Lurap1l (leucine rich adaptor protein 1-like)

Advanced Search (OLGA)

Gene: Lurap1l (leucine rich adaptor protein 1-like) Rattus norvegicus

Analyze

Symbol:

Lurap1l

Name:

leucine rich adaptor protein 1-like

RGD ID:

1308059

Description:

Predicted to be involved in regulation of signal transduction. Orthologous to human LURAP1L (leucine rich adaptor protein 1 like); INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC362535; LOC362535; MGC109234; RGD1308059; similar to DNA segment, Chr 4, Brigham & Womens Genetics 0951 expressed; uncharacterized protein C9orf150 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	100,402,921 - 100,455,479 (+)	NCBI		GRCr8
mRatBN7.2	5	95,362,005 - 95,409,439 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	95,362,005 - 95,409,438 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	97,741,551 - 97,801,762 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	99,562,563 - 99,610,036 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	99,552,400 - 99,612,615 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	98,468,039 - 98,515,126 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	98,469,047 - 98,515,125 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	102,512,705 - 102,558,784 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	99,599,574 - 99,647,041 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	99,604,799 - 99,652,266 (+)	NCBI
Celera	5	93,934,901 - 93,982,041 (+)	NCBI		Celera
Cytogenetic Map	5	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Liver Cirrhosis (ISO)

Tracheoesophageal Fistula (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

1-nitropyrene (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3',5'-cyclic AMP (EXP)

4,4'-diaminodiphenylmethane (EXP)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (EXP,ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

azathioprine (ISO)

azoxystrobin (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium dichloride (EXP,ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chlorpyrifos (EXP)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

DDE (ISO)

Didecyldimethylammonium (ISO)

diuron (EXP,ISO)

endosulfan (EXP)

ethanol (ISO)

fluoranthene (ISO)

folic acid (ISO)

gentamycin (EXP)

glafenine (EXP)

glyphosate (EXP)

imidacloprid (EXP)

inulin (ISO)

leflunomide (ISO)

levofloxacin (EXP)

metformin (EXP)

methylparaben (ISO)

mono(2-ethylhexyl) phthalate (EXP)

N-nitrosodimethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

nickel sulfate (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenformin (EXP)

pregnenolone 16alpha-carbonitrile (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

thiabendazole (EXP)

thioacetamide (EXP)

trichloroethene (ISO)

trichostatin A (ISO)

triclosan (ISO)

triphenyl phosphate (EXP)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of canonical NF-kappaB signal transduction (IEA)

regulation of signal transduction (IBA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334

Genomics

Comparative Map Data

Lurap1l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	100,402,921 - 100,455,479 (+)	NCBI		GRCr8
mRatBN7.2	5	95,362,005 - 95,409,439 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	95,362,005 - 95,409,438 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	97,741,551 - 97,801,762 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	99,562,563 - 99,610,036 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	99,552,400 - 99,612,615 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	98,468,039 - 98,515,126 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	98,469,047 - 98,515,125 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	102,512,705 - 102,558,784 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	99,599,574 - 99,647,041 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	99,604,799 - 99,652,266 (+)	NCBI
Celera	5	93,934,901 - 93,982,041 (+)	NCBI		Celera
Cytogenetic Map	5	q31	NCBI

LURAP1L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	12,775,020 - 12,823,060 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	12,775,020 - 12,823,060 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	12,775,019 - 12,823,059 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	12,765,012 - 12,813,059 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	12,765,011 - 12,813,058	NCBI
Celera	9	12,707,578 - 12,755,676 (+)	NCBI		Celera
Cytogenetic Map	9	p23	NCBI
HuRef	9	12,739,601 - 12,787,743 (+)	NCBI		HuRef
CHM1_1	9	12,775,334 - 12,823,392 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	12,784,296 - 12,832,387 (+)	NCBI		T2T-CHM13v2.0

Lurap1l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	80,828,923 - 80,872,538 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	80,828,883 - 80,873,865 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	80,910,686 - 80,954,301 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	80,910,646 - 80,955,628 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	80,556,590 - 80,600,205 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	80,381,917 - 80,425,532 (+)	NCBI		MGSCv36	mm8
Celera	4	79,465,779 - 79,509,552 (+)	NCBI		Celera
Cytogenetic Map	4	C3	NCBI
cM Map	4	37.91	NCBI

Lurap1l
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955434	15,995,549 - 16,035,055 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955434	15,995,549 - 16,035,055 (+)	NCBI	ChiLan1.0	ChiLan1.0

LURAP1L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	111,711,836 - 111,760,337 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	111,716,849 - 111,765,826 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	12,613,596 - 12,662,950 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	13,061,445 - 13,110,852 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	13,061,445 - 13,109,923 (+)	Ensembl	panpan1.1		panPan2

LURAP1L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	33,388,300 - 33,437,549 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	33,388,633 - 33,436,246 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	32,098,586 - 32,147,310 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	34,294,095 - 34,342,801 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	34,294,847 - 34,342,801 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	33,000,049 - 33,048,799 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	32,785,135 - 32,833,387 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	33,447,312 - 33,496,051 (+)	NCBI		UU_Cfam_GSD_1.0

Lurap1l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	148,167,431 - 148,216,200 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936539	6,619,922 - 6,668,214 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936539	6,620,747 - 6,668,544 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LURAP1L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	209,620,907 - 209,668,913 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	209,621,712 - 209,668,924 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	233,577,587 - 233,603,961 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LURAP1L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	66,726,211 - 66,773,620 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	66,726,215 - 66,773,627 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	54,961,564 - 55,008,847 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lurap1l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624736	17,091,198 - 17,141,023 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624736	17,091,115 - 17,137,503 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Lurap1l
322 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	61
Count of miRNA genes:	43
Interacting mature miRNAs:	57
Transcripts:	ENSRNOT00000041374
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357396	Bw44	Body weight QTL 44	4.19		body mass (VT:0001259)	body weight (CMO:0000012)	5	68984307	104251008	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
61380	Edpm5	Estrogen-dependent pituitary mass QTL 5	4.5	0.92	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	5	68984307	104251008	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1298070	Scl18	Serum cholesterol level QTL 18	3.7		blood LDL cholesterol amount (VT:0000181)	calculated plasma low density lipoprotein cholesterol level (CMO:0001245)	5	79584860	124584860	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1357402	Bw46	Body weight QTL 46	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
2302381	Bw84	Body weight QTL 84	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1331782	Rf36	Renal function QTL 36	3.296		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	83840598	97059958	Rat
1598859	Cm66	Cardiac mass QTL 66	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	79584860	124584860	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	87468046	132468046	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
1598846	Bp293	Blood pressure QTL 293	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	79584860	124584860	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	90067849	128034027	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84132602	129132602	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	64719390	109719390	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
2312671	Scl64	Serum cholesterol level QTL 64		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	68984307	104251008	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	87765973	132765973	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	90067849	128034027	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat

Markers in Region

AV077978

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	95,409,310 - 95,409,391 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	98,514,998 - 98,515,078	NCBI	Rnor6.0
Rnor_5.0	5	102,558,656 - 102,558,736	UniSTS	Rnor5.0
RGSC_v3.4	5	99,646,913 - 99,646,993	UniSTS	RGSC3.4
Celera	5	93,981,913 - 93,981,993	UniSTS
Cytogenetic Map	5	q31	UniSTS

D4Bwg0951e

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	95,409,308 - 95,409,436 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	98,514,996 - 98,515,123	NCBI	Rnor6.0
Rnor_5.0	5	102,558,654 - 102,558,781	UniSTS	Rnor5.0
RGSC_v3.4	5	99,646,911 - 99,647,038	UniSTS	RGSC3.4
Celera	5	93,981,911 - 93,982,038	UniSTS
Cytogenetic Map	5	q31	UniSTS

AV175137

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	95,409,310 - 95,409,439 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	98,514,998 - 98,515,126	NCBI	Rnor6.0
Rnor_5.0	5	102,558,656 - 102,558,784	UniSTS	Rnor5.0
RGSC_v3.4	5	99,646,913 - 99,647,041	UniSTS	RGSC3.4
Celera	5	93,981,913 - 93,982,041	UniSTS
Cytogenetic Map	5	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593479	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000041374 ⟹ ENSRNOP00000045285

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	95,362,005 - 95,409,438 (+)	Ensembl
Rnor_6.0 Ensembl	5	98,469,047 - 98,515,125 (+)	Ensembl

RefSeq Acc Id:

NM_001025022 ⟹ NP_001020193

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	100,408,040 - 100,455,479 (+)	NCBI
mRatBN7.2	5	95,362,005 - 95,409,439 (+)	NCBI
Rnor_6.0	5	98,469,047 - 98,515,126 (+)	NCBI
Rnor_5.0	5	102,512,705 - 102,558,784 (+)	NCBI
RGSC_v3.4	5	99,599,574 - 99,647,041 (+)	RGD
Celera	5	93,934,901 - 93,982,041 (+)	RGD

Sequence:

show sequence

CGGGGACCCAGGCCGGGCCCGGGGAGCCCAGTGCTGAGCTCTAGAGCCCGCCAGGCCGCCGCCT
CCTCGCGCCCTCTGCCTTTACTGTCAGTGTCGCCCCTCGCAAAGAGTCATGGAAGACGGTCCGC
TGCCAGATCTCAGAGACATCGAGCTGAAGCTGGGGCGCAAAGTGCCCGAGAGCCTAGCGCGCTC
GCTGCGCGGGGAGGAGCCGGCGCCCCGGGAAGGGGCTGCGGACCCCAGCGGGGTTGGTGGGAGC
TGCAGCAGCAGCAGTAGCTGCAGCAGCTTCGCGCCCTCCGTGTCCTCCTCGTCTTCATCCTCCC
CTGCCTCCGGCTCCCCACGACGTAGCCACCCCAGCGCCCTGGAGAGGCTAGAGACCAAACTGCA
CATCCTCAGGCAGGAGATGGTGAACCTCAGAGCCACTGACGTAAGGCTCATGCGTCAATTGCTC
CTCATCAATGAGAGCATCGAGTCCATCAAGTGGATGATTGAGGAAAAGGCCACCGTTACCAGCC
GAGGCAGCAGTCTCAGTGGCAGCCTGTGTAGTTTGCTGGAGAGTCAGAGCACCTCCTTACGTGG
CAGCTACAACAGCCTCCATGATGGCAGTGATGGGCTGGATGGCATCTCGGTAGGGAGCTACCTG
GACACTTTGGCAGATGATGTACCAGGCCATCAGACCCCTTCAGACTTGGATCAGTTCAGTGACA
GCTCTATCATAGAGGACTCTCAAGCTCTGCACAAGCATCCCAAGCTGGATTCTGAGTACTACTG
CTTTGGCTAATGATCCACGTTTTTGCATGGGACTGATGTGCAATTAACTTGTATGTATCCTTCT
TCTCTGCTGCTATATTTTTGGTGTGATTTATTTTAATAAGGCAACCTTTTTAAAGAAGCTTATT
TTTAAACTGCTTAATGAAATTTCTGTTGCTCCTAATACTTCTCATCTAGACTGATTTATTTTTC
TCTGTTACATCTCTATTTTTATTTATTGTAATAATCTTTCTCCCTTCTCTTACAGTAGCACAGA
CAAAGTAGAGGGGGAAAATAAGCAATAATTGTTTCTGCTTTTGTTTTCAGAGTGAGGGGTCAGG
GATTATATGAAACACTTTGCTAAGTTTTACAATAAACCAAAGTCTGATCACTTCCTTCAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063287940 ⟹ XP_063144010

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	100,402,921 - 100,455,479 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020193	(Get FASTA)	NCBI Sequence Viewer
	XP_063144010	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91300	(Get FASTA)	NCBI Sequence Viewer
	EDM10477	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000045285.4
GenBank Protein	Q5BJW5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020193 ⟸ NM_001025022

- UniProtKB:

Q5BJW5 (UniProtKB/Swiss-Prot), A6J830 (UniProtKB/TrEMBL), A0A8L2QP13 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEDGPLPDLRDIELKLGRKVPESLARSLRGEEPAPREGAADPSGVGGSCSSSSSCSSFAPSVSS
SSSSSPASGSPRRSHPSALERLETKLHILRQEMVNLRATDVRLMRQLLLINESIESIKWMIEEK
ATVTSRGSSLSGSLCSLLESQSTSLRGSYNSLHDGSDGLDGISVGSYLDTLADDVPGHQTPSDL
DQFSDSSIIEDSQALHKHPKLDSEYYCFG

hide sequence

Ensembl Acc Id:

ENSRNOP00000045285 ⟸ ENSRNOT00000041374

RefSeq Acc Id:	XP_063144010 ⟸ XM_063287940
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BJW5-F1-model_v2	AlphaFold	Q5BJW5	1-221	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308059	AgrOrtholog
BioCyc Gene	G2FUF-40916	BioCyc
Ensembl Genes	ENSRNOG00000033740	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000041374.4	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7309480	IMAGE-MGC_LOAD
InterPro	LURA1/LRA25	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LURAP1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:362535	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:109234	IMAGE-MGC_LOAD
NCBI Gene	362535	ENTREZGENE
PANTHER	LEUCINE RICH ADAPTOR PROTEIN 1-LIKE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR33767	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	LURAP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Lurap1l	PhenoGen
RatGTEx	ENSRNOG00000033740	RatGTEx
UniProt	A0A8L2QP13	ENTREZGENE, UniProtKB/TrEMBL
	A6J830	ENTREZGENE, UniProtKB/TrEMBL
	LUR1L_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-10	Lurap1l	leucine rich adaptor protein 1-like	RGD1308059	similar to DNA segment, Chr 4, Brigham & Womens Genetics 0951 expressed	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1308059	similar to DNA segment, Chr 4, Brigham & Womens Genetics 0951 expressed	RGD1308059_predicted	similar to DNA segment, Chr 4, Brigham & Womens Genetics 0951 expressed (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1308059_predicted	similar to DNA segment, Chr 4, Brigham & Womens Genetics 0951 expressed (predicted)	LOC362535_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC362535_predicted	similar to DNA segment, Chr 4, Brigham & Womens Genetics 0951 expressed (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD