Symbol:
Gbe1
Name:
1,4-alpha-glucan branching enzyme 1
RGD ID:
1309968
Description:
Enables 1,4-alpha-glucan branching enzyme activity and carbohydrate binding activity. Involved in glycogen biosynthetic process and negative regulation of neuron apoptotic process. Predicted to be active in cytosol. Human ortholog(s) of this gene implicated in glycogen storage disease IV and pulmonary tuberculosis. Orthologous to human GBE1 (1,4-alpha-glucan branching enzyme 1); PARTICIPATES IN glycogen biosynthetic pathway; congenital sucrase-isomaltase deficiency pathway; glycogen storage disease type III pathway; INTERACTS WITH 17beta-estradiol; 2,4-dinitrotoluene; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1,4-alpha-glucan-branching enzyme; glucan (1,4-alpha-), branching enzyme 1; LOC288333
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GBE1 (1,4-alpha-glucan branching enzyme 1) HGNC
Ensembl, HomoloGene, NCBI
Mus musculus (house mouse):
Gbe1 (1,4-alpha-glucan branching enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gbe1 (1,4-alpha-glucan branching enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GBE1 (1,4-alpha-glucan branching enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GBE1 (1,4-alpha-glucan branching enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101958945 (1,4-alpha-glucan-branching enzyme) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GBE1 (1,4-alpha-glucan branching enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GBE1 (1,4-alpha-glucan branching enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gbe1 (1,4-alpha-glucan branching enzyme 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
VGLL3 (vestigial like family member 3) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
GBE1 (1,4-alpha-glucan branching enzyme 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Gbe1 (1,4-alpha-glucan branching enzyme 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gbe1a (glucan (1,4-alpha-), branching enzyme 1a)
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gbe1b (glucan (1,4-alpha-), branching enzyme 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
AGBE
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
GLC3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
T04A8.7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gbe1
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 22,181,194 - 22,446,640 (+) NCBI GRCr8 mRatBN7.2 11 8,734,806 - 9,000,226 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 8,734,820 - 9,000,210 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 17,314,505 - 17,568,213 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 10,042,282 - 10,304,941 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 9,221,519 - 9,475,243 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 7,210,169 - 7,485,895 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 7,210,209 - 7,485,890 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 10,903,698 - 11,174,747 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 8,720,408 - 8,975,471 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 8,720,407 - 8,975,223 (+) NCBI Celera 11 8,665,430 - 8,924,865 (+) NCBI Celera Cytogenetic Map 11 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gbe1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO GBE1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of GBE1 mRNA CTD PMID:22079256 Gbe1 Rat (1->4)-beta-D-glucan multiple interactions ISO Gbe1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GBE1 mRNA CTD PMID:36331819 Gbe1 Rat 1,2-dichloroethane decreases expression ISO Gbe1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of GBE1 mRNA CTD PMID:28960355 Gbe1 Rat 1,2-dimethylhydrazine decreases expression ISO Gbe1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GBE1 mRNA CTD PMID:22206623 Gbe1 Rat 1,2-dimethylhydrazine multiple interactions ISO Gbe1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GBE1 mRNA CTD PMID:22206623 Gbe1 Rat 17beta-estradiol decreases expression ISO GBE1 (Homo sapiens) 6480464 Estradiol results in decreased expression of GBE1 mRNA CTD PMID:21632981 Gbe1 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of GBE1 mRNA CTD PMID:32145629 Gbe1 Rat 17beta-estradiol multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of GBE1 mRNA CTD PMID:20823114 Gbe1 Rat 17beta-estradiol decreases expression ISO Gbe1 (Mus musculus) 6480464 Estradiol results in decreased expression of GBE1 mRNA CTD PMID:19484750 and PMID:39298647 Gbe1 Rat 1H-pyrazole increases expression ISO Gbe1 (Mus musculus) 6480464 pyrazole results in increased expression of GBE1 mRNA CTD PMID:17945193 Gbe1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO GBE1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Gbe1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Gbe1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of GBE1 mRNA CTD PMID:16214954 Gbe1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gbe1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GBE1 mRNA CTD PMID:19770486 Gbe1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Gbe1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of GBE1 mRNA CTD PMID:19465110 Gbe1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of GBE1 mRNA CTD PMID:21346803 Gbe1 Rat 2,6-dimethoxyphenol multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 more ... CTD PMID:38598786 Gbe1 Rat 2-hydroxypropanoic acid decreases expression ISO GBE1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of GBE1 mRNA CTD PMID:30851411 Gbe1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of GBE1 protein CTD PMID:34915118 Gbe1 Rat 4,4'-diaminodiphenylmethane increases expression ISO Gbe1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of GBE1 mRNA CTD PMID:18648102 Gbe1 Rat 4,4'-sulfonyldiphenol increases expression ISO Gbe1 (Mus musculus) 6480464 bisphenol S results in increased expression of GBE1 mRNA CTD PMID:39298647 Gbe1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of GBE1 mRNA CTD PMID:19483382 Gbe1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of GBE1 mRNA CTD PMID:19483382 Gbe1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GBE1 mRNA CTD PMID:24780913 and PMID:30047161 Gbe1 Rat 7,12-dimethyltetraphene decreases expression ISO Gbe1 (Mus musculus) 6480464 9 more ... CTD PMID:32553695 Gbe1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of GBE1 mRNA CTD PMID:31881176 Gbe1 Rat acrolein multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of GBE1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of GBE1 mRNA CTD PMID:32699268 Gbe1 Rat actinomycin D multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of GBE1 protein CTD PMID:38460933 Gbe1 Rat afimoxifene increases expression ISO GBE1 (Homo sapiens) 6480464 afimoxifene results in increased expression of GBE1 mRNA CTD PMID:16849584 Gbe1 Rat aflatoxin B1 decreases expression ISO Gbe1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of GBE1 mRNA CTD PMID:19770486 Gbe1 Rat aflatoxin B1 decreases methylation ISO GBE1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of GBE1 gene CTD PMID:27153756 Gbe1 Rat Aflatoxin B2 alpha decreases methylation ISO GBE1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of GBE1 intron CTD PMID:30157460 Gbe1 Rat aflatoxin M1 decreases expression ISO GBE1 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of GBE1 mRNA CTD PMID:30928695 Gbe1 Rat all-trans-retinoic acid increases expression ISO GBE1 (Homo sapiens) 6480464 Tretinoin results in increased expression of GBE1 mRNA CTD PMID:33167477 Gbe1 Rat alpha-pinene multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of GBE1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of GBE1 mRNA CTD PMID:32699268 Gbe1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of GBE1 mRNA CTD PMID:19483382 Gbe1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of GBE1 mRNA CTD PMID:30047161 Gbe1 Rat aristolochic acid A decreases expression ISO GBE1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of GBE1 mRNA CTD PMID:33212167 Gbe1 Rat aristolochic acid A increases expression ISO GBE1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of GBE1 protein CTD PMID:33212167 Gbe1 Rat Aroclor 1254 decreases expression ISO Gbe1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of GBE1 mRNA CTD PMID:23650126 Gbe1 Rat arsane multiple interactions ISO GBE1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GBE1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GBE1 mRNA CTD PMID:39836092 Gbe1 Rat arsenic atom multiple interactions ISO GBE1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GBE1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GBE1 mRNA CTD PMID:39836092 Gbe1 Rat arsenous acid decreases expression ISO Gbe1 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of GBE1 mRNA CTD PMID:35676786 Gbe1 Rat belinostat decreases expression ISO GBE1 (Homo sapiens) 6480464 belinostat results in decreased expression of GBE1 mRNA CTD PMID:27188386 Gbe1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of GBE1 mRNA CTD PMID:19483382 Gbe1 Rat benzo[a]pyrene increases expression ISO GBE1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of GBE1 mRNA CTD PMID:22316170 Gbe1 Rat benzo[a]pyrene increases methylation ISO GBE1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GBE1 promoter CTD PMID:27901495 Gbe1 Rat benzo[a]pyrene decreases expression ISO Gbe1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GBE1 mRNA CTD PMID:23735875 Gbe1 Rat benzo[e]pyrene decreases methylation ISO GBE1 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of GBE1 intron CTD PMID:30157460 Gbe1 Rat beta-lapachone increases expression ISO GBE1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of GBE1 mRNA CTD PMID:38218311 Gbe1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GBE1 mRNA CTD PMID:25181051 and PMID:32145629 Gbe1 Rat bisphenol A increases expression ISO GBE1 (Homo sapiens) 6480464 bisphenol A results in increased expression of GBE1 protein CTD PMID:34186270 and PMID:37567409 Gbe1 Rat bisphenol A decreases expression ISO GBE1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of GBE1 protein CTD PMID:31675489 Gbe1 Rat bisphenol A decreases methylation ISO GBE1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of GBE1 gene CTD PMID:31601247 Gbe1 Rat bisphenol A affects expression ISO GBE1 (Homo sapiens) 6480464 bisphenol A affects the expression of GBE1 mRNA CTD PMID:30903817 Gbe1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of GBE1 gene CTD PMID:28505145 Gbe1 Rat bisphenol AF increases expression ISO GBE1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of GBE1 protein CTD PMID:34186270 Gbe1 Rat Bisphenol B increases expression ISO GBE1 (Homo sapiens) 6480464 bisphenol B results in increased expression of GBE1 protein CTD PMID:34186270 Gbe1 Rat bisphenol F increases expression ISO Gbe1 (Mus musculus) 6480464 bisphenol F results in increased expression of GBE1 mRNA CTD PMID:38685157 Gbe1 Rat bisphenol F increases expression ISO GBE1 (Homo sapiens) 6480464 bisphenol F results in increased expression of GBE1 protein CTD PMID:34186270 Gbe1 Rat bucladesine multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of GBE1 mRNA CTD PMID:20823114 Gbe1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of GBE1 mRNA CTD PMID:24136188 Gbe1 Rat butanal decreases expression ISO GBE1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of GBE1 mRNA CTD PMID:26079696 Gbe1 Rat cadmium atom multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of GBE1 mRNA CTD PMID:35301059 Gbe1 Rat cadmium dichloride increases expression ISO GBE1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of GBE1 mRNA CTD PMID:25596134 Gbe1 Rat cadmium dichloride multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of GBE1 mRNA CTD PMID:35301059 Gbe1 Rat cadmium sulfate increases expression ISO GBE1 (Homo sapiens) 6480464 cadmium sulfate results in increased expression of GBE1 mRNA CTD PMID:12064557 and PMID:14676411 Gbe1 Rat carbon nanotube decreases expression ISO Gbe1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Gbe1 Rat carbon nanotube increases expression ISO Gbe1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of GBE1 mRNA CTD PMID:25554681 Gbe1 Rat chloroacetaldehyde increases expression ISO GBE1 (Homo sapiens) 6480464 chloroacetaldehyde results in increased expression of GBE1 mRNA CTD PMID:25596134 Gbe1 Rat chloroprene increases expression ISO Gbe1 (Mus musculus) 6480464 Chloroprene results in increased expression of GBE1 mRNA CTD PMID:23125180 Gbe1 Rat choline affects expression ISO GBE1 (Homo sapiens) 6480464 Choline affects the expression of GBE1 mRNA CTD PMID:17616785 Gbe1 Rat cidofovir anhydrous increases expression ISO GBE1 (Homo sapiens) 6480464 Cidofovir results in increased expression of GBE1 mRNA CTD PMID:25596134 Gbe1 Rat cisplatin multiple interactions ISO Gbe1 (Mus musculus) 6480464 [Cisplatin co-treated with RELB mutant form co-treated with TNF protein] results in decreased expression of GBE1 mRNA CTD PMID:23625948 Gbe1 Rat cisplatin increases expression ISO GBE1 (Homo sapiens) 6480464 Cisplatin results in increased expression of GBE1 mRNA CTD PMID:25596134 and PMID:27392435 Gbe1 Rat cisplatin decreases expression ISO GBE1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of GBE1 mRNA CTD PMID:27594783 Gbe1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of GBE1 mRNA CTD PMID:19483382 Gbe1 Rat cobalt atom multiple interactions ISO GBE1 (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in increased expression of GBE1 mRNA CTD PMID:18078969 Gbe1 Rat cobalt dichloride multiple interactions ISO GBE1 (Homo sapiens) 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of GBE1 mRNA] CTD PMID:22202117 Gbe1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of GBE1 mRNA CTD PMID:24386269 Gbe1 Rat cobalt dichloride increases expression ISO GBE1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of GBE1 mRNA CTD PMID:15094311 more ... Gbe1 Rat cobalt dichloride increases expression ISO Gbe1 (Mus musculus) 6480464 cobaltous chloride results in increased expression of GBE1 mRNA CTD PMID:15094311 Gbe1 Rat copper atom multiple interactions ISO GBE1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of GBE1 mRNA CTD PMID:20971185 Gbe1 Rat copper(0) multiple interactions ISO GBE1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of GBE1 mRNA CTD PMID:20971185 Gbe1 Rat copper(II) sulfate increases expression ISO GBE1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of GBE1 mRNA CTD PMID:19549813 Gbe1 Rat cyclosporin A decreases expression ISO Gbe1 (Mus musculus) 6480464 Cyclosporine results in decreased expression of GBE1 mRNA CTD PMID:19770486 Gbe1 Rat cyclosporin A increases expression ISO GBE1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of GBE1 mRNA CTD PMID:20106945 and PMID:25596134 Gbe1 Rat cyclosporin A decreases expression ISO GBE1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GBE1 mRNA CTD PMID:25562108 Gbe1 Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of GBE1 mRNA CTD PMID:25596134 Gbe1 Rat DDE decreases expression ISO GBE1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of GBE1 mRNA CTD PMID:38568856 Gbe1 Rat decabromodiphenyl ether decreases expression ISO GBE1 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of GBE1 protein CTD PMID:31675489 Gbe1 Rat desferrioxamine B increases expression ISO GBE1 (Homo sapiens) 6480464 Deferoxamine results in increased expression of GBE1 mRNA CTD PMID:15094311 Gbe1 Rat desferrioxamine B increases expression ISO Gbe1 (Mus musculus) 6480464 Deferoxamine results in increased expression of GBE1 mRNA CTD PMID:15094311 Gbe1 Rat dexamethasone increases expression ISO GBE1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of GBE1 mRNA CTD PMID:25047013 Gbe1 Rat diarsenic trioxide decreases expression ISO Gbe1 (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of GBE1 mRNA CTD PMID:35676786 Gbe1 Rat Dibutyl phosphate affects expression ISO GBE1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GBE1 mRNA CTD PMID:37042841 Gbe1 Rat dichloroacetic acid increases expression ISO Gbe1 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of GBE1 mRNA CTD PMID:28962523 Gbe1 Rat dicrotophos decreases expression ISO GBE1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of GBE1 mRNA CTD PMID:28302478 Gbe1 Rat dioxygen increases expression ISO Gbe1 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of GBE1 mRNA CTD PMID:20880076 Gbe1 Rat dioxygen increases expression ISO GBE1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of GBE1 mRNA CTD PMID:15094311 more ... Gbe1 Rat dorsomorphin multiple interactions ISO GBE1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GBE1 mRNA CTD PMID:27188386 Gbe1 Rat doxorubicin increases expression ISO GBE1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of GBE1 mRNA CTD PMID:29803840 Gbe1 Rat entinostat decreases expression ISO GBE1 (Homo sapiens) 6480464 entinostat results in decreased expression of GBE1 mRNA CTD PMID:27188386 Gbe1 Rat ethanol multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Ethanol co-treated with Folic Acid] results in increased expression of GBE1 mRNA CTD PMID:23378141 Gbe1 Rat ethylparaben increases expression ISO GBE1 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of GBE1 mRNA CTD PMID:37690743 Gbe1 Rat fenofibrate increases expression ISO GBE1 (Homo sapiens) 6480464 Fenofibrate results in increased expression of GBE1 mRNA CTD PMID:25596134 Gbe1 Rat fenofibrate decreases expression EXP 6480464 Fenofibrate results in decreased expression of GBE1 mRNA CTD PMID:25596134 Gbe1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of GBE1 mRNA CTD PMID:24136188 Gbe1 Rat folic acid multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Ethanol co-treated with Folic Acid] results in increased expression of GBE1 mRNA CTD PMID:23378141 Gbe1 Rat folic acid multiple interactions ISO Gbe1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GBE1 mRNA CTD PMID:22206623 Gbe1 Rat furfural multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of GBE1 protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of GBE1 protein CTD PMID:38598786 Gbe1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of GBE1 mRNA CTD PMID:24136188 Gbe1 Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of GBE1 gene CTD PMID:35440735 Gbe1 Rat ibuprofen increases expression ISO GBE1 (Homo sapiens) 6480464 Ibuprofen results in increased expression of GBE1 mRNA CTD PMID:25596134 Gbe1 Rat inulin multiple interactions ISO Gbe1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of GBE1 mRNA CTD PMID:36331819 Gbe1 Rat isotretinoin decreases expression ISO GBE1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of GBE1 mRNA CTD PMID:20436886 Gbe1 Rat ivermectin decreases expression ISO GBE1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of GBE1 protein CTD PMID:32959892 Gbe1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of GBE1 mRNA CTD PMID:19483382 Gbe1 Rat manganese atom multiple interactions ISO GBE1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GBE1 mRNA CTD PMID:39836092 Gbe1 Rat manganese(0) multiple interactions ISO GBE1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GBE1 mRNA CTD PMID:39836092 Gbe1 Rat manganese(II) chloride increases methylation ISO GBE1 (Homo sapiens) 6480464 manganese chloride results in increased methylation of GBE1 gene CTD PMID:27913844 Gbe1 Rat manganese(II) chloride multiple interactions ISO GBE1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GBE1 mRNA CTD PMID:39836092 Gbe1 Rat manganese(II) chloride decreases expression ISO GBE1 (Homo sapiens) 6480464 manganese chloride results in decreased expression of GBE1 mRNA CTD PMID:27913844 Gbe1 Rat medroxyprogesterone acetate multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of GBE1 mRNA CTD PMID:20823114 Gbe1 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of GBE1 mRNA CTD PMID:25596134 Gbe1 Rat methapyrilene decreases methylation ISO GBE1 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of GBE1 intron CTD PMID:30157460 Gbe1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of GBE1 mRNA CTD PMID:30467583 Gbe1 Rat methidathion decreases expression ISO Gbe1 (Mus musculus) 6480464 methidathion results in decreased expression of GBE1 mRNA CTD PMID:34813904 Gbe1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of GBE1 mRNA CTD PMID:30047161 Gbe1 Rat monosodium L-glutamate multiple interactions ISO Gbe1 (Mus musculus) 6480464 [Sodium Glutamate co-treated with Trans Fatty Acids] results in increased expression of GBE1 mRNA CTD PMID:19001666 Gbe1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of GBE1 gene CTD PMID:33148267 Gbe1 Rat N-methyl-4-phenylpyridinium decreases expression ISO GBE1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of GBE1 mRNA CTD PMID:24810058 Gbe1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of GBE1 mRNA CTD PMID:22110744 Gbe1 Rat nickel dichloride increases expression ISO GBE1 (Homo sapiens) 6480464 nickel chloride results in increased expression of GBE1 mRNA CTD PMID:15094311 Gbe1 Rat nickel dichloride increases expression ISO Gbe1 (Mus musculus) 6480464 nickel chloride results in increased expression of GBE1 mRNA CTD PMID:15094311 Gbe1 Rat nickel dichloride multiple interactions ISO Gbe1 (Mus musculus) 6480464 HIF1A protein affects the reaction [nickel chloride results in increased expression of GBE1 mRNA] CTD PMID:15094311 Gbe1 Rat Nutlin-3 multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of GBE1 protein CTD PMID:38460933 Gbe1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of GBE1 mRNA CTD PMID:19483382 Gbe1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of GBE1 mRNA CTD PMID:25729387 Gbe1 Rat ozone multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of GBE1 mRNA more ... CTD PMID:32699268 Gbe1 Rat paracetamol affects expression ISO Gbe1 (Mus musculus) 6480464 Acetaminophen affects the expression of GBE1 mRNA CTD PMID:17562736 Gbe1 Rat pentachlorophenol increases expression ISO Gbe1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of GBE1 mRNA CTD PMID:23892564 Gbe1 Rat pentanal decreases expression ISO GBE1 (Homo sapiens) 6480464 pentanal results in decreased expression of GBE1 mRNA CTD PMID:26079696 Gbe1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Gbe1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GBE1 mRNA more ... CTD PMID:36331819 Gbe1 Rat perfluorooctanoic acid decreases expression ISO GBE1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of GBE1 mRNA CTD PMID:36326898 Gbe1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of GBE1 gene CTD PMID:33148267 Gbe1 Rat phenformin decreases expression EXP 6480464 Phenformin results in decreased expression of GBE1 mRNA CTD PMID:31324951 Gbe1 Rat phenobarbital increases expression ISO Gbe1 (Mus musculus) 6480464 Phenobarbital results in increased expression of GBE1 mRNA CTD PMID:19270015 and PMID:19482888 Gbe1 Rat phenobarbital affects expression ISO Gbe1 (Mus musculus) 6480464 Phenobarbital affects the expression of GBE1 mRNA CTD PMID:23091169 Gbe1 Rat phenobarbital affects expression ISO GBE1 (Homo sapiens) 6480464 Phenobarbital affects the expression of GBE1 mRNA CTD PMID:19159669 Gbe1 Rat phenobarbital multiple interactions ISO Gbe1 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of GBE1 mRNA] CTD PMID:19482888 Gbe1 Rat phenylmercury acetate increases expression ISO GBE1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of GBE1 mRNA CTD PMID:26272509 Gbe1 Rat phenylmercury acetate multiple interactions ISO GBE1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GBE1 mRNA CTD PMID:27188386 Gbe1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of GBE1 mRNA CTD PMID:19483382 Gbe1 Rat pirinixic acid increases expression ISO Gbe1 (Mus musculus) 6480464 pirinixic acid results in increased expression of GBE1 mRNA CTD PMID:17426115 Gbe1 Rat potassium chromate decreases expression ISO GBE1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of GBE1 mRNA CTD PMID:22079256 Gbe1 Rat potassium chromate multiple interactions ISO GBE1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of GBE1 mRNA CTD PMID:22079256 Gbe1 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of GBE1 mRNA CTD PMID:30047161 Gbe1 Rat propiconazole increases expression ISO Gbe1 (Mus musculus) 6480464 propiconazole results in increased expression of GBE1 mRNA CTD PMID:21278054 Gbe1 Rat quercetin increases expression ISO GBE1 (Homo sapiens) 6480464 Quercetin results in increased expression of GBE1 mRNA CTD PMID:19729006 Gbe1 Rat rac-lactic acid decreases expression ISO GBE1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of GBE1 mRNA CTD PMID:30851411 Gbe1 Rat resveratrol multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of GBE1 mRNA CTD PMID:23557933 Gbe1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of GBE1 mRNA CTD PMID:28374803 Gbe1 Rat SB 431542 multiple interactions ISO GBE1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GBE1 mRNA CTD PMID:27188386 Gbe1 Rat silver atom increases expression ISO Gbe1 (Mus musculus) 6480464 Silver results in increased expression of GBE1 mRNA CTD PMID:27131904 Gbe1 Rat silver(0) increases expression ISO Gbe1 (Mus musculus) 6480464 Silver results in increased expression of GBE1 mRNA CTD PMID:27131904 Gbe1 Rat sodium arsenite increases expression ISO Gbe1 (Mus musculus) 6480464 sodium arsenite results in increased expression of GBE1 protein CTD PMID:29044176 Gbe1 Rat sodium arsenite multiple interactions ISO GBE1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GBE1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GBE1 mRNA CTD PMID:39836092 Gbe1 Rat sodium arsenite increases expression ISO GBE1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of GBE1 mRNA CTD PMID:38568856 Gbe1 Rat sodium chloride multiple interactions ISO GBE1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of GBE1 protein more ... CTD PMID:38598786 Gbe1 Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of GBE1 mRNA CTD PMID:22110744 Gbe1 Rat T-2 toxin decreases expression ISO GBE1 (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of GBE mRNA CTD PMID:34581912 Gbe1 Rat tetrachloromethane affects expression ISO Gbe1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of GBE1 mRNA CTD PMID:17484886 Gbe1 Rat tetrachloromethane increases expression ISO Gbe1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of GBE1 mRNA CTD PMID:31919559 Gbe1 Rat tetraphene decreases expression ISO Gbe1 (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of GBE1 mRNA CTD PMID:26377693 Gbe1 Rat thimerosal decreases expression ISO GBE1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of GBE1 mRNA CTD PMID:27188386 Gbe1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of GBE1 mRNA CTD PMID:19483382 Gbe1 Rat thiram increases expression ISO GBE1 (Homo sapiens) 6480464 Thiram results in increased expression of GBE1 mRNA CTD PMID:38568856 Gbe1 Rat titanium dioxide decreases expression ISO Gbe1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of GBE1 mRNA CTD PMID:23557971 Gbe1 Rat titanium dioxide decreases methylation ISO Gbe1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GBE1 gene CTD PMID:35295148 Gbe1 Rat titanium dioxide increases methylation ISO Gbe1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of GBE1 promoter CTD PMID:35295148 Gbe1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of GBE1 mRNA CTD PMID:25729387 Gbe1 Rat triadimefon decreases expression EXP 6480464 triadimefon results in decreased expression of GBE1 mRNA CTD PMID:30047161 Gbe1 Rat trichloroethene increases expression ISO Gbe1 (Mus musculus) 6480464 Trichloroethylene results in increased expression of GBE1 mRNA CTD PMID:19448997 Gbe1 Rat triphenyl phosphate affects expression ISO GBE1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GBE1 mRNA CTD PMID:37042841 Gbe1 Rat Triptolide decreases expression ISO Gbe1 (Mus musculus) 6480464 triptolide results in decreased expression of GBE1 mRNA CTD PMID:32835833 Gbe1 Rat Tungsten carbide multiple interactions ISO GBE1 (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in increased expression of GBE1 mRNA CTD PMID:18078969 Gbe1 Rat valproic acid affects expression ISO GBE1 (Homo sapiens) 6480464 Valproic Acid affects the expression of GBE1 mRNA CTD PMID:25979313 Gbe1 Rat valproic acid decreases expression ISO GBE1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GBE1 mRNA CTD PMID:23179753 and PMID:27188386 Gbe1 Rat vorinostat decreases expression ISO GBE1 (Homo sapiens) 6480464 vorinostat results in decreased expression of GBE1 mRNA CTD PMID:27188386 Gbe1 Rat zinc dichloride multiple interactions ISO GBE1 (Homo sapiens) 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of GBE1 mRNA] CTD PMID:22202117
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
autosomal recessive cutis laxa type IB (ISO) Familial Cirrhosis with Deposition of Abnormal Glycogen (ISO) fetal akinesia deformation sequence syndrome 1 (ISO) genetic disease (ISO) glycogen storage disease (ISO) glycogen storage disease IV (ISO,ISS) GSD IV, Classic Hepatic (ISO) GSD IV, combined hepatic and myopathic (ISO) GSD IV, Neuromuscular Form, Childhood (ISO) GSD IV, Neuromuscular Form, Congenital (ISO) GSD IV, Neuromuscular Form, Fatal Perinatal (ISO) osteogenesis imperfecta type 15 (ISO) Polyglucosan Body Disease, Adult Form (ISO) polyneuropathy (ISO) pulmonary tuberculosis (ISO)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acetamide (EXP) acrolein (ISO) actinomycin D (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aflatoxin M1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amiodarone (EXP) amitrole (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) belinostat (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bucladesine (ISO) buspirone (EXP) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cadmium sulfate (ISO) carbon nanotube (ISO) chloroacetaldehyde (ISO) chloroprene (ISO) choline (ISO) cidofovir anhydrous (ISO) cisplatin (ISO) clofibrate (EXP) cobalt atom (ISO) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cyclosporin A (EXP,ISO) DDE (ISO) decabromodiphenyl ether (ISO) desferrioxamine B (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dichloroacetic acid (ISO) dicrotophos (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) ethylparaben (ISO) fenofibrate (EXP,ISO) flutamide (EXP) folic acid (ISO) furfural (ISO) glafenine (EXP) glyphosate (EXP) ibuprofen (ISO) inulin (ISO) isotretinoin (ISO) ivermectin (ISO) L-ethionine (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) medroxyprogesterone acetate (ISO) metformin (EXP) methapyrilene (EXP,ISO) methidathion (ISO) methimazole (EXP) monosodium L-glutamate (ISO) N,N-diethyl-m-toluamide (EXP) N-methyl-4-phenylpyridinium (ISO) nickel dichloride (EXP,ISO) Nutlin-3 (ISO) omeprazole (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) pentachlorophenol (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) permethrin (EXP) phenformin (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP,ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP) T-2 toxin (ISO) tetrachloromethane (ISO) tetraphene (ISO) thimerosal (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) triadimefon (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) Triptolide (ISO) Tungsten carbide (ISO) valproic acid (ISO) vorinostat (ISO) zinc dichloride (ISO)
1.
Hepatic and neuromuscular forms of glycogen storage disease type IV caused by mutations in the same glycogen-branching enzyme gene.
Bao Y, etal., J Clin Invest. 1996 Feb 15;97(4):941-8.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Risk prediction of pulmonary tuberculosis using genetic and conventional risk factors in adult Korean population.
Hong EP, etal., PLoS One. 2017 Mar 29;12(3):e0174642. doi: 10.1371/journal.pone.0174642. eCollection 2017.
5.
Polyglucosan neurotoxicity caused by glycogen branching enzyme deficiency can be reversed by inhibition of glycogen synthase.
Kakhlon O, etal., J Neurochem. 2013 Oct;127(1):101-13. doi: 10.1111/jnc.12277. Epub 2013 May 9.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Single fiber analyses of glycogen-related proteins reveal their differential association with glycogen in rat skeletal muscle.
Murphy RM, etal., Am J Physiol Cell Physiol. 2012 Dec 1;303(11):C1146-55. doi: 10.1152/ajpcell.00252.2012. Epub 2012 Sep 26.
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
11.
Novel pathogenic variants in GBE1 causing fetal akinesia deformation sequence and severe neuromuscular form of glycogen storage disease type IV.
Radhakrishnan P, etal., Clin Dysmorphol. 2019 Jan;28(1):17-21. doi: 10.1097/MCD.0000000000000248.
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Comprehensive gene review and curation
RGD comprehensive gene curation
16.
Glycogen-binding protein components of rat tissues.
Satoh K and Sato K, Biochem Biophys Res Commun. 1980 Sep 16;96(1):28-33.
Gbe1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 22,181,194 - 22,446,640 (+) NCBI GRCr8 mRatBN7.2 11 8,734,806 - 9,000,226 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 8,734,820 - 9,000,210 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 17,314,505 - 17,568,213 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 10,042,282 - 10,304,941 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 9,221,519 - 9,475,243 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 7,210,169 - 7,485,895 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 7,210,209 - 7,485,890 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 10,903,698 - 11,174,747 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 8,720,408 - 8,975,471 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 8,720,407 - 8,975,223 (+) NCBI Celera 11 8,665,430 - 8,924,865 (+) NCBI Celera Cytogenetic Map 11 p11 NCBI
GBE1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 81,489,703 - 81,761,645 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 81,489,703 - 81,761,645 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 81,538,854 - 81,810,796 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 81,621,541 - 81,893,640 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 81,621,547 - 81,893,435 NCBI Celera 3 82,281,720 - 82,553,857 (-) NCBI Celera Cytogenetic Map 3 p12.2 NCBI HuRef 3 81,557,582 - 81,828,544 (-) NCBI HuRef CHM1_1 3 81,490,987 - 81,762,964 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 81,543,135 - 81,815,065 (-) NCBI T2T-CHM13v2.0
Gbe1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 70,110,837 - 70,366,608 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 70,110,837 - 70,366,604 (+) Ensembl GRCm39 Ensembl GRCm38 16 70,313,949 - 70,569,720 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 70,313,949 - 70,569,716 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 70,314,332 - 70,569,961 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 70,196,767 - 70,452,396 (+) NCBI MGSCv36 mm8 Celera 16 70,562,114 - 70,812,345 (+) NCBI Celera Cytogenetic Map 16 C2 NCBI cM Map 16 40.19 NCBI
Gbe1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955407 10,692,303 - 10,963,489 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955407 10,692,082 - 10,959,236 (+) NCBI ChiLan1.0 ChiLan1.0
GBE1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 81,606,232 - 81,883,060 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 81,611,018 - 81,887,850 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 81,587,604 - 81,861,214 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 83,632,214 - 83,904,546 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 83,632,215 - 83,904,546 (-) Ensembl panpan1.1 panPan2
GBE1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 31 5,742,744 - 6,010,881 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 31 5,742,744 - 6,093,612 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 31 5,809,115 - 6,081,275 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 31 5,750,707 - 6,019,215 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 31 5,750,707 - 6,055,820 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 31 5,717,055 - 5,986,758 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 31 5,767,815 - 6,037,553 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 31 6,156,072 - 6,424,439 (+) NCBI UU_Cfam_GSD_1.0
LOC101958945 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404971 7,182,545 - 7,322,307 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936505 1,974,264 - 2,241,427 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936505 2,077,206 - 2,242,079 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GBE1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 173,634,454 - 173,914,756 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 173,634,401 - 173,909,646 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 184,012,385 - 184,127,125 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GBE1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 95,228,926 - 95,503,798 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 95,229,133 - 95,504,840 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 71,375,169 - 71,641,554 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gbe1
.
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 1598842 Glom10 Glomerulus QTL 10 3.4 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 1 35331169 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 634341 Bw121 Body weight QTL 121 3.56 abdominal fat pad mass (VT:1000711) abdominal fat pad weight (CMO:0000088) 11 1 21836709 Rat 1641927 Alcrsp10 Alcohol response QTL 10 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 11 8436674 53436674 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000075964 ⟹ ENSRNOP00000067909
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 11 7,422,272 - 7,485,890 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076695 ⟹ ENSRNOP00000068309
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 8,734,918 - 8,974,767 (+) Ensembl Rnor_6.0 Ensembl 11 7,210,209 - 7,413,999 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000084765 ⟹ ENSRNOP00000068640
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 8,734,820 - 9,000,210 (+) Ensembl Rnor_6.0 Ensembl 11 7,265,828 - 7,485,211 (+) Ensembl
RefSeq Acc Id:
NM_001100502 ⟹ NP_001093972
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 22,181,276 - 22,446,640 (+) NCBI mRatBN7.2 11 8,734,862 - 9,000,226 (+) NCBI Rnor_6.0 11 7,210,169 - 7,485,895 (+) NCBI Rnor_5.0 11 10,903,698 - 11,174,747 (+) NCBI RGSC_v3.4 11 8,720,408 - 8,975,471 (+) RGD Celera 11 8,665,430 - 8,924,865 (+) RGD
Sequence:
CGCTCTGCGGCTATAAAGGGCAAGTCCCCAGCGGCTCGCCTAGGCTCGCCCGGCTCCGCCCTGCCGCTCGCACACCACACGGGCCACTCGACCTTCTCGGGCCTCGGCTACTTGGGCGGCGGCGAAGA
hide sequence
RefSeq Acc Id:
XM_039088228 ⟹ XP_038944156
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 22,240,702 - 22,446,640 (+) NCBI mRatBN7.2 11 8,795,451 - 9,000,221 (+) NCBI
RefSeq Acc Id:
XM_039088229 ⟹ XP_038944157
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 22,181,194 - 22,394,649 (+) NCBI mRatBN7.2 11 8,734,806 - 8,948,238 (+) NCBI
RefSeq Acc Id:
XM_063270436 ⟹ XP_063126506
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 22,240,702 - 22,394,649 (+) NCBI
RefSeq Acc Id:
NP_001093972 ⟸ NM_001100502
- UniProtKB:
A6K4X8 (UniProtKB/TrEMBL), A6K4X9 (UniProtKB/TrEMBL)
- Sequence:
MAAPAAPAAEEKGSEAQLKAALADVPELGRLLEIDPYLKPYAADFQRRYKKFNQVLHDIGENEGGIDKFSRGYESFGIHRCSDGGIYCKEWAPGAEGVFLTGEFSGWNPFSHPYKKLEYGKWELYIPP
hide sequence
Ensembl Acc Id:
ENSRNOP00000068640 ⟸ ENSRNOT00000084765
Ensembl Acc Id:
ENSRNOP00000067909 ⟸ ENSRNOT00000075964
Ensembl Acc Id:
ENSRNOP00000068309 ⟸ ENSRNOT00000076695
RefSeq Acc Id:
XP_038944157 ⟸ XM_039088229
- Peptide Label:
isoform X2
- UniProtKB:
A6K4X9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038944156 ⟸ XM_039088228
- Peptide Label:
isoform X1
- UniProtKB:
Q5EB55 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063126506 ⟸ XM_063270436
- Peptide Label:
isoform X3
RGD ID: 13698003 Promoter ID: EPDNEW_R8526 Type: multiple initiation site Name: Gbe1_1 Description: 1,4-alpha-glucan-branching enzyme SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 11 7,210,210 - 7,210,270 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-18
Gbe1
1,4-alpha-glucan branching enzyme 1
Gbe1
glucan (1,4-alpha-), branching enzyme 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Gbe1
glucan (1,4-alpha-), branching enzyme 1
Gbe1_predicted
glucan (1,4-alpha-), branching enzyme 1 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Gbe1_predicted
glucan (1,4-alpha-), branching enzyme 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
