Symbol:
Coro2a
Name:
coronin 2A
RGD ID:
1309719
Description:
Predicted to enable actin filament binding activity. Predicted to be located in brush border. Predicted to be part of transcription repressor complex. Orthologous to human CORO2A (coronin 2A); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 3,3',5,5'-tetrabromobisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
coronin, actin binding protein 2A; coronin-2A; LOC313235
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CORO2A (coronin 2A) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Coro2a (coronin, actin binding protein 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Coro2a (coronin 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CORO2A (coronin 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CORO2A (coronin 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Coro2a (coronin 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CORO2A (coronin 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CORO2A (coronin 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Coro2a (coronin 2A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CORO2B (coronin 2B) HGNC
OrthoDB
Homo sapiens (human):
EPN1 (epsin 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CORO2A (coronin 2A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Coro2a (coronin, actin binding protein 2A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
coro2a (coronin, actin binding protein, 2A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CRN1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
coro2a
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 65,623,820 - 65,677,483 (-) NCBI GRCr8 mRatBN7.2 5 60,825,630 - 60,881,917 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 60,828,247 - 60,859,035 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 62,799,206 - 62,829,895 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 64,618,572 - 64,649,265 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 64,587,986 - 64,618,675 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 62,154,526 - 62,210,797 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 62,156,839 - 62,187,930 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 66,682,213 - 66,737,392 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 63,121,905 - 63,152,843 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 63,122,086 - 63,153,022 (-) NCBI Celera 5 59,389,825 - 59,420,508 (-) NCBI Celera Cytogenetic Map 5 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Coro2a Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:1320211 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Coro2a Rat 17beta-estradiol decreases expression ISO RGD:1320211 6480464 Estradiol results in decreased expression of CORO2A mRNA CTD PMID:39298647 Coro2a Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:1320210 6480464 Dihydrotestosterone results in increased expression of CORO2A mRNA CTD PMID:29581250 Coro2a Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1320211 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Coro2a Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:1320211 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Coro2a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CORO2A mRNA CTD PMID:22298810 Coro2a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CORO2A mRNA CTD PMID:32109520|PMID:33387578 Coro2a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1320211 6480464 Tetrachlorodibenzodioxin affects the expression of CORO2A mRNA CTD PMID:21570461|PMID:26377647 Coro2a Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:1320211 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Coro2a Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of CORO2A mRNA CTD PMID:21346803 Coro2a Rat 2-hydroxypropanoic acid decreases expression ISO RGD:1320210 6480464 Lactic Acid results in decreased expression of CORO2A mRNA CTD PMID:30851411 Coro2a Rat 3,3',5,5'-tetrabromobisphenol A increases expression EXP 6480464 tetrabromobisphenol A results in increased expression of CORO2A mRNA CTD PMID:27914987 Coro2a Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1320210 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Coro2a Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1320210 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Coro2a Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1320211 6480464 bisphenol S results in decreased methylation of CORO2A exon CTD PMID:33297965 Coro2a Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1320211 6480464 bisphenol S results in decreased expression of CORO2A mRNA CTD PMID:39298647 Coro2a Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1320211 6480464 Fenretinide results in increased expression of CORO2A mRNA CTD PMID:28973697 Coro2a Rat 8-Br-cAMP decreases expression ISO RGD:1320210 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of CORO2A mRNA CTD PMID:22079614 Coro2a Rat actinomycin D multiple interactions ISO RGD:1320210 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of CORO2A mRNA CTD PMID:38460933 Coro2a Rat aflatoxin B1 increases methylation ISO RGD:1320210 6480464 Aflatoxin B1 results in increased methylation of CORO2A gene CTD PMID:27153756 Coro2a Rat all-trans-retinoic acid increases expression ISO RGD:1320210 6480464 Tretinoin results in increased expression of CORO2A mRNA CTD PMID:23724009|PMID:23830798|PMID:33167477 Coro2a Rat all-trans-retinoic acid multiple interactions ISO RGD:1320211 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of CORO2A mRNA CTD PMID:36189433 Coro2a Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CORO2A mRNA CTD PMID:35163327 Coro2a Rat amiodarone increases expression ISO RGD:1320210 6480464 Amiodarone results in increased expression of CORO2A mRNA CTD PMID:19774075 Coro2a Rat aristolochic acid A decreases expression ISO RGD:1320210 6480464 aristolochic acid I results in decreased expression of CORO2A mRNA CTD PMID:33212167 Coro2a Rat arsane multiple interactions ISO RGD:1320210 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Coro2a Rat arsenic atom multiple interactions ISO RGD:1320210 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Coro2a Rat arsenous acid decreases expression ISO RGD:1320210 6480464 Arsenic Trioxide results in decreased expression of CORO2A mRNA CTD PMID:26705709 Coro2a Rat atrazine increases expression ISO RGD:1320210 6480464 Atrazine results in increased expression of CORO2A mRNA CTD PMID:22378314 Coro2a Rat benzo[a]pyrene decreases expression ISO RGD:1320210 6480464 Benzo(a)pyrene results in decreased expression of CORO2A mRNA CTD PMID:22316170|PMID:26238291 Coro2a Rat benzo[a]pyrene increases methylation ISO RGD:1320210 6480464 Benzo(a)pyrene results in increased methylation of CORO2A 5' UTR CTD PMID:27901495 Coro2a Rat benzo[a]pyrene multiple interactions ISO RGD:1320211 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Coro2a Rat benzo[b]fluoranthene multiple interactions ISO RGD:1320211 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Coro2a Rat benzo[e]pyrene increases methylation ISO RGD:1320210 6480464 benzo(e)pyrene results in increased methylation of CORO2A intron CTD PMID:30157460 Coro2a Rat beta-lapachone increases expression ISO RGD:1320210 6480464 beta-lapachone results in increased expression of CORO2A mRNA CTD PMID:38218311 Coro2a Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1320210 6480464 Diethylhexyl Phthalate results in increased expression of CORO2A mRNA CTD PMID:31163220 Coro2a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CORO2A mRNA CTD PMID:25181051 Coro2a Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CORO2A gene CTD PMID:28505145 Coro2a Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of CORO2A promoter CTD PMID:22457795 Coro2a Rat camptothecin increases expression ISO RGD:1320210 6480464 Camptothecin results in increased expression of CORO2A mRNA CTD PMID:38460933 Coro2a Rat carbon nanotube increases expression ISO RGD:1320211 6480464 Nanotubes, Carbon analog results in increased expression of CORO2A mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Coro2a Rat chlordecone increases expression ISO RGD:1320211 6480464 Chlordecone results in increased expression of CORO2A mRNA CTD PMID:33711761 Coro2a Rat chloroprene increases expression ISO RGD:1320211 6480464 Chloroprene results in increased expression of CORO2A mRNA CTD PMID:23125180 Coro2a Rat chrysene multiple interactions ISO RGD:1320211 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Coro2a Rat cisplatin increases expression ISO RGD:1320210 6480464 Cisplatin results in increased expression of CORO2A mRNA CTD PMID:27392435 Coro2a Rat cisplatin multiple interactions ISO RGD:1320210 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of CORO2A mRNA CTD PMID:27392435 Coro2a Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of CORO2A mRNA CTD PMID:26033743 Coro2a Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of CORO2A mRNA CTD PMID:26033743 Coro2a Rat copper(II) sulfate decreases expression ISO RGD:1320210 6480464 Copper Sulfate results in decreased expression of CORO2A mRNA CTD PMID:19549813 Coro2a Rat coumestrol decreases expression ISO RGD:1320210 6480464 Coumestrol results in decreased expression of CORO2A mRNA CTD PMID:19167446 Coro2a Rat coumestrol multiple interactions ISO RGD:1320210 6480464 [Coumestrol co-treated with resveratrol] results in decreased expression of CORO2A mRNA CTD PMID:19167446 Coro2a Rat cyclosporin A decreases expression ISO RGD:1320210 6480464 Cyclosporine results in decreased expression of CORO2A mRNA CTD PMID:25562108 Coro2a Rat dexamethasone multiple interactions ISO RGD:1320210 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Coro2a Rat diarsenic trioxide decreases expression ISO RGD:1320210 6480464 Arsenic Trioxide results in decreased expression of CORO2A mRNA CTD PMID:26705709 Coro2a Rat Dibutyl phosphate affects expression ISO RGD:1320210 6480464 di-n-butylphosphoric acid affects the expression of CORO2A mRNA CTD PMID:37042841 Coro2a Rat dichloroacetic acid decreases expression ISO RGD:1320211 6480464 Dichloroacetic Acid results in decreased expression of CORO2A mRNA CTD PMID:28962523 Coro2a Rat dioxygen increases expression ISO RGD:1320210 6480464 Oxygen deficiency results in increased expression of CORO2A mRNA CTD PMID:24236059 Coro2a Rat dorsomorphin multiple interactions ISO RGD:1320210 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Coro2a Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of CORO2A mRNA CTD PMID:29391264 Coro2a Rat entinostat multiple interactions ISO RGD:1320210 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Coro2a Rat entinostat increases expression ISO RGD:1320210 6480464 entinostat results in increased expression of CORO2A mRNA CTD PMID:26272509 Coro2a Rat ethanol affects splicing ISO RGD:1320211 6480464 Ethanol affects the splicing of CORO2A mRNA CTD PMID:30319688 Coro2a Rat folic acid decreases expression ISO RGD:1320211 6480464 Folic Acid results in decreased expression of CORO2A mRNA CTD PMID:25629700 Coro2a Rat hydrogen peroxide affects expression ISO RGD:1320210 6480464 Hydrogen Peroxide affects the expression of CORO2A mRNA CTD PMID:20044591 Coro2a Rat indometacin multiple interactions ISO RGD:1320210 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Coro2a Rat lipopolysaccharide multiple interactions ISO RGD:1320210 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CORO2A mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Coro2a Rat lipopolysaccharide decreases expression ISO RGD:1320210 6480464 Lipopolysaccharides results in decreased expression of CORO2A mRNA CTD PMID:35811015 Coro2a Rat manganese atom multiple interactions ISO RGD:1320210 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Coro2a Rat manganese(0) multiple interactions ISO RGD:1320210 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Coro2a Rat manganese(II) chloride multiple interactions ISO RGD:1320210 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Coro2a Rat menadione affects expression ISO RGD:1320210 6480464 Vitamin K 3 affects the expression of CORO2A mRNA CTD PMID:20044591 Coro2a Rat methapyrilene increases methylation ISO RGD:1320210 6480464 Methapyrilene results in increased methylation of CORO2A intron CTD PMID:30157460 Coro2a Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:1320211 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of CORO2A mRNA CTD PMID:36189433 Coro2a Rat Nutlin-3 multiple interactions ISO RGD:1320210 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of CORO2A mRNA CTD PMID:38460933 Coro2a Rat ozone multiple interactions ISO RGD:1320211 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of CORO2A more ... CTD PMID:34911549 Coro2a Rat ozone multiple interactions ISO RGD:1320210 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of CORO2A mRNA CTD PMID:35430440 Coro2a Rat panobinostat increases expression ISO RGD:1320210 6480464 panobinostat results in increased expression of CORO2A mRNA CTD PMID:26272509 Coro2a Rat panobinostat multiple interactions ISO RGD:1320210 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Coro2a Rat PCB138 multiple interactions ISO RGD:1320211 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Coro2a Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CORO2A mRNA CTD PMID:35163327 Coro2a Rat phenobarbital affects expression ISO RGD:1320210 6480464 Phenobarbital affects the expression of CORO2A mRNA CTD PMID:19159669 Coro2a Rat phenylmercury acetate increases expression ISO RGD:1320210 6480464 Phenylmercuric Acetate results in increased expression of CORO2A mRNA CTD PMID:26272509 Coro2a Rat phenylmercury acetate multiple interactions ISO RGD:1320210 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Coro2a Rat pirinixic acid multiple interactions ISO RGD:1320210 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Coro2a Rat pregnenolone 16alpha-carbonitrile decreases expression ISO RGD:1320211 6480464 Pregnenolone Carbonitrile results in decreased expression of CORO2A mRNA CTD PMID:28903501 Coro2a Rat quercetin decreases expression ISO RGD:1320210 6480464 Quercetin results in decreased expression of CORO2A mRNA CTD PMID:21632981 Coro2a Rat rac-lactic acid decreases expression ISO RGD:1320210 6480464 Lactic Acid results in decreased expression of CORO2A mRNA CTD PMID:30851411 Coro2a Rat resveratrol multiple interactions ISO RGD:1320210 6480464 [Coumestrol co-treated with resveratrol] results in decreased expression of CORO2A mRNA CTD PMID:19167446 Coro2a Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1320210 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CORO2A mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Coro2a Rat SB 431542 multiple interactions ISO RGD:1320210 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Coro2a Rat silicon dioxide decreases expression ISO RGD:1320210 6480464 Silicon Dioxide analog results in decreased expression of CORO2A mRNA CTD PMID:25895662 Coro2a Rat sodium arsenite decreases expression ISO RGD:1320210 6480464 sodium arsenite results in decreased expression of CORO2A mRNA CTD PMID:38568856 Coro2a Rat sodium arsenite multiple interactions ISO RGD:1320210 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Coro2a Rat temozolomide increases expression ISO RGD:1320210 6480464 Temozolomide results in increased expression of CORO2A mRNA CTD PMID:31758290 Coro2a Rat tetraphene multiple interactions ISO RGD:1320211 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ... CTD PMID:27858113 Coro2a Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CORO2A mRNA CTD PMID:23411599 Coro2a Rat thiram decreases expression ISO RGD:1320210 6480464 Thiram results in decreased expression of CORO2A mRNA CTD PMID:38568856 Coro2a Rat titanium dioxide decreases methylation ISO RGD:1320211 6480464 titanium dioxide results in decreased methylation of CORO2A gene CTD PMID:35295148 Coro2a Rat tributylstannane increases expression ISO RGD:1320211 6480464 tributyltin results in increased expression of CORO2A mRNA CTD PMID:31939706 Coro2a Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CORO2A mRNA CTD PMID:33387578 Coro2a Rat trichostatin A increases expression ISO RGD:1320210 6480464 trichostatin A results in increased expression of CORO2A mRNA CTD PMID:24935251|PMID:26272509 Coro2a Rat trichostatin A multiple interactions ISO RGD:1320210 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Coro2a Rat trimellitic anhydride increases expression ISO RGD:1320211 6480464 trimellitic anhydride results in increased expression of CORO2A mRNA CTD PMID:19042947 Coro2a Rat tungsten decreases expression ISO RGD:1320211 6480464 Tungsten results in decreased expression of CORO2A mRNA CTD PMID:30912803 Coro2a Rat valproic acid increases methylation ISO RGD:1320210 6480464 Valproic Acid results in increased methylation of CORO2A gene CTD PMID:29154799 Coro2a Rat valproic acid affects expression ISO RGD:1320210 6480464 Valproic Acid affects the expression of CORO2A mRNA CTD PMID:25979313 Coro2a Rat valproic acid increases expression ISO RGD:1320210 6480464 Valproic Acid results in increased expression of CORO2A mRNA CTD PMID:19101580|PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509|PMID:28001369|PMID:29154799 Coro2a Rat valproic acid multiple interactions ISO RGD:1320210 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Coro2a Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of CORO2A gene CTD PMID:31079544 Coro2a Rat vorinostat increases expression ISO RGD:1320210 6480464 vorinostat results in increased expression of CORO2A mRNA CTD PMID:26272509 Coro2a Rat vorinostat multiple interactions ISO RGD:1320210 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386
1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (ISO) 2,4-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 8-Br-cAMP (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amiodarone (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) cadmium dichloride (EXP) camptothecin (ISO) carbon nanotube (ISO) chlordecone (ISO) chloroprene (ISO) chrysene (ISO) cisplatin (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dichloroacetic acid (ISO) dioxygen (ISO) dorsomorphin (ISO) endosulfan (EXP) entinostat (ISO) ethanol (ISO) folic acid (ISO) hydrogen peroxide (ISO) indometacin (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) methapyrilene (ISO) mono(2-ethylhexyl) phthalate (ISO) Nutlin-3 (ISO) ozone (ISO) panobinostat (ISO) PCB138 (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) temozolomide (ISO) tetraphene (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tributylstannane (ISO) trichloroethene (EXP) trichostatin A (ISO) trimellitic anhydride (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO)
Coro2a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 65,623,820 - 65,677,483 (-) NCBI GRCr8 mRatBN7.2 5 60,825,630 - 60,881,917 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 60,828,247 - 60,859,035 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 62,799,206 - 62,829,895 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 64,618,572 - 64,649,265 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 64,587,986 - 64,618,675 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 62,154,526 - 62,210,797 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 62,156,839 - 62,187,930 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 66,682,213 - 66,737,392 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 63,121,905 - 63,152,843 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 63,122,086 - 63,153,022 (-) NCBI Celera 5 59,389,825 - 59,420,508 (-) NCBI Celera Cytogenetic Map 5 q22 NCBI
CORO2A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 98,120,975 - 98,192,637 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 98,120,975 - 98,192,637 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 100,883,257 - 100,954,919 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 99,926,294 - 99,994,743 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 97,966,032 - 98,034,477 NCBI Celera 9 71,397,550 - 71,469,269 (-) NCBI Celera Cytogenetic Map 9 q22.33 NCBI HuRef 9 70,483,409 - 70,555,156 (-) NCBI HuRef CHM1_1 9 101,029,674 - 101,101,387 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 110,292,922 - 110,364,586 (-) NCBI T2T-CHM13v2.0
Coro2a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 46,536,937 - 46,601,929 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 46,536,937 - 46,602,202 (-) Ensembl GRCm39 Ensembl GRCm38 4 46,536,937 - 46,601,929 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 46,536,937 - 46,602,202 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 46,549,809 - 46,579,312 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 46,558,659 - 46,587,540 (-) NCBI MGSCv36 mm8 Celera 4 46,555,568 - 46,613,230 (-) NCBI Celera Cytogenetic Map 4 B1 NCBI cM Map 4 24.87 NCBI
Coro2a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 27,348,452 - 27,388,965 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 27,323,164 - 27,386,488 (+) NCBI ChiLan1.0 ChiLan1.0
CORO2A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 41,265,137 - 41,337,032 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 41,267,525 - 41,339,409 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 69,210,625 - 69,282,434 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 97,335,021 - 97,403,255 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 97,335,026 - 97,368,204 (-) Ensembl panpan1.1 panPan2
CORO2A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 55,345,577 - 55,400,092 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 55,345,934 - 55,372,374 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 53,778,976 - 53,833,540 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 56,457,510 - 56,512,403 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 56,459,945 - 56,512,809 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 54,953,123 - 55,007,725 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 54,983,784 - 55,038,657 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 55,680,250 - 55,729,539 (-) NCBI UU_Cfam_GSD_1.0
Coro2a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 170,272,327 - 170,316,358 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936524 6,820,063 - 6,848,371 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936524 6,819,641 - 6,845,854 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CORO2A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 239,947,301 - 240,000,918 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 239,947,299 - 240,000,964 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 268,117,471 - 268,171,600 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CORO2A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 41,226,972 - 41,294,742 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 41,227,349 - 41,295,468 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 38,266,023 - 38,333,941 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Coro2a
.
Predicted Target Of
Count of predictions: 101 Count of miRNA genes: 78 Interacting mature miRNAs: 82 Transcripts: ENSRNOT00000011787 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578776 Stresp18 Stress response QTL 18 2.9 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 5 27955440 72955440 Rat 1298067 Scl15 Serum cholesterol level QTL 15 4.8 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 33215665 78215665 Rat 1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 61386 Bp49 Blood pressure QTL 49 16.6 cerebrum integrity trait (VT:0010549) brain infarction volume (CMO:0001013) 5 60293434 98603051 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1598807 Glom12 Glomerulus QTL 12 2.7 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 33215665 78215665 Rat 1302786 Kidm8 Kidney mass QTL 8 28.15 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 33215665 78215665 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 6903292 Stl28 Serum triglyceride level QTL 28 2.6 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 5 28515489 73515489 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1578767 Stresp17 Stress response QTL 17 4.3 0.01 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 5 27955440 72955440 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 1641922 Alcrsp8 Alcohol response QTL 8 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 5 35189153 68564008 Rat 2303615 Vencon7 Ventilatory control QTL 7 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 5 50983895 95983895 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 6903306 Scl35 Serum cholesterol QTL 35 2.6 0.0073 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 28515489 73515489 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331773 Scl26 Serum cholesterol level QTL 26 3.065 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 43726656 86724018 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 61359 Eaex Experimental allergic encephalomyelitis QTL x 3 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 5 55715622 100715622 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 2303574 Gluco42 Glucose level QTL 42 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 53496719 98496719 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 8552954 Pigfal14 Plasma insulin-like growth factor 1 level QTL 14 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 21226744 66226744 Rat 2316954 Rf57 Renal function QTL 57 0 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 59793528 90450144 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 1600358 Mamtr5 Mammary tumor resistance QTL 5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 18873947 63873947 Rat 2316957 Pur21 Proteinuria QTL 21 6.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 5 59793528 113558156 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
48
113
91
90
59
25
59
6
215
95
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011787 ⟹ ENSRNOP00000011787
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 60,828,247 - 60,859,035 (-) Ensembl Rnor_6.0 Ensembl 5 62,157,149 - 62,187,930 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000089789 ⟹ ENSRNOP00000072816
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 62,156,839 - 62,186,372 (-) Ensembl
RefSeq Acc Id:
NM_001012101 ⟹ NP_001012101
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 65,623,820 - 65,654,602 (-) NCBI mRatBN7.2 5 60,828,244 - 60,859,035 (-) NCBI Rnor_6.0 5 62,157,148 - 62,187,930 (-) NCBI Rnor_5.0 5 66,682,213 - 66,737,392 (-) NCBI RGSC_v3.4 5 63,121,905 - 63,152,843 (-) RGD Celera 5 59,389,825 - 59,420,508 (-) NCBI
Sequence:
CAAAATCAGAACTCTCAGGGCCTTACCCATAGCCTGTGGTAGAGCGACGAACTTGTCCCTGTGTGTCTGGAATGTCCTCAGGTTTGGGGTTTTAGGTTTGCTTTCATTTTTCTTGCAGTCCTAGACAT
hide sequence
RefSeq Acc Id:
XM_006238058 ⟹ XP_006238120
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 65,623,820 - 65,677,483 (-) NCBI mRatBN7.2 5 60,825,630 - 60,881,917 (-) NCBI Rnor_6.0 5 62,154,526 - 62,210,797 (-) NCBI Rnor_5.0 5 66,682,213 - 66,737,392 (-) NCBI
Sequence:
CCCGGTCCCGCCCGCCGGGCTGCGCGGGGAGGCGGCGGCGCTGGGCGCGGGGACTCGGCGGGCG
hide sequence
RefSeq Acc Id:
XM_017593364 ⟹ XP_017448853
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 65,623,820 - 65,654,655 (-) NCBI mRatBN7.2 5 60,825,630 - 60,859,539 (-) NCBI Rnor_6.0 5 62,154,526 - 62,189,227 (-) NCBI
Sequence:
CCACCAAGCCAGGTGGACTCTGTCCTCTTTGTCATTGGGTTTGAGGGATTCTGTTTGTTCTGTC
hide sequence
RefSeq Acc Id:
XM_039109864 ⟹ XP_038965792
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 65,623,820 - 65,654,621 (-) NCBI mRatBN7.2 5 60,825,630 - 60,859,539 (-) NCBI
RefSeq Acc Id:
XM_063287629 ⟹ XP_063143699
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 65,623,820 - 65,655,208 (-) NCBI
RefSeq Acc Id:
NP_001012101 ⟸ NM_001012101
- UniProtKB:
A0A0G2QC56 (UniProtKB/TrEMBL), A6IJC5 (UniProtKB/TrEMBL)
- Sequence:
MWNGNSKLRPSPPLLKPNQMSWHPQYRSSKFRHVYGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRGNVLDIKWNPFDDFEIASCSEDATIKI
hide sequence
RefSeq Acc Id:
XP_006238120 ⟸ XM_006238058
- Peptide Label:
isoform X2
- UniProtKB:
Q6AY36 (UniProtKB/TrEMBL), F1LSP7 (UniProtKB/TrEMBL), A6IJC5 (UniProtKB/TrEMBL)
- Sequence:
MSWHPQYRSSKFRHVYGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIP
hide sequence
RefSeq Acc Id:
XP_017448853 ⟸ XM_017593364
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2QC56 (UniProtKB/TrEMBL), A6IJC5 (UniProtKB/TrEMBL)
- Sequence:
MWNGNSKLRPSPPLLKPNQMSWHPQYRSSKFRHVYGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRGNVLDIKWNPFDDFEIASCSEDATIKI
hide sequence
Ensembl Acc Id:
ENSRNOP00000011787 ⟸ ENSRNOT00000011787
Ensembl Acc Id:
ENSRNOP00000072816 ⟸ ENSRNOT00000089789
RefSeq Acc Id:
XP_038965792 ⟸ XM_039109864
- Peptide Label:
isoform X2
- UniProtKB:
F1LSP7 (UniProtKB/TrEMBL), Q6AY36 (UniProtKB/TrEMBL), A6IJC5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143699 ⟸ XM_063287629
- Peptide Label:
isoform X2
- UniProtKB:
A6IJC5 (UniProtKB/TrEMBL), F1LSP7 (UniProtKB/TrEMBL), Q6AY36 (UniProtKB/TrEMBL)
RGD ID: 13693716 Promoter ID: EPDNEW_R4240 Type: multiple initiation site Name: Coro2a_1 Description: coronin 2A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 62,187,923 - 62,187,983 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-20
Coro2a
coronin 2A
Coro2a
coronin, actin binding protein 2A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Coro2a
coronin, actin binding protein 2A
Coro2a_predicted
coronin, actin binding protein 2A (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Coro2a_predicted
coronin, actin binding protein 2A (predicted)
Symbol and Name status set to approved
70820 APPROVED
