Advanced Search (OLGA)

Gene: Memo1 (mediator of cell motility 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Memo1

Name:

mediator of cell motility 1

RGD ID:

1309929

Description:

Predicted to be involved in regulation of microtubule-based process. Orthologous to human MEMO1 (mediator of cell motility 1); INTERACTS WITH sodium chloride; 4,4'-sulfonyldiphenol (ortholog); cadmium atom (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC298787; mediator of ErbB2-driven cell motility 1; memo-1; MGC116222; protein memo; RGD1309929; similar to RIKEN cDNA 0610016J10 gene

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MEMO1 (mediator of cell motility 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Memo1 (mediator of cell motility 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Memo1 (mediator of cell motility 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MEMO1 (mediator of cell motility 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MEMO1 (mediator of cell motility 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Memo1 (mediator of cell motility 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MEMO1 (mediator of cell motility 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MEMO1 (mediator of cell motility 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Memo1 (mediator of cell motility 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MEMO1 (mediator of cell motility 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Memo1 (mediator of cell motility 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	memo1 (mediator of cell motility 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MHO1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8031	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	memo-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	memo1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	26,895,497 - 26,986,248 (+)	NCBI		GRCr8
mRatBN7.2	6	21,144,525 - 21,234,363 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	21,125,639 - 21,234,561 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	21,475,758 - 21,564,825 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	21,791,599 - 21,880,664 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	21,272,051 - 21,361,118 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	22,362,483 - 22,409,583 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	22,362,484 - 22,409,579 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	32,248,023 - 32,295,278 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	21,149,520 - 21,197,328 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	21,152,474 - 21,200,281 (+)	NCBI
Celera	6	20,744,198 - 20,791,297 (+)	NCBI		Celera
Cytogenetic Map	6	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Memo1	Rat	Autoinflammation with Infantile Enterocolitis		ISO	RGD:1320537	8554872	ClinVar Annotator: match by term: Autoinflammation with infantile enterocolitis	ClinVar	PMID:28492532
Memo1	Rat	familial cold autoinflammatory syndrome 4		ISO	RGD:1320537	8554872	ClinVar Annotator: match by term: Familial cold autoinflammatory syndrome 4	ClinVar	PMID:28492532
Memo1	Rat	hereditary spastic paraplegia 4		ISO	RGD:1320537	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia 4	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Memo1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1552554	6480464	bisphenol S results in increased expression of MEMO1 mRNA	CTD	PMID:39298647
Memo1	Rat	cadmium atom	multiple interactions	ISO	RGD:1552554	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MEMO1 more ...	CTD	PMID:37325564
Memo1	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1552554	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MEMO1 more ...	CTD	PMID:37325564
Memo1	Rat	dextran sulfate	multiple interactions	ISO	RGD:1552554	6480464	evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of MEMO1 protein]	CTD	PMID:35362542
Memo1	Rat	dextran sulfate	decreases expression	ISO	RGD:1552554	6480464	Dextran Sulfate results in decreased expression of MEMO1 protein	CTD	PMID:35362542
Memo1	Rat	Evodiamine	multiple interactions	ISO	RGD:1552554	6480464	evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of MEMO1 protein]	CTD	PMID:35362542
Memo1	Rat	okadaic acid	increases expression	ISO	RGD:1320537	6480464	Okadaic Acid results in increased expression of MEMO1 mRNA	CTD	PMID:38832940
Memo1	Rat	ozone	multiple interactions	ISO	RGD:1320537	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of MEMO1 mRNA	CTD	PMID:35430440
Memo1	Rat	perfluorohexanesulfonic acid	increases expression	ISO	RGD:1552554	6480464	perfluorohexanesulfonic acid results in increased expression of MEMO1 mRNA	CTD	PMID:37995155
Memo1	Rat	sodium chloride	decreases expression	EXP		6480464	Sodium Chloride results in decreased expression of MEMO1 mRNA	CTD	PMID:37992803
Memo1	Rat	titanium dioxide	increases methylation	ISO	RGD:1552554	6480464	titanium dioxide results in increased methylation of MEMO1 promoter	CTD	PMID:35295148
Memo1	Rat	titanium dioxide	increases expression	ISO	RGD:1552554	6480464	titanium dioxide results in increased expression of MEMO1 mRNA	CTD	PMID:35295148

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Memo1	Rat	regulation of microtubule-based process	involved_in	ISO	RGD:1320537	1624291	PMID:20937854	RGD	PMID:20937854
Memo1	Rat	regulation of microtubule-based process	involved_in	ISS	UniProtKB:Q9Y316	1600115	GO_REF:0000024	UniProt	GO_REF:0000024

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Memo1	Rat	protein binding	enables	ISO	RGD:1320537	1624291	UniProtKB:O15209\|UniProtKB:O75410\|UniProtKB:O75410-7\|UniProtKB:O94983-5\|UniProtKB:P04626\|UniProtKB:P14373\|UniProtKB:P15884\|UniProtKB:P15884-3\|UniProtKB:Q04864\|UniProtKB:Q15654\|UniProtKB:Q86WR7\|UniProtKB:Q8HWS3\|UniProtKB:Q8IUH3\|UniProtKB:Q8N720\|UniProtKB:Q8TBB1\|UniProtKB:Q8WUE5\|UniProtKB:Q96D03\|UniProtKB:Q9BRK4\|UniProtKB:Q9NT22\|UniProtKB:Q9UJY4 PMID:21516116, PMID:21840311, PMID:25416956, PMID:32296183, PMID:33961781	RGD	PMID:21516116\|PMID:21840311\|PMID:25416956\|PMID:32296183\|PMID:33961781

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:15489334	PMID:16780588	PMID:20937854	PMID:21873635

Memo1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	26,895,497 - 26,986,248 (+)	NCBI		GRCr8
mRatBN7.2	6	21,144,525 - 21,234,363 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	21,125,639 - 21,234,561 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	21,475,758 - 21,564,825 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	21,791,599 - 21,880,664 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	21,272,051 - 21,361,118 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	22,362,483 - 22,409,583 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	22,362,484 - 22,409,579 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	32,248,023 - 32,295,278 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	21,149,520 - 21,197,328 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	21,152,474 - 21,200,281 (+)	NCBI
Celera	6	20,744,198 - 20,791,297 (+)	NCBI		Celera
Cytogenetic Map	6	q13	NCBI

MEMO1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	31,867,823 - 32,011,008 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	31,865,060 - 32,011,230 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	32,092,892 - 32,236,077 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	31,946,396 - 32,089,202 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	32,004,546 - 32,147,349	NCBI
Celera	2	31,937,749 - 32,080,568 (-)	NCBI		Celera
Cytogenetic Map	2	p22.3	NCBI
HuRef	2	31,832,452 - 31,923,497 (-)	NCBI		HuRef
CHM1_1	2	32,022,713 - 32,165,883 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	31,916,231 - 32,059,416 (-)	NCBI		T2T-CHM13v2.0

Memo1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	74,493,759 - 74,602,677 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	74,506,031 - 74,602,516 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	74,186,764 - 74,295,682 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	74,199,036 - 74,295,521 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	74,600,040 - 74,694,203 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	74,105,655 - 74,199,965 (-)	NCBI		MGSCv36	mm8
Celera	17	78,495,588 - 78,553,414 (-)	NCBI		Celera
Cytogenetic Map	17	E2	NCBI
cM Map	17	45.63	NCBI

Memo1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955441	332,864 - 391,838 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955441	332,864 - 391,836 (-)	NCBI	ChiLan1.0	ChiLan1.0

MEMO1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	94,478,056 - 94,622,140 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	94,469,913 - 94,638,453 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	31,887,899 - 32,032,155 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	31,956,294 - 32,098,889 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	31,956,831 - 32,051,337 (-)	Ensembl	panpan1.1		panPan2

MEMO1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	25,231,982 - 25,298,786 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	25,237,661 - 25,303,462 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	25,031,330 - 25,153,198 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	25,801,068 - 25,923,444 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	25,799,405 - 25,923,546 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	25,101,370 - 25,223,192 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	25,166,579 - 25,295,146 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	25,268,985 - 25,394,281 (-)	NCBI		UU_Cfam_GSD_1.0

Memo1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	69,327,591 - 69,443,276 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936493	1,449,152 - 1,506,716 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936493	1,396,106 - 1,506,716 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MEMO1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	107,542,096 - 107,658,455 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	107,542,045 - 107,657,195 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	114,306,301 - 114,420,268 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MEMO1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	75,480,890 - 75,625,264 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	75,557,793 - 75,627,858 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	36,438,746 - 36,590,242 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Memo1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624738	13,575,542 - 13,687,497 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624738	13,575,542 - 13,687,002 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Memo1
410 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	324
Count of miRNA genes:	213
Interacting mature miRNAs:	241
Transcripts:	ENSRNOT00000008687
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1	41223769	Rat
1549905	Stresp10	Stress response QTL 10	6.83	0.0066	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	6	1	27574569	Rat
8693699	Alc37	Alcohol consumption QTL 37	2.6	0.224	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	6	7964167	21301982	Rat
8693645	Alc31	Alcohol consumption QTL 31	3.7	0.038	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	6	17532521	24011952	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	1	34235784	Rat
2292589	Emca10	Estrogen-induced mammary cancer QTL 10		0.048	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	16536140	61536140	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	54641141	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1	41223769	Rat
1578758	Tcas9	Tongue tumor susceptibility QTL 9	3.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	6	1	37618905	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	41223769	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	39036266	Rat
738024	Sach5	Saccharine consumption QTL 5	3.9	0.00039	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	6	1	43394190	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1	41223769	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1	41223769	Rat
738023	Alc17	Alcohol consumption QTL 17	3.1	0.003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	6	1	27574569	Rat
1354616	Despr12	Despair related QTL 12		0.0012	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	6	1	27574569	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	1	42487980	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	1	42487980	Rat
7411584	Foco4	Food consumption QTL 4	4.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	42838846	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	11735669	72593685	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
2300176	Bmd51	Bone mineral density QTL 51	11.7	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	6	1	27574569	Rat
1300128	Rf16	Renal function QTL 16	3.89		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	34434305	Rat
1641898	Colcr4	Colorectal carcinoma resistance QTL4	3.71	0.0007	intestine integrity trait (VT:0010554)	well differentiated malignant colorectal tumor surface area measurement (CMO:0002077)	6	20338777	62613667	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	11735669	72593685	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	1	42487980	Rat
1359023	Bp272	Blood pressure QTL 272	2.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	16536140	27261739	Rat
1354664	Slep2	Serum leptin concentration QTL 2	4.49		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	6	16536140	71636405	Rat
2300190	Bmd52	Bone mineral density QTL 52	11.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	6	1	27574569	Rat
8693690	Alc35	Alcohol consumption QTL 35	2.2	0.606	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	6	7964167	21301982	Rat

BF404306

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	21,221,762 - 21,221,864 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	22,396,984 - 22,397,085	NCBI	Rnor6.0
Rnor_5.0	6	32,282,679 - 32,282,780	UniSTS	Rnor5.0
RGSC_v3.4	6	21,184,019 - 21,184,120	UniSTS	RGSC3.4
Celera	6	20,778,699 - 20,778,800	UniSTS
Cytogenetic Map	6	q13	UniSTS

AA925064

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	21,234,071 - 21,234,228 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	22,409,292 - 22,409,448	NCBI	Rnor6.0
Rnor_5.0	6	32,294,987 - 32,295,143	UniSTS	Rnor5.0
RGSC_v3.4	6	21,197,037 - 21,197,193	UniSTS	RGSC3.4
Celera	6	20,791,006 - 20,791,162	UniSTS
Cytogenetic Map	6	q13	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001029917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111903	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261616	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010052055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010052056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC139392	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098061	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215386	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008687 ⟹ ENSRNOP00000008687

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	21,144,638 - 21,234,561 (+)	Ensembl
Rnor_6.0 Ensembl	6	22,362,484 - 22,409,579 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106946 ⟹ ENSRNOP00000087011

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	21,144,638 - 21,234,561 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107877 ⟹ ENSRNOP00000080510

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	21,145,240 - 21,234,357 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110923 ⟹ ENSRNOP00000086324

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	21,125,639 - 21,234,353 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114968 ⟹ ENSRNOP00000093193

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	21,144,638 - 21,234,561 (+)	Ensembl

RefSeq Acc Id:

NM_001029917 ⟹ NP_001025088

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	26,897,102 - 26,986,248 (+)	NCBI
mRatBN7.2	6	21,145,242 - 21,234,363 (+)	NCBI
Rnor_6.0	6	22,362,483 - 22,409,583 (+)	NCBI
Rnor_5.0	6	32,248,023 - 32,295,278 (+)	NCBI
RGSC_v3.4	6	21,149,520 - 21,197,328 (+)	RGD
Celera	6	20,744,198 - 20,791,297 (+)	RGD

Sequence:

show sequence

GCACCATAGGCGGCACAGGCTCCAAGATGTCCAACCGAGTGGTCTGCCGGGAAGCCAGCCACGCCGGGAGCTGGTACACCGCCTCAGGACCTCAGCTGAATGCCCAGCTAGAAGGTTGGCTTTCACAA
GTCCAGTCTACGAAAAGACCTGCCAGAGCCATCATTGCACCCCATGCAGGATATACGTACTGTGGGTCTTGTGCTGCCCATGCTTACAAACAAGTGGATCCATCAATTACCCGGAGAATTTTCATCCT
TGGGCCCTCCCATCATGTGCCCCTGTCTCGATGTGCACTCTCCAGTGTGGATATATATAGGACTCCTCTGTATGACCTTCGTATTGACCAAAAGATTTACGGAGAGCTATGGAAGACAGGAATGTTTG
AACGAATGTCTCTGCAGACAGATGAAGATGAACACAGTATTGAAATGCATTTGCCTTACACAGCTAAAGCCATGGAAAGCCATAAAGATGAGTTTACCATTATTCCTGTACTGGTTGGAGCTCTGAGT
GAGTCAAAAGAACAGGAATTCGGAAAACTCTTCAGTAAATATCTAGCGGATCCTAGTAATCTCTTTGTGGTTTCTTCTGATTTCTGCCATTGGGGTCAAAGGTTCCGTTACAGTTACTATGATGAATC
CCAGGGGGAGATTTATAGATCCATTGAACATCTAGATAAAATGGGTATGAGTATTATAGAACAATTAGATCCTGTATCTTTTAGCAATTATTTGAAGAAATATCATAATACTATATGTGGAAGACATC
CCATCGGGGTGTTATTAAATGCTATCACAGAGCTTCAAAAGAGTGGAATGAATATGAGCTTTTCCTTTTTGAATTATGCCCAGTCGAGCCAGTGTAGAAGCTGGCAAGACAGTTCAGTCAGTTACGCA
GCTGGAGCACTCACGGTCCACTGAAGCTCCGACCCTCAGGGACGCCACCTGCACAGACTCGTACTCTGTCTAGGGTCCAGCCTAGCCTTTACCAAGATGTTGGTTCTGGTGTGGGGGGATTCTGAAAC
CTCAGACTAATAGAACTCTTCTTCTTTTCTAGTAGGTGTAGTCCTCCTTAATTTCAACTCATTTTAAAAAATGCTTTCTAGTTTGGGGCAGTGGAAGGAAGGCTGGAATCAAAATATTTGCCCAATTG
GCACACAGTGACTTGTAAAGCATTTAGCATATCTGAAATTTGCACTCTTTGCAGACTCATGCACATATATTCCGCTTTCAGAATAGTTTTGCAAATTGTACACAGACAAAGGGTGGAAGCTTTTTAAT
AAAAAATTGCATTTATAAATGATCTGTATTAGAATATAAGAAATCTCCAGTTACAGACAATTACTACCCATGTTGTACAACAGATACCTTCTATTTTAGTTGCTAATAAAGGGCTACACAACTCAAAA
AAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039111900 ⟹ XP_038967828

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	26,896,385 - 26,986,248 (+)	NCBI
mRatBN7.2	6	21,144,525 - 21,234,363 (+)	NCBI

RefSeq Acc Id:

XM_039111903 ⟹ XP_038967831

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	26,939,144 - 26,986,248 (+)	NCBI
mRatBN7.2	6	21,165,073 - 21,234,363 (+)	NCBI

RefSeq Acc Id:

XM_063261614 ⟹ XP_063117684

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	26,895,497 - 26,967,211 (+)	NCBI

RefSeq Acc Id:

XM_063261615 ⟹ XP_063117685

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	26,895,497 - 26,984,259 (+)	NCBI

RefSeq Acc Id:

XM_063261616 ⟹ XP_063117686

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	26,895,497 - 26,986,248 (+)	NCBI

RefSeq Acc Id:

XR_010052055

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	26,895,497 - 26,975,751 (+)	NCBI

RefSeq Acc Id:

XR_010052056

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	26,895,497 - 26,985,673 (+)	NCBI


Protein RefSeqs	NP_001025088	(Get FASTA)	NCBI Sequence Viewer
	XP_038967828	(Get FASTA)	NCBI Sequence Viewer
	XP_038967831	(Get FASTA)	NCBI Sequence Viewer
	XP_063117684	(Get FASTA)	NCBI Sequence Viewer
	XP_063117685	(Get FASTA)	NCBI Sequence Viewer
	XP_063117686	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98061	(Get FASTA)	NCBI Sequence Viewer
	EDM02847	(Get FASTA)	NCBI Sequence Viewer
	EDM02848	(Get FASTA)	NCBI Sequence Viewer
	EDM02849	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008687
	ENSRNOP00000008687.4
	ENSRNOP00000080510
GenBank Protein	Q4QQR9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001025088 ⟸ NM_001029917

- UniProtKB:

Q4QQR9 (UniProtKB/Swiss-Prot), F1LNE5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDE
DEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAI
TELQKSGMNMSFSFLNYAQSSQCRSWQDSSVSYAAGALTVH

hide sequence

Ensembl Acc Id:

ENSRNOP00000008687 ⟸ ENSRNOT00000008687

RefSeq Acc Id:	XP_038967828 ⟸ XM_039111900
- Peptide Label:	isoform X4
- UniProtKB:	Q4QQR9 (UniProtKB/Swiss-Prot), F1LNE5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038967831 ⟸ XM_039111903
- Peptide Label:	isoform X5

Ensembl Acc Id:

ENSRNOP00000086324 ⟸ ENSRNOT00000110923

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4QQR9-F1-model_v2	AlphaFold	Q4QQR9	1-297	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-38436	BioCyc
Ensembl Genes	ENSRNOG00000006340	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000008687	ENTREZGENE
	ENSRNOT00000008687.6	UniProtKB/Swiss-Prot
	ENSRNOT00000107877	ENTREZGENE
	ENSRNOT00000133440	ENTREZGENE
Gene3D-CATH	LigB-like	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7458219	IMAGE-MGC_LOAD
InterPro	MEMO1_fam	UniProtKB/Swiss-Prot
KEGG Report	rno:298787	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:116222	IMAGE-MGC_LOAD
NCBI Gene	298787	ENTREZGENE
PANTHER	PROTEIN MEMO1	UniProtKB/Swiss-Prot
	PTHR11060	UniProtKB/Swiss-Prot
Pfam	Memo	UniProtKB/Swiss-Prot
PhenoGen	Memo1	PhenoGen
RatGTEx	ENSRNOG00000006340	RatGTEx
UniProt	A0A8I5ZPZ0_RAT	UniProtKB/TrEMBL
	A0A8I6A3E7_RAT	UniProtKB/TrEMBL
	A0A8I6A7Q1_RAT	UniProtKB/TrEMBL
	A0A8I6AIW5_RAT	UniProtKB/TrEMBL
	F1LNE5	ENTREZGENE, UniProtKB/TrEMBL
	MEMO1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-26	Memo1	mediator of cell motility 1	RGD1309929	similar to RIKEN cDNA 0610016J10 gene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1309929	similar to RIKEN cDNA 0610016J10 gene	RGD1309929_predicted	similar to RIKEN cDNA 0610016J10 gene (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1309929_predicted	similar to RIKEN cDNA 0610016J10 gene (predicted)	LOC298787_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC298787_predicted	similar to RIKEN cDNA 0610016J10 gene (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar