGGGGTTTTCTATGAGTTTATGGCTTTTCTTCAGATCACTCAATG
TGTAGTAGTGCTAAGCCAACGAGATAGCCAGGGCTAAGGTGGTGGTCTGTGGTTTGACCAGCACAGAAGCTGGCACACTTAAATATTAGTAGTCAAGAGCACCATTGTGTGTGCCAGCTGGGGCTCGG
CTTTTCAGGATGTTTAGGATGATAAAAACACAAGTTGATCTACCCATGGCCAAACCTCACAGCCATTTTCCTTTAGTTATTAGCTTCCTTCCTTCTCTACATTGGCTTCCCATTGGCTTTATCTTATC
TGTCCCCTTTGAGGTCTGGTGATAGAGCTAACTAACCCTTCAGGTCCAGGTTTGCCTGTAGCATGAGGGATGGGGCCATGATGTGTGTCATGTGATCCATCCCCTTCCCAGAAGAAATCCTAAGATTC
CTCCACTATAAAAATTCCCATATTCTTCAACCACAACGTCGAGGAAACCGACAGTTCACATTTTAGTACAAACACCCCAGCACATGGCAGCATATGGCAAGCTGTCAGTGAGGTGCTAATTTATTGGA
TCGGGATGAGGAAGTCTCCTCTGTTCAAGAGGATGGGGACAGTCCTGGCTACCCTGACAGTGAGATATGCAGGGTCTCTGGCCAGATGAAGGTCCAAATGGGAAGACACCTGTCAATCAGTCATGGGA
GTGCCACACAGGCCTGGCTGTAGGTACAGGAACCATACAGACAGCTGGGGCAGGTCCCCTGCACATTCATCATGAACTATACAAGATGAGGCTGTACATGAGTTAATTACAAAAGTCATTATTTACAA
AAATCTGTACACACATTTGAAAAACTCACAAAATTGTCATCTATGTATCACAAGTTGCTAGACCAAAATATTAAAAATGGGATAAAATTA

hide sequence


Protein RefSeqs	NP_001387877	(Get FASTA)	NCBI Sequence Viewer
	XP_008770779	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL92352	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071937
	ENSRNOP00000071937.1

RefSeq Acc Id:	XP_008770779 ⟸ XM_008772557
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2K1Q3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRRRPRLCRDAWLTLLLSAALGLLLYAQRDGVSPTTRAPPARGRQLPRPTPGRRALELPNTAHAAPPAYEGETPVPPTPTDPFDFRRYLRAKDQRRFPLLINQPRKCHSDGASGGSLDLLIAVKSVAA DFERREAVRQTWGAEGRVQGALVRRVFLLGVPKGAGSGGAGTRTHWRALLEAESRAYADILLWAFEDTFFNLTLKEIHFLSWASAFCPDVHFVFKGDADVFVHVRNLLQFLEPRDPAQDLLAGDVIVQ ARPIRARASKYFIPQAVYGLPVYPAYAGGGGFVLSGATLHRLAHACTQVELFPIDDVFLGMCLQRLRLTPEPHPAFRTFGISQPSAAPHLRTFDPCFYRELVVVHGLSAADIWLMWRLLHGPQGPVCA HPQPVATGPFQWNS hide sequence

Ensembl Acc Id:

ENSRNOP00000071937 ⟸ ENSRNOT00000083097

RefSeq Acc Id:	NP_001387877 ⟸ NM_001400948
- Peptide Label:	precursor
- UniProtKB:	A0A0G2K1Q3 (UniProtKB/TrEMBL)

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K1Q3-F1-model_v2	AlphaFold	A0A0G2K1Q3	1-398	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-5853	BioCyc
Ensembl Genes	ENSRNOG00000053895	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000083097	ENTREZGENE
	ENSRNOT00000083097.2	UniProtKB/TrEMBL
Gene3D-CATH	3.90.550.50	UniProtKB/TrEMBL
InterPro	Glyco_trans_31	UniProtKB/TrEMBL
NCBI Gene	291958	ENTREZGENE
PANTHER	Glyco_trans_31	UniProtKB/TrEMBL
	UDP-GLCNAC:BETAGAL BETA-1,3-N-ACETYLGLUCOSAMINYLTRANSFERASE 9	UniProtKB/TrEMBL
Pfam	Galactosyl_T	UniProtKB/TrEMBL
PhenoGen	B3gnt9	PhenoGen
RatGTEx	ENSRNOG00000053895	RatGTEx
UniProt	A0A0G2K1Q3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-09	B3gnt9	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9	RGD1310170	similar to beta-1,3-galactosyltransferase-related protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1310170	similar to beta-1,3-galactosyltransferase-related protein	RGD1310170_predicted	similar to beta-1,3-galactosyltransferase-related protein (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1310170_predicted	similar to beta-1,3-galactosyltransferase-related protein (predicted)	LOC291958_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC291958_predicted	similar to beta-1,3-galactosyltransferase-related protein (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD