Symbol:
Dhrs11
Name:
dehydrogenase/reductase 11
RGD ID:
1307935
Description:
Predicted to enable 17-beta-hydroxysteroid dehydrogenase (NADP+) activity; 3-beta-hydroxysteroid 3-dehydrogenase (NADP+) activity; and estradiol 17-beta-dehydrogenase [NAD(P)+] activity. Predicted to be involved in steroid biosynthetic process. Orthologous to human DHRS11 (dehydrogenase/reductase 11); INTERACTS WITH (+)-schisandrin B; bisphenol A; gentamycin.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
dehydrogenase/reductase (SDR family) member 11; dehydrogenase/reductase SDR family member 11; LOC360583; RGD1307935; similar to Hypothetical protein MGC18716
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DHRS11 (dehydrogenase/reductase 11) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Dhrs11 (dehydrogenase/reductase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dhrs11 (dehydrogenase/reductase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DHRS11 (dehydrogenase/reductase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DHRS11 (dehydrogenase/reductase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dhrs11 (dehydrogenase/reductase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DHRS11 (dehydrogenase/reductase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DHRS11 (dehydrogenase/reductase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dhrs11 (dehydrogenase/reductase 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
KLHL6 (kelch like family member 6) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Dhrs11 (dehydrogenase/reductase 11)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
DHRS11 (dehydrogenase/reductase 11)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zgc:92630
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER)
Danio rerio (zebrafish):
dhrs11a (dehydrogenase/reductase (SDR family) member 11a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dhrs11b (dehydrogenase/reductase (SDR family) member 11b)
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG10962
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
YMR226C
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG3301
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG40485
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG40486
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG8757
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG9150
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG9360
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
antdh
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
rdhB
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
dhrs11
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 70,195,637 - 70,205,735 (-) NCBI GRCr8 mRatBN7.2 10 69,698,214 - 69,708,294 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 69,698,214 - 69,708,295 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 74,318,215 - 74,328,174 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 73,822,981 - 73,832,941 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 69,287,649 - 69,297,608 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 72,144,042 - 72,153,496 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 72,144,042 - 72,153,375 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 72,050,901 - 72,060,355 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 73,101,525 - 73,111,478 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 73,115,894 - 73,125,848 (-) NCBI Celera 10 68,626,115 - 68,636,127 (-) NCBI Celera Cytogenetic Map 10 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dhrs11 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DHRS11 mRNA] CTD PMID:31150632 Dhrs11 Rat (-)-demecolcine decreases expression ISO RGD:1601851 6480464 Demecolcine results in decreased expression of DHRS11 mRNA CTD PMID:23649840 Dhrs11 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1317419 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DHRS11 mRNA CTD PMID:36331819 Dhrs11 Rat (1S)-bornane-2,3-dione increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of camphorquinone CTD PMID:30926317 Dhrs11 Rat 1-phenyl-1,2-propanedione increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of 1-phenyl-1,2-propanedione CTD PMID:30926317 Dhrs11 Rat 17beta-estradiol increases oxidation ISO RGD:1601851 6480464 DHRS11 protein results in increased oxidation of Estradiol CTD PMID:30926317 Dhrs11 Rat 17beta-hydroxy-5alpha-androstan-3-one increases oxidation ISO RGD:1601851 6480464 DHRS11 protein results in increased oxidation of Dihydrotestosterone CTD PMID:30926317 Dhrs11 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1317419 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to DHRS11 gene] CTD PMID:20819909 Dhrs11 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1317419 6480464 Tetrachlorodibenzodioxin results in increased expression of DHRS11 mRNA CTD PMID:20819909 Dhrs11 Rat 2-hydroxypropanoic acid decreases expression ISO RGD:1601851 6480464 Lactic Acid results in decreased expression of DHRS11 mRNA CTD PMID:30851411 Dhrs11 Rat 3,7,12-trioxo-5beta-cholanic acid increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of Dehydrocholic Acid CTD PMID:30926317 Dhrs11 Rat 3-oxo-5beta-cholanic acid increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of 3-oxocholan-24-oic acid CTD PMID:30926317 Dhrs11 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1601851 6480464 bisphenol S results in increased expression of DHRS11 protein CTD PMID:34186270 Dhrs11 Rat 9,10-phenanthroquinone increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of 9,10-phenanthrenequinone CTD PMID:30926317 Dhrs11 Rat acenaphthoquinone increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of acenaphthenequinone CTD PMID:30926317 Dhrs11 Rat acrylamide decreases expression ISO RGD:1601851 6480464 Acrylamide results in decreased expression of DHRS11 mRNA CTD PMID:32763439 Dhrs11 Rat all-trans-retinoic acid decreases expression ISO RGD:1601851 6480464 Tretinoin results in decreased expression of DHRS11 mRNA CTD PMID:33167477 Dhrs11 Rat androst-4-ene-3,17-dione increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of Androstenedione CTD PMID:30926317 Dhrs11 Rat androst-5-ene-3beta,17beta-diol increases oxidation ISO RGD:1601851 6480464 DHRS11 protein results in increased oxidation of Androstenediol CTD PMID:30926317 Dhrs11 Rat androstane-3,17-dione increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of androstane-3,17-dione CTD PMID:30926317 Dhrs11 Rat androsterone increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of Androsterone CTD PMID:30926317 Dhrs11 Rat apigenin decreases activity ISO RGD:1601851 6480464 Apigenin results in decreased activity of DHRS11 protein CTD PMID:30926317 Dhrs11 Rat aristolochic acid A increases expression ISO RGD:1601851 6480464 aristolochic acid I results in increased expression of DHRS11 mRNA CTD PMID:33212167 Dhrs11 Rat arsane multiple interactions ISO RGD:1601851 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Dhrs11 Rat arsenic acid multiple interactions ISO RGD:1601851 6480464 [sodium arsenate results in increased abundance of arsenic acid] which results in decreased expression of more ... CTD PMID:38630284 Dhrs11 Rat arsenic atom multiple interactions ISO RGD:1601851 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Dhrs11 Rat arsenite(3-) multiple interactions ISO RGD:1601851 6480464 [sodium arsenite results in increased abundance of arsenite] which results in decreased expression of DHRS11 more ... CTD PMID:38630284 Dhrs11 Rat benzo[a]pyrene increases methylation ISO RGD:1601851 6480464 Benzo(a)pyrene results in increased methylation of DHRS11 promoter CTD PMID:27901495 Dhrs11 Rat beta-lapachone decreases expression ISO RGD:1601851 6480464 beta-lapachone results in decreased expression of DHRS11 mRNA CTD PMID:38218311 Dhrs11 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DHRS11 mRNA CTD PMID:25181051 Dhrs11 Rat bisphenol A increases expression ISO RGD:1317419 6480464 bisphenol A results in increased expression of DHRS11 mRNA CTD PMID:34585602 Dhrs11 Rat bisphenol A decreases expression ISO RGD:1601851 6480464 bisphenol A results in decreased expression of DHRS11 mRNA CTD PMID:29275510 Dhrs11 Rat Bisphenol B increases expression ISO RGD:1601851 6480464 bisphenol B results in increased expression of DHRS11 protein CTD PMID:34186270 Dhrs11 Rat bisphenol F increases expression ISO RGD:1601851 6480464 bisphenol F results in increased expression of DHRS11 protein CTD PMID:34186270 Dhrs11 Rat cadmium dichloride decreases expression ISO RGD:1601851 6480464 Cadmium Chloride results in decreased expression of DHRS11 mRNA CTD PMID:38568856 Dhrs11 Rat cantharidin decreases expression ISO RGD:1317419 6480464 Cantharidin results in decreased expression of DHRS11 mRNA CTD PMID:36907384 Dhrs11 Rat CARBENOXOLONE decreases activity ISO RGD:1601851 6480464 Carbenoxolone results in decreased activity of DHRS11 protein CTD PMID:30926317 Dhrs11 Rat carbon nanotube decreases expression ISO RGD:1317419 6480464 Nanotubes, Carbon analog results in decreased expression of DHRS11 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25620056 Dhrs11 Rat chlorpyrifos increases expression ISO RGD:1317419 6480464 Chlorpyrifos results in increased expression of DHRS11 mRNA CTD PMID:37019170 Dhrs11 Rat chromium(6+) multiple interactions ISO RGD:1601851 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ... CTD PMID:38479592 Dhrs11 Rat copper(II) sulfate decreases expression ISO RGD:1601851 6480464 Copper Sulfate results in decreased expression of DHRS11 mRNA CTD PMID:19549813 Dhrs11 Rat cyclosporin A decreases expression ISO RGD:1601851 6480464 Cyclosporine results in decreased expression of DHRS11 mRNA CTD PMID:20106945|PMID:25562108 Dhrs11 Rat DDE increases expression ISO RGD:1601851 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of DHRS11 mRNA CTD PMID:38568856 Dhrs11 Rat dehydroepiandrosterone increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of Dehydroepiandrosterone CTD PMID:30926317 Dhrs11 Rat Dibutyl phosphate affects expression ISO RGD:1601851 6480464 di-n-butylphosphoric acid affects the expression of DHRS11 mRNA CTD PMID:37042841 Dhrs11 Rat dibutyl phthalate increases expression ISO RGD:1317419 6480464 Dibutyl Phthalate results in increased expression of DHRS11 mRNA CTD PMID:21266533 Dhrs11 Rat dimethylarsinic acid decreases expression ISO RGD:1601851 6480464 Cacodylic Acid results in decreased expression of DHRS11 mRNA CTD PMID:38630284 Dhrs11 Rat dorsomorphin multiple interactions ISO RGD:1601851 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Dhrs11 Rat estrone increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of Estrone CTD PMID:30926317 Dhrs11 Rat estrone 3-sulfate increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of estrone sulfate CTD PMID:30926317 Dhrs11 Rat fenoprofen decreases activity ISO RGD:1601851 6480464 Fenoprofen results in decreased activity of DHRS11 protein CTD PMID:30926317 Dhrs11 Rat flufenamic acid decreases activity ISO RGD:1601851 6480464 Flufenamic Acid results in decreased activity of DHRS11 protein CTD PMID:30926317 Dhrs11 Rat formaldehyde decreases expression ISO RGD:1601851 6480464 Formaldehyde results in decreased expression of DHRS11 mRNA CTD PMID:23649840 Dhrs11 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of DHRS11 mRNA CTD PMID:22061828|PMID:33387578 Dhrs11 Rat GSK-J4 decreases expression ISO RGD:1601851 6480464 GSK-J4 results in decreased expression of DHRS11 mRNA CTD PMID:29301935 Dhrs11 Rat indometacin decreases activity ISO RGD:1601851 6480464 Indomethacin results in decreased activity of DHRS11 protein CTD PMID:30926317 Dhrs11 Rat isatin increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of Isatin CTD PMID:30926317 Dhrs11 Rat isotretinoin decreases expression ISO RGD:1601851 6480464 Isotretinoin results in decreased expression of DHRS11 mRNA CTD PMID:20436886 Dhrs11 Rat kaempferol decreases activity ISO RGD:1601851 6480464 kaempferol results in decreased activity of DHRS11 protein CTD PMID:30926317 Dhrs11 Rat ketoprofen decreases activity ISO RGD:1601851 6480464 Ketoprofen results in decreased activity of DHRS11 protein CTD PMID:30926317 Dhrs11 Rat lithocholic acid increases oxidation ISO RGD:1601851 6480464 DHRS11 protein results in increased oxidation of Lithocholic Acid CTD PMID:30926317 Dhrs11 Rat luteolin decreases activity ISO RGD:1601851 6480464 Luteolin results in decreased activity of DHRS11 protein CTD PMID:30926317 Dhrs11 Rat manganese atom multiple interactions ISO RGD:1601851 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Dhrs11 Rat manganese(0) multiple interactions ISO RGD:1601851 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Dhrs11 Rat manganese(II) chloride multiple interactions ISO RGD:1601851 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Dhrs11 Rat menadione increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of Vitamin K 3 CTD PMID:30926317 Dhrs11 Rat mercury dibromide decreases expression ISO RGD:1601851 6480464 mercuric bromide results in decreased expression of DHRS11 mRNA CTD PMID:26272509 Dhrs11 Rat mercury dibromide multiple interactions ISO RGD:1601851 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Dhrs11 Rat methidathion increases expression ISO RGD:1317419 6480464 methidathion results in increased expression of DHRS11 mRNA CTD PMID:34813904 Dhrs11 Rat methylarsonic acid decreases expression ISO RGD:1601851 6480464 monomethylarsonic acid results in decreased expression of DHRS11 mRNA CTD PMID:38630284 Dhrs11 Rat methylmercury chloride decreases expression ISO RGD:1601851 6480464 methylmercuric chloride results in decreased expression of DHRS11 mRNA CTD PMID:28001369 Dhrs11 Rat NADP zwitterion multiple interactions ISO RGD:1601851 6480464 NADP binds to and results in increased activity of DHRS11 protein CTD PMID:25526675 Dhrs11 Rat NADP(+) multiple interactions ISO RGD:1601851 6480464 NADP binds to and results in increased activity of DHRS11 protein CTD PMID:25526675 Dhrs11 Rat nickel atom decreases expression ISO RGD:1601851 6480464 Nickel results in decreased expression of DHRS11 mRNA CTD PMID:24768652|PMID:25583101 Dhrs11 Rat nickel sulfate increases expression ISO RGD:1601851 6480464 nickel sulfate results in increased expression of DHRS11 mRNA CTD PMID:22714537 Dhrs11 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DHRS11 mRNA CTD PMID:25729387 Dhrs11 Rat ozone multiple interactions ISO RGD:1317419 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of DHRS11 more ... CTD PMID:34911549 Dhrs11 Rat p-chloromercuribenzoic acid decreases expression ISO RGD:1601851 6480464 p-Chloromercuribenzoic Acid results in decreased expression of DHRS11 mRNA CTD PMID:26272509 Dhrs11 Rat p-chloromercuribenzoic acid multiple interactions ISO RGD:1601851 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Dhrs11 Rat paracetamol decreases expression ISO RGD:1601851 6480464 Acetaminophen results in decreased expression of DHRS11 mRNA CTD PMID:26690555 Dhrs11 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of DHRS11 mRNA CTD PMID:33387578 Dhrs11 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1317419 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DHRS11 mRNA CTD PMID:36331819 Dhrs11 Rat Phenylglyoxal increases reduction ISO RGD:1601851 6480464 DHRS11 protein results in increased reduction of Phenylglyoxal CTD PMID:30926317 Dhrs11 Rat phenylmercury acetate decreases expression ISO RGD:1601851 6480464 Phenylmercuric Acetate results in decreased expression of DHRS11 mRNA CTD PMID:26272509 Dhrs11 Rat phenylmercury acetate multiple interactions ISO RGD:1601851 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Dhrs11 Rat pirinixic acid multiple interactions ISO RGD:1601851 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Dhrs11 Rat pirinixic acid multiple interactions ISO RGD:1317419 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Dhrs11 Rat quercetin decreases activity ISO RGD:1601851 6480464 Quercetin results in decreased activity of DHRS11 protein CTD PMID:30926317 Dhrs11 Rat quercitrin decreases activity ISO RGD:1601851 6480464 quercitrin results in decreased activity of DHRS11 protein CTD PMID:30926317 Dhrs11 Rat rac-lactic acid decreases expression ISO RGD:1601851 6480464 Lactic Acid results in decreased expression of DHRS11 mRNA CTD PMID:30851411 Dhrs11 Rat SB 431542 multiple interactions ISO RGD:1601851 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Dhrs11 Rat sodium arsenate multiple interactions ISO RGD:1601851 6480464 [sodium arsenate results in increased abundance of arsenic acid] which results in decreased expression of more ... CTD PMID:38630284 Dhrs11 Rat sodium arsenite decreases expression ISO RGD:1601851 6480464 sodium arsenite results in decreased expression of DHRS11 mRNA CTD PMID:38568856 Dhrs11 Rat sodium arsenite multiple interactions ISO RGD:1601851 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:38630284|PMID:39836092 Dhrs11 Rat sulforaphane increases expression ISO RGD:1317419 6480464 sulforaphane results in increased expression of DHRS11 mRNA CTD PMID:30529165 Dhrs11 Rat sulforaphane decreases expression ISO RGD:1601851 6480464 sulforaphane results in decreased expression of DHRS11 mRNA CTD PMID:31838189 Dhrs11 Rat sulindac decreases activity ISO RGD:1601851 6480464 Sulindac results in decreased activity of DHRS11 protein CTD PMID:30926317 Dhrs11 Rat suprofen decreases activity ISO RGD:1601851 6480464 Suprofen results in decreased activity of DHRS11 protein CTD PMID:30926317 Dhrs11 Rat temozolomide increases expression ISO RGD:1601851 6480464 Temozolomide results in increased expression of DHRS11 mRNA CTD PMID:31758290 Dhrs11 Rat testosterone increases oxidation ISO RGD:1601851 6480464 DHRS11 protein results in increased oxidation of Testosterone CTD PMID:30926317 Dhrs11 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of DHRS11 mRNA CTD PMID:31150632 Dhrs11 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DHRS11 mRNA] CTD PMID:31150632 Dhrs11 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of DHRS11 mRNA CTD PMID:34492290 Dhrs11 Rat titanium dioxide decreases methylation ISO RGD:1317419 6480464 titanium dioxide results in decreased methylation of DHRS11 gene CTD PMID:35295148 Dhrs11 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DHRS11 mRNA CTD PMID:25729387 Dhrs11 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of DHRS11 mRNA CTD PMID:25729387 Dhrs11 Rat tris(2-butoxyethyl) phosphate affects expression ISO RGD:1601851 6480464 tris(2-butoxyethyl) phosphate affects the expression of DHRS11 mRNA CTD PMID:29024780 Dhrs11 Rat valproic acid decreases methylation ISO RGD:1601851 6480464 Valproic Acid results in decreased methylation of DHRS11 gene CTD PMID:29154799 Dhrs11 Rat valproic acid increases expression ISO RGD:1601851 6480464 Valproic Acid results in increased expression of DHRS11 mRNA CTD PMID:28001369 Dhrs11 Rat vincristine decreases expression ISO RGD:1601851 6480464 Vincristine results in decreased expression of DHRS11 mRNA CTD PMID:23649840 Dhrs11 Rat zoledronic acid decreases expression ISO RGD:1601851 6480464 zoledronic acid results in decreased expression of DHRS11 mRNA CTD PMID:24714768 Dhrs11 Rat zomepirac decreases activity ISO RGD:1601851 6480464 zomepirac results in decreased activity of DHRS11 protein CTD PMID:30926317
(+)-schisandrin B (EXP) (-)-demecolcine (ISO) (1->4)-beta-D-glucan (ISO) (1S)-bornane-2,3-dione (ISO) 1-phenyl-1,2-propanedione (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-hydroxypropanoic acid (ISO) 3,7,12-trioxo-5beta-cholanic acid (ISO) 3-oxo-5beta-cholanic acid (ISO) 4,4'-sulfonyldiphenol (ISO) 9,10-phenanthroquinone (ISO) acenaphthoquinone (ISO) acrylamide (ISO) all-trans-retinoic acid (ISO) androst-4-ene-3,17-dione (ISO) androst-5-ene-3beta,17beta-diol (ISO) androstane-3,17-dione (ISO) androsterone (ISO) apigenin (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic acid (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium dichloride (ISO) cantharidin (ISO) CARBENOXOLONE (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) DDE (ISO) dehydroepiandrosterone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dimethylarsinic acid (ISO) dorsomorphin (ISO) estrone (ISO) estrone 3-sulfate (ISO) fenoprofen (ISO) flufenamic acid (ISO) formaldehyde (ISO) gentamycin (EXP) GSK-J4 (ISO) indometacin (ISO) isatin (ISO) isotretinoin (ISO) kaempferol (ISO) ketoprofen (ISO) lithocholic acid (ISO) luteolin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) mercury dibromide (ISO) methidathion (ISO) methylarsonic acid (ISO) methylmercury chloride (ISO) NADP zwitterion (ISO) NADP(+) (ISO) nickel atom (ISO) nickel sulfate (ISO) oxaliplatin (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) Phenylglyoxal (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) quercetin (ISO) quercitrin (ISO) rac-lactic acid (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sulforaphane (ISO) sulindac (ISO) suprofen (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) tris(2-butoxyethyl) phosphate (ISO) valproic acid (ISO) vincristine (ISO) zoledronic acid (ISO) zomepirac (ISO)
Dhrs11 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 70,195,637 - 70,205,735 (-) NCBI GRCr8 mRatBN7.2 10 69,698,214 - 69,708,294 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 69,698,214 - 69,708,295 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 74,318,215 - 74,328,174 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 73,822,981 - 73,832,941 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 69,287,649 - 69,297,608 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 72,144,042 - 72,153,496 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 72,144,042 - 72,153,375 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 72,050,901 - 72,060,355 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 73,101,525 - 73,111,478 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 73,115,894 - 73,125,848 (-) NCBI Celera 10 68,626,115 - 68,636,127 (-) NCBI Celera Cytogenetic Map 10 q26 NCBI
DHRS11 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 36,591,879 - 36,600,804 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 36,591,879 - 36,600,804 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 34,948,309 - 34,957,233 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 32,022,339 - 32,031,346 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 31,770,502 - 31,779,510 (+) NCBI Celera Cytogenetic Map 17 q12 NCBI HuRef 17 30,885,559 - 30,894,567 (+) NCBI HuRef CHM1_1 17 34,983,359 - 34,992,367 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 37,578,223 - 37,587,148 (+) NCBI T2T-CHM13v2.0
Dhrs11 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 84,711,547 - 84,719,880 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 84,711,682 - 84,719,820 (-) Ensembl GRCm39 Ensembl GRCm38 11 84,820,721 - 84,829,067 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 84,820,856 - 84,828,994 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 84,634,230 - 84,642,505 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 84,636,921 - 84,645,159 (-) NCBI MGSCv36 mm8 Celera 11 94,440,644 - 94,448,907 (-) NCBI Celera Cytogenetic Map 11 C NCBI cM Map 11 51.34 NCBI
Dhrs11 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955451 1,333,384 - 1,343,271 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955451 1,335,134 - 1,343,271 (-) NCBI ChiLan1.0 ChiLan1.0
DHRS11 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 28,159,732 - 28,168,744 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 30,041,620 - 30,050,604 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 20,480,754 - 20,489,736 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 20,776,083 - 20,784,737 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 20,776,083 - 20,784,789 (-) Ensembl panpan1.1 panPan2
DHRS11 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 36,465,449 - 36,473,625 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 36,465,444 - 36,473,414 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 35,691,580 - 35,699,767 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 37,275,246 - 37,283,463 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 37,275,221 - 37,283,463 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 36,057,716 - 36,065,930 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 36,344,450 - 36,352,637 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 36,432,435 - 36,440,622 (+) NCBI UU_Cfam_GSD_1.0
Dhrs11 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 35,441,460 - 35,448,878 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 1,626,106 - 1,633,622 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 1,626,177 - 1,633,578 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DHRS11 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 38,113,912 - 38,123,839 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 38,114,017 - 38,123,360 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 39,732,408 - 39,741,854 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DHRS11 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 31,189,107 - 31,198,435 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 31,189,710 - 31,198,218 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 1,938,493 - 1,947,804 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dhrs11
.
Predicted Target Of
Count of predictions: 79 Count of miRNA genes: 67 Interacting mature miRNAs: 74 Transcripts: ENSRNOT00000030841 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 631565 Hcuc4 Hepatic copper content QTL 4 4.15 liver copper amount (VT:0003065) liver copper weight to liver dry weight ratio (CMO:0001512) 10 66941813 73452992 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2298481 Eau9 Experimental allergic uveoretinitis QTL 9 0.0169 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 65927233 82565079 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 2289985 Bp305 Blood pressure QTL 305 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 67502108 73579767 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
RH131489
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 69,698,355 - 69,698,564 (+) MAPPER mRatBN7.2 Rnor_6.0 10 72,144,184 - 72,144,392 NCBI Rnor6.0 Rnor_5.0 10 72,051,043 - 72,051,251 UniSTS Rnor5.0 RGSC_v3.4 10 73,101,667 - 73,101,875 UniSTS RGSC3.4 Celera 10 68,626,257 - 68,626,465 UniSTS Cytogenetic Map 10 q26 UniSTS
RH127604
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 69,702,700 - 69,702,904 (+) MAPPER mRatBN7.2 mRatBN7.2 10 14,279,208 - 14,279,412 (-) MAPPER mRatBN7.2 mRatBN7.2 10 14,279,208 - 14,279,412 (+) MAPPER mRatBN7.2 mRatBN7.2 10 69,702,700 - 69,702,904 (-) MAPPER mRatBN7.2 Rnor_6.0 10 72,148,529 - 72,148,732 NCBI Rnor6.0 Rnor_6.0 10 14,620,070 - 14,620,273 NCBI Rnor6.0 Rnor_5.0 10 14,437,660 - 14,437,863 UniSTS Rnor5.0 Rnor_5.0 10 72,055,388 - 72,055,591 UniSTS Rnor5.0 RGSC_v3.4 10 14,510,002 - 14,510,205 UniSTS RGSC3.4 RGSC_v3.4 10 73,106,012 - 73,106,215 UniSTS RGSC3.4 Celera 10 68,630,602 - 68,630,805 UniSTS Celera 10 13,951,622 - 13,951,825 UniSTS Cytogenetic Map 10 q26 UniSTS Cytogenetic Map 10 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000030841 ⟹ ENSRNOP00000038582
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 69,698,214 - 69,708,295 (-) Ensembl Rnor_6.0 Ensembl 10 72,144,042 - 72,153,375 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096426 ⟹ ENSRNOP00000093907
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 69,698,214 - 69,708,295 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102513 ⟹ ENSRNOP00000079543
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 69,698,214 - 69,708,295 (-) Ensembl
RefSeq Acc Id:
NM_001014119 ⟹ NP_001014141
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,195,637 - 70,205,596 (-) NCBI mRatBN7.2 10 69,698,214 - 69,708,173 (-) NCBI Rnor_6.0 10 72,144,042 - 72,153,375 (-) NCBI Rnor_5.0 10 72,050,901 - 72,060,355 (-) NCBI RGSC_v3.4 10 73,101,525 - 73,111,478 (-) RGD Celera 10 68,626,115 - 68,636,127 (-) NCBI
Sequence:
CGCGCCCGCCCCAGCAGTGACCAGGGAGCTACCGAGCTTCAGTAACTCTAGACTAAACTCCGCGATCCCAGTGCCTAGTTCGCCGAACGAGGTGGGCAGACGGCTCGGGACCATGACCAGAGCTGGCA
hide sequence
RefSeq Acc Id:
XM_008768069 ⟹ XP_008766291
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,195,637 - 70,205,735 (-) NCBI mRatBN7.2 10 69,698,214 - 69,708,250 (-) NCBI Rnor_6.0 10 72,144,042 - 72,153,476 (-) NCBI
Sequence:
GCGATGTGGCCCAGTGTGGAGGTCCCGAGGGCGGAGCCCCGGCCGGAGGCCGGCCCGCAAGGGG
hide sequence
RefSeq Acc Id:
XM_039086366 ⟹ XP_038942294
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,195,637 - 70,205,735 (-) NCBI mRatBN7.2 10 69,698,214 - 69,708,294 (-) NCBI
RefSeq Acc Id:
XM_039086367 ⟹ XP_038942295
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,195,637 - 70,205,680 (-) NCBI mRatBN7.2 10 69,698,214 - 69,708,258 (-) NCBI
RefSeq Acc Id:
XM_039086368 ⟹ XP_038942296
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,195,637 - 70,205,735 (-) NCBI mRatBN7.2 10 69,698,214 - 69,708,249 (-) NCBI
RefSeq Acc Id:
XM_039086372 ⟹ XP_038942300
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,195,637 - 70,205,704 (-) NCBI mRatBN7.2 10 69,698,214 - 69,708,282 (-) NCBI
RefSeq Acc Id:
XM_063269384 ⟹ XP_063125454
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,195,637 - 70,205,735 (-) NCBI
RefSeq Acc Id:
XM_063269385 ⟹ XP_063125455
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,195,637 - 70,205,735 (-) NCBI
RefSeq Acc Id:
XM_063269386 ⟹ XP_063125456
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,196,306 - 70,205,735 (-) NCBI
RefSeq Acc Id:
XM_063269387 ⟹ XP_063125457
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,195,637 - 70,205,692 (-) NCBI
RefSeq Acc Id:
XM_063269388 ⟹ XP_063125458
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,196,306 - 70,205,735 (-) NCBI
RefSeq Acc Id:
XM_063269390 ⟹ XP_063125460
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,195,637 - 70,205,716 (-) NCBI
RefSeq Acc Id:
XM_063269391 ⟹ XP_063125461
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,196,306 - 70,205,712 (-) NCBI
RefSeq Acc Id:
NP_001014141 ⟸ NM_001014119
- UniProtKB:
A6HHL9 (UniProtKB/TrEMBL)
- Sequence:
MTRAGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCDLSNEEDILSMFSAVRSQHSGVDICINNAGMARPDSLLSGSTSGWKDMFNVNVLALSIC
hide sequence
RefSeq Acc Id:
XP_008766291 ⟸ XM_008768069
- Peptide Label:
isoform X3
- UniProtKB:
G3V978 (UniProtKB/TrEMBL)
- Sequence:
MWPSVEVPRAEPRPEAGPQGVGSRRSSNISKLPAPAPAVTRELPSFSNSRLNSAIPVPSSPNEV
hide sequence
Ensembl Acc Id:
ENSRNOP00000038582 ⟸ ENSRNOT00000030841
RefSeq Acc Id:
XP_038942294 ⟸ XM_039086366
- Peptide Label:
isoform X4
- UniProtKB:
G3V978 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942300 ⟸ XM_039086372
- Peptide Label:
isoform X12
RefSeq Acc Id:
XP_038942295 ⟸ XM_039086367
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_038942296 ⟸ XM_039086368
- Peptide Label:
isoform X9
Ensembl Acc Id:
ENSRNOP00000079543 ⟸ ENSRNOT00000102513
Ensembl Acc Id:
ENSRNOP00000093907 ⟸ ENSRNOT00000096426
RefSeq Acc Id:
XP_063125455 ⟸ XM_063269385
- Peptide Label:
isoform X2
- UniProtKB:
G3V978 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125454 ⟸ XM_063269384
- Peptide Label:
isoform X1
- UniProtKB:
G3V978 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125460 ⟸ XM_063269390
- Peptide Label:
isoform X10
- UniProtKB:
A0A8I5ZNH0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125457 ⟸ XM_063269387
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063125458 ⟸ XM_063269388
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_063125456 ⟸ XM_063269386
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6AKI1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125461 ⟸ XM_063269391
- Peptide Label:
isoform X11
RGD ID: 13697552 Promoter ID: EPDNEW_R8077 Type: initiation region Name: Dhrs11_1 Description: dehydrogenase/reductase 11 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 72,153,382 - 72,153,442 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-06-01
Dhrs11
dehydrogenase/reductase 11
Dhrs11
dehydrogenase/reductase (SDR family) member 11
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-06-12
Dhrs11
dehydrogenase/reductase (SDR family) member 11
RGD1307935
similar to Hypothetical protein MGC18716
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
RGD1307935
similar to Hypothetical protein MGC18716
RGD1307935_predicted
similar to Hypothetical protein MGC18716 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1307935_predicted
similar to Hypothetical protein MGC18716 (predicted)
LOC360583_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC360583_predicted
similar to Hypothetical protein MGC18716 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
