Ciao2a (cytosolic iron-sulfur assembly component 2A) - Rat Genome Database

Ciao2a (cytosolic iron-sulfur assembly component 2A) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Ciao2a (cytosolic iron-sulfur assembly component 2A) Rattus norvegicus

Subscribe to Updates

Symbol:

Ciao2a

Name:

cytosolic iron-sulfur assembly component 2A

RGD ID:

1307481

Description:

Predicted to be involved in protein maturation. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of cytosolic [4Fe-4S] assembly targeting complex. Orthologous to human CIAO2A (cytosolic iron-sulfur assembly component 2A); PARTICIPATES IN cytosolic iron-sulfur cluster protein assembly pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

Previously known as:

Fam96a; family with sequence similarity 96, member A; LOC300797; MGC105538; MIP18 family protein FAM96A; RGD1307481; similar to RIKEN cDNA 5730536A07

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	75,565,620 - 75,577,542 (+)	NCBI		GRCr8
mRatBN7.2	8	66,670,533 - 66,682,455 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	66,670,483 - 66,682,455 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	72,183,136 - 72,195,001 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	70,456,195 - 70,468,054 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	68,326,000 - 68,337,909 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	71,786,336 - 71,798,258 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	71,786,310 - 71,798,266 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	71,455,249 - 71,467,171 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	70,410,776 - 70,422,702 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	70,429,829 - 70,441,755 (+)	NCBI
Celera	8	66,058,924 - 66,070,845 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ciao2a	Rat	Bloom syndrome		ISO	CIAO2A (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bloom syndrome	ClinVar	PMID:28492532
Ciao2a	Rat	colorectal cancer		ISO	CIAO2A (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial colorectal cancer	ClinVar	PMID:28492532
Ciao2a	Rat	nemaline myopathy 6		ISO	CIAO2A (Homo sapiens)	8554872	ClinVar Annotator: match by term: Nemaline myopathy 6	ClinVar	PMID:21681106 and PMID:24525055

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ciao2a	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Ciao2a (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of FAM96A mRNA	CTD	PMID:22206623
Ciao2a	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Ciao2a (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CIAO2A mRNA	CTD	PMID:22206623
Ciao2a	Rat	17beta-estradiol	increases expression	ISO	Ciao2a (Mus musculus)	6480464	Estradiol results in increased expression of CIAO2A mRNA	CTD	PMID:39298647
Ciao2a	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of CIAO2A mRNA	CTD	PMID:32109520 and PMID:33387578
Ciao2a	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Ciao2a (Mus musculus)	6480464	bisphenol S results in increased expression of CIAO2A mRNA	CTD	PMID:39298647
Ciao2a	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of FAM96A mRNA	CTD	PMID:30047161
Ciao2a	Rat	aflatoxin B1	decreases methylation	ISO	CIAO2A (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of CIAO2A gene	CTD	PMID:27153756
Ciao2a	Rat	antimycin A	decreases expression	ISO	CIAO2A (Homo sapiens)	6480464	Antimycin A results in decreased expression of CIAO2A mRNA	CTD	PMID:33512557
Ciao2a	Rat	antirheumatic drug	decreases expression	ISO	CIAO2A (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of CIAO2A mRNA	CTD	PMID:24449571
Ciao2a	Rat	arsane	multiple interactions	ISO	CIAO2A (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CIAO2A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of CIAO2A mRNA	CTD	PMID:39836092
Ciao2a	Rat	arsenic atom	multiple interactions	ISO	CIAO2A (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CIAO2A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of CIAO2A mRNA	CTD	PMID:39836092
Ciao2a	Rat	arsenite(3-)	multiple interactions	ISO	CIAO2A (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to CIAO2A mRNA]	CTD	PMID:32406909
Ciao2a	Rat	beta-lapachone	increases expression	ISO	CIAO2A (Homo sapiens)	6480464	beta-lapachone results in increased expression of FAM96A mRNA	CTD	PMID:38218311
Ciao2a	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of CIAO2A mRNA	CTD	PMID:25181051
Ciao2a	Rat	bisphenol A	increases expression	ISO	CIAO2A (Homo sapiens)	6480464	bisphenol A results in increased expression of CIAO2A protein	CTD	PMID:33376534
Ciao2a	Rat	bisphenol F	increases expression	ISO	Ciao2a (Mus musculus)	6480464	bisphenol F results in increased expression of CIAO2A mRNA	CTD	PMID:38685157
Ciao2a	Rat	cadmium atom	decreases expression	ISO	CIAO2A (Homo sapiens)	6480464	Cadmium results in decreased expression of CIAO2A mRNA	CTD	PMID:23369406
Ciao2a	Rat	carbon nanotube	increases expression	ISO	Ciao2a (Mus musculus)	6480464	Nanotubes and Carbon analog results in increased expression of CIAO2A mRNA	CTD	PMID:25554681
Ciao2a	Rat	CGP 52608	multiple interactions	ISO	CIAO2A (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to FAM96A gene]	CTD	PMID:28238834
Ciao2a	Rat	cisplatin	increases expression	ISO	CIAO2A (Homo sapiens)	6480464	Cisplatin results in increased expression of CIAO2A mRNA	CTD	PMID:27392435
Ciao2a	Rat	copper(II) sulfate	decreases expression	ISO	CIAO2A (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of CIAO2A mRNA	CTD	PMID:19549813
Ciao2a	Rat	crocidolite asbestos	decreases expression	ISO	Ciao2a (Mus musculus)	6480464	Asbestos and Crocidolite results in decreased expression of CIAO2A mRNA	CTD	PMID:29279043
Ciao2a	Rat	cyclosporin A	decreases expression	ISO	CIAO2A (Homo sapiens)	6480464	Cyclosporine results in decreased expression of CIAO2A mRNA	CTD	PMID:20106945 and PMID:25562108
Ciao2a	Rat	DDE	increases expression	ISO	CIAO2A (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of CIAO2A mRNA	CTD	PMID:38568856
Ciao2a	Rat	dibutyl phthalate	decreases expression	ISO	Ciao2a (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of CIAO2A mRNA	CTD	PMID:21266533
Ciao2a	Rat	dicrotophos	decreases expression	ISO	CIAO2A (Homo sapiens)	6480464	dicrotophos results in decreased expression of CIAO2A mRNA	CTD	PMID:28302478
Ciao2a	Rat	doxorubicin	increases expression	ISO	CIAO2A (Homo sapiens)	6480464	Doxorubicin results in increased expression of CIAO2A mRNA	CTD	PMID:29803840
Ciao2a	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of CIAO2A mRNA	CTD	PMID:24136188
Ciao2a	Rat	folic acid	multiple interactions	ISO	Ciao2a (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CIAO2A mRNA	CTD	PMID:22206623
Ciao2a	Rat	folic acid	decreases expression	ISO	Ciao2a (Mus musculus)	6480464	Folic Acid results in decreased expression of FAM96A mRNA	CTD	PMID:25629700
Ciao2a	Rat	ivermectin	decreases expression	ISO	CIAO2A (Homo sapiens)	6480464	Ivermectin results in decreased expression of CIAO2A protein	CTD	PMID:32959892
Ciao2a	Rat	manganese atom	multiple interactions	ISO	CIAO2A (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CIAO2A mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of CIAO2A mRNA	CTD	PMID:39836092
Ciao2a	Rat	manganese(0)	multiple interactions	ISO	CIAO2A (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CIAO2A mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of CIAO2A mRNA	CTD	PMID:39836092
Ciao2a	Rat	manganese(II) chloride	multiple interactions	ISO	CIAO2A (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CIAO2A mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of CIAO2A mRNA	CTD	PMID:39836092
Ciao2a	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of FAM96A mRNA	CTD	PMID:30047161
Ciao2a	Rat	monosodium L-glutamate	multiple interactions	ISO	Ciao2a (Mus musculus)	6480464	[Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of CIAO2A mRNA	CTD	PMID:22078008
Ciao2a	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of CIAO2A mRNA	CTD	PMID:24136188
Ciao2a	Rat	nimesulide	increases expression	EXP		6480464	nimesulide results in increased expression of CIAO2A mRNA	CTD	PMID:24136188
Ciao2a	Rat	nitrates	multiple interactions	ISO	Ciao2a (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of CIAO2A mRNA	CTD	PMID:35964746
Ciao2a	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of CIAO2A mRNA	CTD	PMID:25729387
Ciao2a	Rat	ozone	multiple interactions	ISO	Ciao2a (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of CIAO2A mRNA	CTD	PMID:34911549
Ciao2a	Rat	paracetamol	decreases expression	ISO	CIAO2A (Homo sapiens)	6480464	Acetaminophen results in decreased expression of CIAO2A mRNA	CTD	PMID:29067470
Ciao2a	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of CIAO2A mRNA	CTD	PMID:33387578
Ciao2a	Rat	perfluorobutanesulfonic acid	increases expression	ISO	CIAO2A (Homo sapiens)	6480464	perfluorobutanesulfonic acid results in increased expression of CIAO2A mRNA	CTD	PMID:33772556
Ciao2a	Rat	perfluorooctane-1-sulfonic acid	increases expression	ISO	CIAO2A (Homo sapiens)	6480464	perfluorooctane sulfonic acid results in increased expression of CIAO2A mRNA	CTD	PMID:33772556
Ciao2a	Rat	perfluorooctanoic acid	increases expression	ISO	CIAO2A (Homo sapiens)	6480464	perfluorooctanoic acid results in increased expression of CIAO2A mRNA	CTD	PMID:33772556
Ciao2a	Rat	pirinixic acid	increases expression	ISO	Ciao2a (Mus musculus)	6480464	pirinixic acid results in increased expression of CIAO2A mRNA	CTD	PMID:23811191
Ciao2a	Rat	rotenone	decreases expression	ISO	CIAO2A (Homo sapiens)	6480464	Rotenone results in decreased expression of CIAO2A mRNA	CTD	PMID:33512557
Ciao2a	Rat	sodium arsenite	decreases expression	ISO	CIAO2A (Homo sapiens)	6480464	sodium arsenite results in decreased expression of CIAO2A mRNA	CTD	PMID:38568856
Ciao2a	Rat	sodium arsenite	multiple interactions	ISO	CIAO2A (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CIAO2A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of CIAO2A mRNA	CTD	PMID:39836092
Ciao2a	Rat	sodium arsenite	increases expression	ISO	CIAO2A (Homo sapiens)	6480464	sodium arsenite results in increased expression of CIAO2A mRNA	CTD	PMID:34032870
Ciao2a	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of FAM96A mRNA	CTD	PMID:30047161
Ciao2a	Rat	tetrachloromethane	increases expression	ISO	Ciao2a (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of CIAO2A mRNA	CTD	PMID:31919559
Ciao2a	Rat	tolcapone	decreases expression	EXP		6480464	tolcapone results in decreased expression of CIAO2A mRNA	CTD	PMID:24136188
Ciao2a	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of CIAO2A mRNA	CTD	PMID:25729387
Ciao2a	Rat	triadimefon	increases expression	EXP		6480464	triadimefon results in increased expression of FAM96A mRNA	CTD	PMID:30047161
Ciao2a	Rat	trimellitic anhydride	increases expression	ISO	Ciao2a (Mus musculus)	6480464	trimellitic anhydride results in increased expression of CIAO2A mRNA	CTD	PMID:19042947
Ciao2a	Rat	triphenyl phosphate	affects expression	ISO	CIAO2A (Homo sapiens)	6480464	triphenyl phosphate affects the expression of CIAO2A mRNA	CTD	PMID:37042841
Ciao2a	Rat	urethane	decreases expression	ISO	CIAO2A (Homo sapiens)	6480464	Urethane results in decreased expression of CIAO2A mRNA	CTD	PMID:28818685

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ciao2a	Rat	biological_process		ND		1598407	09/08: no relevant rat data	RGD
Ciao2a	Rat	chromosome segregation	involved_in	IEA	UniProtKB-KW:KW-0159	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ciao2a	Rat	protein maturation	involved_in	IEA	InterPro:IPR039796	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ciao2a	Rat	protein maturation	involved_in	IEA	UniProtKB:Q9H5X1 and ensembl:ENSP00000300030	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ciao2a	Rat	protein maturation	involved_in	ISO	CIAO2A (Homo sapiens)	1624291	PMID:23891004	RGD	PMID:23891004

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ciao2a	Rat	cytosol	located_in	ISO	CIAO2A (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Ciao2a	Rat	cytosol	located_in	IEA	UniProtKB:Q9H5X1 and ensembl:ENSP00000300030	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ciao2a	Rat	cytosolic [4Fe-4S] assembly targeting complex	part_of	ISO	CIAO2A (Homo sapiens)	1624291	PMID:23891004	RGD	PMID:23891004
Ciao2a	Rat	cytosolic [4Fe-4S] assembly targeting complex	part_of	IEA	UniProtKB:Q9H5X1 and ensembl:ENSP00000300030	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ciao2a	Rat	nucleoplasm	located_in	ISO	CIAO2A (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Ciao2a	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q9H5X1 and ensembl:ENSP00000300030	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ciao2a	Rat	protein binding	enables	ISO	CIAO2A (Homo sapiens)	1624291	UniProtKB:H3BQL7 more ...	RGD	PMID:16189514 more ...
Ciao2a	Rat	protein binding	enables	ISO	Ciao2a (Mus musculus)	1624291	UniProtKB:O76071 more ...	RGD	PMID:23891004

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ciao2a	Rat	cytosolic iron-sulfur cluster protein assembly pathway		ISO	CIAO2A (Homo sapiens)	11554190		RGD
Ciao2a	Rat	cytosolic iron-sulfur cluster protein assembly pathway		ISO	CIAO2A (Homo sapiens)	11554192		RGD

#	Reference Title	Reference Citation
1.	Iron-sulfur cluster biogenesis in mammalian cells: New insights into the molecular mechanisms of cluster delivery.	Maio N and Rouault TA, Biochim Biophys Acta. 2015 Jun;1853(6):1493-512. doi: 10.1016/j.bbamcr.2014.09.009. Epub 2014 Sep 19.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Biogenesis of cytosolic and nuclear iron-sulfur proteins and their role in genome stability.	Paul VD and Lill R, Biochim Biophys Acta. 2015 Jun;1853(6):1528-39. doi: 10.1016/j.bbamcr.2014.12.018. Epub 2015 Jan 10.
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation

PMID:12477932	PMID:23891004

Ciao2a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	75,565,620 - 75,577,542 (+)	NCBI		GRCr8
mRatBN7.2	8	66,670,533 - 66,682,455 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	66,670,483 - 66,682,455 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	72,183,136 - 72,195,001 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	70,456,195 - 70,468,054 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	68,326,000 - 68,337,909 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	71,786,336 - 71,798,258 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	71,786,310 - 71,798,266 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	71,455,249 - 71,467,171 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	70,410,776 - 70,422,702 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	70,429,829 - 70,441,755 (+)	NCBI
Celera	8	66,058,924 - 66,070,845 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

CIAO2A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	64,072,565 - 64,093,838 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	64,072,565 - 64,094,262 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	64,364,764 - 64,386,037 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	62,151,814 - 62,173,260 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	15	41,244,173 - 41,265,622 (-)	NCBI		Celera
Cytogenetic Map	15	q22.31	NCBI
HuRef	15	41,189,395 - 41,210,854 (-)	NCBI		HuRef
CHM1_1	15	64,484,272 - 64,505,725 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	61,879,723 - 61,900,991 (-)	NCBI		T2T-CHM13v2.0

Ciao2a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	66,033,878 - 66,046,250 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	66,033,893 - 66,046,237 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	66,126,596 - 66,138,968 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	66,126,611 - 66,138,955 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	65,974,418 - 65,986,775 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	65,924,617 - 65,936,974 (+)	NCBI		MGSCv36	mm8
Celera	9	63,362,237 - 63,374,668 (+)	NCBI		Celera
Cytogenetic Map	9	C	NCBI
cM Map	9	35.73	NCBI

Ciao2a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	11,306,099 - 11,331,758 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955450	11,306,099 - 11,327,688 (+)	NCBI	ChiLan1.0	ChiLan1.0

CIAO2A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	53,327,864 - 53,351,078 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	57,503,133 - 57,526,346 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	43,025,577 - 43,047,013 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	61,317,188 - 61,338,337 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	61,317,188 - 61,338,337 (-)	Ensembl	panpan1.1		panPan2

CIAO2A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	28,582,048 - 28,597,856 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	28,582,902 - 28,597,748 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	28,501,777 - 28,517,587 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	28,758,001 - 28,773,814 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	28,758,012 - 28,773,776 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	28,692,569 - 28,708,362 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	28,755,102 - 28,770,923 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	28,993,565 - 29,009,399 (-)	NCBI		UU_Cfam_GSD_1.0

Ciao2a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	106,699,806 - 106,719,929 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	24,548,235 - 24,567,792 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	24,547,862 - 24,568,003 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CIAO2A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	107,951,646 - 107,969,298 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	107,951,618 - 107,969,306 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CIAO2A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	19,448,702 - 19,470,212 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	19,448,903 - 19,469,756 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	121,923,113 - 121,945,326 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ciao2a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624781	8,467,683 - 8,485,677 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624781	8,467,682 - 8,485,677 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in Ciao2a
52 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	273
Count of miRNA genes:	170
Interacting mature miRNAs:	191
Transcripts:	ENSRNOT00000022999
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat

RH126556

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	66,682,123 - 66,682,345 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	71,797,927 - 71,798,148	NCBI	Rnor6.0
Rnor_5.0	8	71,466,840 - 71,467,061	UniSTS	Rnor5.0
RGSC_v3.4	8	70,422,371 - 70,422,592	UniSTS	RGSC3.4
Celera	8	66,070,514 - 66,070,735	UniSTS
Cytogenetic Map	8	q24	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001008327	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC096406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215407	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216583	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218392	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225271	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233915	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022999 ⟹ ENSRNOP00000022999

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	66,670,483 - 66,682,455 (+)	Ensembl
Rnor_6.0 Ensembl	8	71,786,310 - 71,798,266 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105309 ⟹ ENSRNOP00000097371

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	66,670,483 - 66,682,455 (+)	Ensembl

RefSeq Acc Id:

NM_001008327 ⟹ NP_001008328

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	75,565,620 - 75,577,542 (+)	NCBI
mRatBN7.2	8	66,670,533 - 66,682,455 (+)	NCBI
Rnor_6.0	8	71,786,336 - 71,798,258 (+)	NCBI
Rnor_5.0	8	71,455,249 - 71,467,171 (+)	NCBI
RGSC_v3.4	8	70,410,776 - 70,422,702 (+)	RGD
Celera	8	66,058,924 - 66,070,845 (+)	RGD

Sequence:

show sequence

GCCTATTCTCTGCTCCCCTAAACCTTTACACATGTCTTGGTTTATTTGAAGTCCAGGAAGTTAACTTCTGAGATCGGCTGCGGAAAGACGGTGGCTCGGTTGGGACAGTCGCCAGGGATGGCGGAACG
TCAGGATGGAGCGAGTGTCTGGGCTGCTCTCCTGGACGCTGAGCAGGGTCCTATGGCTCTCAGGCTTTTCTGAGCAGGGAGCTGCCTGGCAGCCCCGGATCATGGAAGAGAAAGCGCTAGAAGTTTAT
GATTTGATTCGAACTATCCGGGACCCAGAAAAGCCCAATACTTTAGAAGAACTGGAAGTGGTCACAGAGAGTTGTGTGGAAGTTCAAGAAATAAGTGAAGATGACTATTTGGTTATTATCAAGTTCAC
ACCAACAGTACCTCATTGCTCTTTGGCAACTCTTATTGGACTGTGCTTAAGAGTAAAGCTCCAGCGATGTCTGCCATTCAAACACAAGCTGGAAATTTACATTTCTGAAGGAACTCACTCGACAGAAG
AAGACATCAACAAGCAGATAAATGACAAAGAGCGAGTGGCAGCTGCAATGGAGAACCCCAACCTTCGGGAGATTGTGGAACAGTGCGTCCTCGAGCCGGACTGACGCCTTCCTAAGAGCCAGTGGCCT
GGAAGCATTTGATCTGCTTGTTTAAATCCTTTGAAAAATGTAGAGGACACATGTCGACTATATAGGTGATTTGTACCTCAGACCTTTTTTTTTGTTTTTTGTTTTTTCAAGACAAGGTTTTTCTGTAT
AGTCCTGGCTGTCCTGGAACTTGTTCTGTTGACCAGACTGGCCTTGAACTCAGAGATCCACCTGGCTCTGTCTTCTGAAAGCTGGGATTAAAGGTGTGAGCCACCACTGGCCAGCCTTCAGAGTGTTT
TTTTAAAAGGCTTCTTTCTGAGCAGATTTCAGTTATGAGGTAAATTCTAATTGTTCAGTGAGTAACATTCTCAGGATTTCTAACTCAAGTGATCATACAGAAAAATATTTTCTAGTTATTATGTGTAA
AATGTTACTATTTTTCTGATGACCATTCTGATACAACTGTTTTTCATGTCAAATATCTACTGTGCCCAAATGTATTTGATTTAAATCATTCTAAAATAAATATGACAGATGATTCTTAAAAAAAAAAA
AAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001008328	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86524	(Get FASTA)	NCBI Sequence Viewer
	EDL95849	(Get FASTA)	NCBI Sequence Viewer
	EDL95850	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000022999
	ENSRNOP00000022999.4
	ENSRNOP00000097371.1

RefSeq Acc Id:	NP_001008328 ⟸ NM_001008327
- Peptide Label:	precursor
- UniProtKB:	Q5RJS3 (UniProtKB/TrEMBL), A6J5H6 (UniProtKB/TrEMBL), A0A8I6AST8 (UniProtKB/TrEMBL), F7EXH6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MERVSGLLSWTLSRVLWLSGFSEQGAAWQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVTESCVEVQEISEDDYLVIIKFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEED INKQINDKERVAAAMENPNLREIVEQCVLEPD hide sequence

Ensembl Acc Id:

ENSRNOP00000022999 ⟸ ENSRNOT00000022999

Ensembl Acc Id:

ENSRNOP00000097371 ⟸ ENSRNOT00000105309

Protein Domains

MIP18 family-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5RJS3-F1-model_v2	AlphaFold	Q5RJS3	1-160	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

Promoter ID:

Type:

initiation region

Name:

Fam96a_2

Description:

family with sequence similarity 96, member A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R6609

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	71,786,338 - 71,786,398	EPDNEW

RGD ID:

Promoter ID:

Type:

multiple initiation site

Name:

Fam96a_1

Description:

family with sequence similarity 96, member A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R6608

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	71,786,449 - 71,786,509	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-30032	BioCyc
Ensembl Genes	ENSRNOG00000017119	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000022999	ENTREZGENE
	ENSRNOT00000022999.7	UniProtKB/TrEMBL
	ENSRNOT00000105309.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.300.130	UniProtKB/TrEMBL
	6.10.250.1280	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7303322	IMAGE-MGC_LOAD
InterPro	DUF59	UniProtKB/TrEMBL
	FSCA_dom	UniProtKB/TrEMBL
	MIP18	UniProtKB/TrEMBL
KEGG Report	rno:300797	UniProtKB/TrEMBL
MGC_CLONE	MGC:105538	IMAGE-MGC_LOAD
NCBI Gene	300797	ENTREZGENE
PANTHER	CYTOSOLIC IRON-SULFUR ASSEMBLY COMPONENT 2A	UniProtKB/TrEMBL
	PTHR12377	UniProtKB/TrEMBL
Pfam	DUF59	UniProtKB/TrEMBL
PhenoGen	Ciao2a	PhenoGen
RatGTEx	ENSRNOG00000017119	RatGTEx
Superfamily-SCOP	SSF117916	UniProtKB/TrEMBL
UniProt	A0A8I6AST8	ENTREZGENE, UniProtKB/TrEMBL
	A6J5H6	ENTREZGENE, UniProtKB/TrEMBL
	F7EXH6	ENTREZGENE, UniProtKB/TrEMBL
	Q5RJS3	ENTREZGENE
UniProt Secondary	Q5RJS3	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-05-25	Ciao2a	cytosolic iron-sulfur assembly component 2A	Fam96a	family with sequence similarity 96, member A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Fam96a	family with sequence similarity 96, member A	RGD1307481	similar to RIKEN cDNA 5730536A07	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1307481	similar to RIKEN cDNA 5730536A07	RGD1307481_predicted	similar to RIKEN cDNA 5730536A07 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1307481_predicted	similar to RIKEN cDNA 5730536A07 (predicted)	LOC300797_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC300797_predicted	similar to RIKEN cDNA 5730536A07 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL