Advanced Search (OLGA)

Gene: Plekhm2 (pleckstrin homology and RUN domain containing M2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Plekhm2

Name:

pleckstrin homology and RUN domain containing M2

RGD ID:

1307005

Description:

Predicted to enable kinesin binding activity. Predicted to be involved in several processes, including Golgi organization; lysosome localization; and natural killer cell mediated cytotoxicity. Predicted to be located in lysosomal membrane. Predicted to be active in endosome membrane. Orthologous to human PLEKHM2 (pleckstrin homology and RUN domain containing M2); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; gentamycin.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC313667; pleckstrin homology domain containing, family M (with RUN domain) member 2; pleckstrin homology domain-containing family M member 2; regulatory solute carrier protein family 1 member 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	159,222,620 - 159,261,666 (-)	NCBI		GRCr8
mRatBN7.2	5	153,939,582 - 153,978,625 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	153,940,262 - 153,978,689 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	156,625,416 - 156,663,648 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	158,398,694 - 158,436,930 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	158,387,856 - 158,426,085 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	160,182,556 - 160,219,770 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	160,182,251 - 160,219,812 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	163,897,199 - 163,934,413 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	160,527,710 - 160,565,407 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	160,537,310 - 160,545,504 (-)	NCBI
Celera	5	152,296,410 - 152,333,474 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plekhm2	Rat	chromosome 1p36 deletion syndrome		ISO	PLEKHM2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 1p36 deletion syndrome	ClinVar
Plekhm2	Rat	dilated cardiomyopathy		ISO	PLEKHM2 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:17576681 more ...
Plekhm2	Rat	dilated cardiomyopathy		ISO	PLEKHM2 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:16199547 more ...
Plekhm2	Rat	dilated cardiomyopathy		ISO	PLEKHM2 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:16199547 more ...
Plekhm2	Rat	dilated cardiomyopathy		ISO	PLEKHM2 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:16199547 more ...
Plekhm2	Rat	Hereditary Pancreatitis		ISO	PLEKHM2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary pancreatitis	ClinVar	PMID:23721890 and PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plekhm2	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PLEKHM2 mRNA]	CTD	PMID:31150632
Plekhm2	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Plekhm2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of PLEKHM2 mRNA	CTD	PMID:31961203
Plekhm2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PLEKHM2 mRNA	CTD	PMID:33387578
Plekhm2	Rat	2-methylcholine	affects expression	ISO	PLEKHM2 (Homo sapiens)	6480464	beta-methylcholine affects the expression of PLEKHM2 mRNA	CTD	PMID:21179406
Plekhm2	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	Plekhm2 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PLEKHM2 mRNA	CTD	PMID:20188158
Plekhm2	Rat	aristolochic acid A	increases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of PLEKHM2 mRNA	CTD	PMID:33212167
Plekhm2	Rat	arsenous acid	multiple interactions	ISO	PLEKHM2 (Homo sapiens)	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PLEKHM2 protein]	CTD	PMID:26598702
Plekhm2	Rat	bisphenol A	increases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	bisphenol A results in increased expression of PLEKHM2 mRNA	CTD	PMID:29275510
Plekhm2	Rat	bortezomib	decreases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	Bortezomib results in decreased expression of PLEKHM2 mRNA	CTD	PMID:20977926
Plekhm2	Rat	butan-1-ol	multiple interactions	ISO	PLEKHM2 (Homo sapiens)	6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of PLEKHM2 mRNA	CTD	PMID:29432896
Plekhm2	Rat	cadmium dichloride	increases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of PLEKHM2 mRNA	CTD	PMID:38568856
Plekhm2	Rat	caffeine	increases phosphorylation	ISO	PLEKHM2 (Homo sapiens)	6480464	Caffeine results in increased phosphorylation of PLEKHM2 protein	CTD	PMID:35688186
Plekhm2	Rat	CGP 52608	multiple interactions	ISO	PLEKHM2 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to PLEKHM2 gene]	CTD	PMID:28238834
Plekhm2	Rat	coumarin	decreases phosphorylation	ISO	PLEKHM2 (Homo sapiens)	6480464	coumarin results in decreased phosphorylation of PLEKHM2 protein	CTD	PMID:35688186
Plekhm2	Rat	cyclosporin A	increases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	Cyclosporine results in increased expression of PLEKHM2 mRNA	CTD	PMID:25562108
Plekhm2	Rat	cyclosporin A	decreases methylation	ISO	PLEKHM2 (Homo sapiens)	6480464	Cyclosporine results in decreased methylation of PLEKHM2 promoter	CTD	PMID:27989131
Plekhm2	Rat	diarsenic trioxide	multiple interactions	ISO	PLEKHM2 (Homo sapiens)	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PLEKHM2 protein]	CTD	PMID:26598702
Plekhm2	Rat	epoxiconazole	decreases expression	ISO	Plekhm2 (Mus musculus)	6480464	epoxiconazole results in decreased expression of PLEKHM2 mRNA	CTD	PMID:35436446
Plekhm2	Rat	ethanol	increases expression	ISO	Plekhm2 (Mus musculus)	6480464	Ethanol results in increased expression of PLEKHM2 mRNA	CTD	PMID:30319688
Plekhm2	Rat	ethyl methanesulfonate	increases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in increased expression of PLEKHM2 mRNA	CTD	PMID:23649840
Plekhm2	Rat	fenthion	decreases expression	ISO	Plekhm2 (Mus musculus)	6480464	Fenthion results in decreased expression of PLEKHM2 mRNA	CTD	PMID:34813904
Plekhm2	Rat	FR900359	decreases phosphorylation	ISO	PLEKHM2 (Homo sapiens)	6480464	FR900359 results in decreased phosphorylation of PLEKHM2 protein	CTD	PMID:37730182
Plekhm2	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of PLEKHM2 mRNA	CTD	PMID:22061828 and PMID:33387578
Plekhm2	Rat	maneb	multiple interactions	ISO	Plekhm2 (Mus musculus)	6480464	[Maneb co-treated with Paraquat] results in decreased expression of PLEKHM2 mRNA	CTD	PMID:36117858
Plekhm2	Rat	methamphetamine	affects methylation	ISO	Plekhm2 (Mus musculus)	6480464	Methamphetamine affects the methylation of PLEKHM2 promoter	CTD	PMID:26307267
Plekhm2	Rat	methamphetamine	increases expression	ISO	Plekhm2 (Mus musculus)	6480464	Methamphetamine results in increased expression of PLEKHM2 mRNA	CTD	PMID:26307267
Plekhm2	Rat	methidathion	decreases expression	ISO	Plekhm2 (Mus musculus)	6480464	methidathion results in decreased expression of PLEKHM2 mRNA	CTD	PMID:34813904
Plekhm2	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of PLEKHM2 gene	CTD	PMID:35440735
Plekhm2	Rat	methyl methanesulfonate	increases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of PLEKHM2 mRNA	CTD	PMID:23649840
Plekhm2	Rat	ozone	multiple interactions	ISO	Plekhm2 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of Ozone] which results in increased expression of PLEKHM2 mRNA	CTD	PMID:34911549
Plekhm2	Rat	ozone	multiple interactions	ISO	PLEKHM2 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of PLEKHM2 mRNA	CTD	PMID:35430440
Plekhm2	Rat	paracetamol	increases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	Acetaminophen results in increased expression of PLEKHM2 mRNA	CTD	PMID:22230336
Plekhm2	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of PLEKHM2 mRNA	CTD	PMID:33387578
Plekhm2	Rat	paraquat	multiple interactions	ISO	Plekhm2 (Mus musculus)	6480464	[Maneb co-treated with Paraquat] results in decreased expression of PLEKHM2 mRNA	CTD	PMID:36117858
Plekhm2	Rat	PCB138	decreases expression	EXP		6480464	2 more ...	CTD	PMID:23829299
Plekhm2	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	Plekhm2 (Mus musculus)	6480464	perfluorohexanesulfonic acid results in decreased expression of PLEKHM2 mRNA	CTD	PMID:37995155
Plekhm2	Rat	sodium arsenite	increases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	sodium arsenite results in increased expression of PLEKHM2 mRNA	CTD	PMID:38568856
Plekhm2	Rat	sunitinib	increases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	Sunitinib results in increased expression of PLEKHM2 mRNA	CTD	PMID:31533062
Plekhm2	Rat	tamoxifen	increases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	Tamoxifen results in increased expression of PLEKHM2 mRNA	CTD	PMID:15604281
Plekhm2	Rat	temozolomide	decreases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	Temozolomide results in decreased expression of PLEKHM2 mRNA	CTD	PMID:31758290
Plekhm2	Rat	tetrachloroethene	increases expression	ISO	Plekhm2 (Mus musculus)	6480464	Tetrachloroethylene results in increased expression of PLEKHM2 mRNA	CTD	PMID:28973375
Plekhm2	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of PLEKHM2 mRNA	CTD	PMID:31150632
Plekhm2	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of PLEKHM2 mRNA]	CTD	PMID:31150632
Plekhm2	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of PLEKHM2 mRNA	CTD	PMID:34492290
Plekhm2	Rat	thiram	increases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	Thiram results in increased expression of PLEKHM2 mRNA	CTD	PMID:38568856
Plekhm2	Rat	titanium dioxide	decreases methylation	ISO	Plekhm2 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of PLEKHM2 gene	CTD	PMID:35295148
Plekhm2	Rat	triphenyl phosphate	affects expression	ISO	PLEKHM2 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of PLEKHM2 mRNA	CTD	PMID:37042841
Plekhm2	Rat	urethane	increases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	Urethane results in increased expression of PLEKHM2 mRNA	CTD	PMID:28818685
Plekhm2	Rat	valproic acid	affects expression	ISO	PLEKHM2 (Homo sapiens)	6480464	Valproic Acid affects the expression of PLEKHM2 mRNA	CTD	PMID:25979313
Plekhm2	Rat	valproic acid	increases methylation	ISO	PLEKHM2 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of PLEKHM2 gene	CTD	PMID:29154799
Plekhm2	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of PLEKHM2 mRNA	CTD	PMID:23034163
Plekhm2	Rat	vorinostat	decreases expression	ISO	PLEKHM2 (Homo sapiens)	6480464	vorinostat results in decreased expression of PLEKHM2 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plekhm2	Rat	Golgi organization	involved_in	ISO	PLEKHM2 (Homo sapiens)	1624291	PMID:15905402	RGD	PMID:15905402
Plekhm2	Rat	Golgi organization	involved_in	IBA	PANTHER:PTN002926757 and UniProtKB:Q8IWE5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Plekhm2	Rat	Golgi organization	involved_in	IEA	UniProtKB:Q8IWE5 and ensembl:ENSP00000364956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Plekhm2	Rat	lysosome localization	involved_in	ISO	PLEKHM2 (Homo sapiens)	1624291	PMID:22172677 more ...	RGD	PMID:22172677 more ...
Plekhm2	Rat	lysosome localization	involved_in	IBA	PANTHER:PTN002926757 and UniProtKB:Q8IWE5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Plekhm2	Rat	lysosome localization	involved_in	IEA	UniProtKB:Q8IWE5 and ensembl:ENSP00000364956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Plekhm2	Rat	natural killer cell mediated cytotoxicity	involved_in	ISO	PLEKHM2 (Homo sapiens)	1624291	PMID:24088571	RGD	PMID:24088571
Plekhm2	Rat	natural killer cell mediated cytotoxicity	involved_in	IEA	UniProtKB:Q8IWE5 and ensembl:ENSP00000364956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Plekhm2	Rat	regulation of protein localization	involved_in	ISO	PLEKHM2 (Homo sapiens)	1624291	PMID:18787122	RGD	PMID:18787122
Plekhm2	Rat	regulation of protein localization	involved_in	IBA	PANTHER:PTN002926757 and UniProtKB:Q8IWE5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Plekhm2	Rat	regulation of protein localization	involved_in	IEA	UniProtKB:Q8IWE5 and ensembl:ENSP00000364956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plekhm2	Rat	endosome membrane	located_in	ISO	PLEKHM2 (Homo sapiens)	1624291	PMID:18996344	RGD	PMID:18996344
Plekhm2	Rat	endosome membrane	is_active_in	IBA	PANTHER:PTN002926757 and UniProtKB:Q8IWE5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Plekhm2	Rat	endosome membrane	located_in	IEA	UniProtKB:Q8IWE5 and ensembl:ENSP00000364956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Plekhm2	Rat	lysosomal membrane	located_in	ISO	PLEKHM2 (Homo sapiens)	1624291	PMID:22172677	RGD	PMID:22172677
Plekhm2	Rat	lysosomal membrane	located_in	IEA	UniProtKB:Q8IWE5 and ensembl:ENSP00000364956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Plekhm2	Rat	lysosomal membrane	located_in	IEA	UniProtKB-SubCell:SL-0157	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Plekhm2	Rat	lysosome	located_in	IEA	UniProtKB-KW:KW-0458	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plekhm2	Rat	kinesin binding	enables	ISO	PLEKHM2 (Homo sapiens)	1624291	PMID:15905402	RGD	PMID:15905402
Plekhm2	Rat	kinesin binding	enables	IEA	UniProtKB:Q8IWE5 and ensembl:ENSP00000364956	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Plekhm2	Rat	kinesin binding	enables	IBA	PANTHER:PTN002926757 and UniProtKB:Q8IWE5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Plekhm2	Rat	protein binding	enables	ISO	PLEKHM2 (Homo sapiens)	1624291	UniProtKB:A0A0F6B063 more ...	RGD	PMID:15905402 more ...

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:15905402	PMID:18787122	PMID:18996344	PMID:25898167

Plekhm2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	159,222,620 - 159,261,666 (-)	NCBI		GRCr8
mRatBN7.2	5	153,939,582 - 153,978,625 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	153,940,262 - 153,978,689 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	156,625,416 - 156,663,648 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	158,398,694 - 158,436,930 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	158,387,856 - 158,426,085 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	160,182,556 - 160,219,770 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	160,182,251 - 160,219,812 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	163,897,199 - 163,934,413 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	160,527,710 - 160,565,407 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	160,537,310 - 160,545,504 (-)	NCBI
Celera	5	152,296,410 - 152,333,474 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

PLEKHM2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	15,681,506 - 15,734,769 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	15,684,320 - 15,734,769 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	16,010,815 - 16,061,264 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	15,880,613 - 15,933,851 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	14,493,710 - 14,544,281 (+)	NCBI		Celera
Cytogenetic Map	1	p36.21	NCBI
HuRef	1	14,530,042 - 14,580,241 (+)	NCBI		HuRef
CHM1_1	1	15,809,564 - 15,859,865 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	15,125,588 - 15,179,507 (+)	NCBI		T2T-CHM13v2.0

Plekhm2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	141,353,043 - 141,391,457 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	141,353,045 - 141,392,210 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	141,625,732 - 141,664,146 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	141,625,734 - 141,664,899 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	141,181,649 - 141,220,030 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	140,897,810 - 140,944,739 (-)	NCBI		MGSCv36	mm8
Celera	4	143,449,113 - 143,487,570 (-)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	74.64	NCBI

Plekhm2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955527	2,438,595 - 2,463,842 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955527	2,438,595 - 2,453,120 (-)	NCBI	ChiLan1.0	ChiLan1.0

PLEKHM2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	211,181,303 - 211,231,842 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	210,429,902 - 210,480,362 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	14,826,604 - 14,877,142 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	15,850,776 - 15,869,327 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	15,846,673 - 15,869,327 (+)	Ensembl	panpan1.1		panPan2

PLEKHM2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	81,864,958 - 81,902,682 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	81,865,640 - 81,880,363 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	78,402,921 - 78,440,948 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	82,513,537 - 82,551,925 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	82,513,540 - 82,551,938 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	79,266,903 - 79,305,041 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	80,284,931 - 80,323,248 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	81,350,810 - 81,389,227 (-)	NCBI		UU_Cfam_GSD_1.0

Plekhm2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	37,523,883 - 37,541,272 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	3,348,487 - 3,365,226 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	3,348,661 - 3,366,054 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PLEKHM2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	74,864,968 - 74,907,766 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	74,865,116 - 74,907,769 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	69,396,273 - 69,435,738 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PLEKHM2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	116,569,780 - 116,612,906 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	116,570,613 - 116,612,880 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	20,103,616 - 20,149,211 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Plekhm2
263 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	153
Count of miRNA genes:	120
Interacting mature miRNAs:	138
Transcripts:	ENSRNOT00000016333
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
1354631	Swd2	Spike wave discharge measurement QTL 2	3.64	0.0002	brain electrophysiology trait (VT:0010557)	brain total spike-and-wave discharge duration (CMO:0001740)	5	151113452	164465185	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	151113452	166875058	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298090	Bp155	Blood pressure QTL 155	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	151006154	161165494	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat

RH131979

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	153,994,571 - 153,994,764 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	160,235,934 - 160,236,126	NCBI	Rnor6.0
Rnor_5.0	5	163,950,334 - 163,950,526	UniSTS	Rnor5.0
RGSC_v3.4	5	160,581,298 - 160,581,490	UniSTS	RGSC3.4
Celera	5	152,348,259 - 152,348,451	UniSTS
RH 3.4 Map	5	1057.3	UniSTS
Cytogenetic Map	5	q36	UniSTS

AU040698

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	153,995,867 - 153,995,964 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	160,237,230 - 160,237,326	NCBI	Rnor6.0
Rnor_5.0	5	163,951,630 - 163,951,726	UniSTS	Rnor5.0
RGSC_v3.4	5	160,582,594 - 160,582,690	UniSTS	RGSC3.4
Celera	5	152,349,555 - 152,349,651	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH134786

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	153,989,799 - 153,990,015 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	160,231,162 - 160,231,377	NCBI	Rnor6.0
Rnor_5.0	5	163,945,562 - 163,945,777	UniSTS	Rnor5.0
RGSC_v3.4	5	160,576,526 - 160,576,741	UniSTS	RGSC3.4
Celera	5	152,343,487 - 152,343,702	UniSTS
RH 3.4 Map	5	1057.3	UniSTS
Cytogenetic Map	5	q36	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001191767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110081	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016333 ⟹ ENSRNOP00000016333

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	153,940,262 - 153,978,689 (-)	Ensembl
Rnor_6.0 Ensembl	5	160,182,251 - 160,219,812 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096039 ⟹ ENSRNOP00000087716

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	153,940,262 - 153,978,689 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102733 ⟹ ENSRNOP00000089483

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	153,940,262 - 153,978,689 (-)	Ensembl

RefSeq Acc Id:

NM_001191767 ⟹ NP_001178696

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	159,223,300 - 159,261,443 (-)	NCBI
mRatBN7.2	5	153,940,262 - 153,978,406 (-)	NCBI
Rnor_6.0	5	160,182,556 - 160,219,770 (-)	NCBI
Rnor_5.0	5	163,897,199 - 163,934,413 (-)	NCBI
Celera	5	152,296,410 - 152,333,474 (-)	NCBI

Sequence:

show sequence

ATGGAGCCTCGGGAGGTGAAGGACCGAATCCTGGAGAACATCTCGCTGTCGGTGAAGAAGCTGCAGAGCTACTTCGCAGCATGCGAGGACGAGACCCCTGCCATCCGGAACCACGACAAGGTCCTGCA
GCGCCTGTGTGAGCACTTGGACCACGCCCTGTTGTACGGATTGCAAGACCTGTCCTCTGGCTACTGGGTGGTCGTGGTCCATTTCACCCGCAGAGAGGCCATCAGGCAAATTGAAGTGCTACAGCATG
TGGCCACCAACCTGGGGCGAAGCCGCGCCTGGCTCTACCTGGCTCTCAATGAGAATTCCTTGGAGAGCTACCTTCGCCTGTTCCAGGAGAACCTGGGTCTGTTACAGAAGTACTATGTCAGGAATGCC
CTGGTCTGCAGCCACGATCACTTGACTCTCTTCCTGACCTTGGTGTCTGGGTTGGAGTTTATTCGGTTCGACCTGGATCTGGATGCCCCGTACTTAGACCTGGCCCCATATATGCCTGACTACTATAA
ACCTCAGTACCTGCTGGACTTTGAAGACCGCCTTCCCAGCTCAGTCCACGGCTCAGACAGCCTGTCCCTGAACTCCTTCAACTCTGTCACCTCCACCAACCTGGAATGGGATGACAGCGCAATTGCCC
CATCTAGTGAGGATTATGATTTTGGAGATGTGTTTCCAGCAGTGCCGTCTGTACCCAGCACAGACTGGGAAGATGGAGACCTCACAGATACCATCAGTGGTCCCCGCTCTACTGCTTCAGACCTGACC
AGTAGCAAGGCATCCACCAAGAGCCCCACCCAGCGCCACAACCCCTTCAACGAGGAGCAGGCGGAGAGCGCGTCATCTGAGACCACCCCCGTGCACACTACCTCTCAGGAGAAGGAAGAGGCCCAGGC
CCCAGACCAGCCAGATGCTTGTACAGAGCTTGAAGTTATCAGGGTCACCAAGAAGAAGAAGATTGGCAAGAAGAAAAAGACCAAGCTGGATGAGGAAGCAAGCCCACTGCACCCCAACTGTAGCCAGC
AGAAGTGCGGTCGGCAGGGGGACGGTGACGGACTTGTGGGCACCCCAGGCCTGGCGCGGAACTGTTCGGACACCATACTTGCCTCTCCACAGGAGCAAGGGGAAGGGCCCGGCAGTACCGCCGGGAGC
TGTGAGCACTCAGAGCTCAGCCAGATGGGTTTGCTGATCCCCGAGATGAAGGACACCTCCATGGAGTGCCTAGGACAGCCCCTGAGCAAGGTCATCGACCAGCTTCATGGCCAGCTGGACCCTAGCAC
CTGGTGCTCCCGTGTCGAGCCCCCGGATCAGTCCTTTCGGACCGGCTCTCCCGGGGAGGCCCCGGAGAAACCGCCATTTTGCGACTTTAGTGAGGGGCTTCCAGCCCCCATGGACTTCTACCGGTTTA
CAGTCGAGAGTCCAAGTACTGTTGCACCAGGTGGCGGCCACCATGACCCTCCAGGGTCTAGCCAACCGCTGCATGTTCCTGGTAGCCCTGCGCCTGCTCTCCAAGAAGAAGAGGGAGGAAGAGGAGAG
GGACAGACATCTCAGCCCCTAGAGGACCAGCAAGGGAAGGAGATTCAGGAGCCAGAGCCTCAGGAACCAGACAGCCAGTTGCCGCTGGTCAGCCAGGAGCCTGGGCCTGAACCTGTGTCCCAGCCTGA
ACCTGGAACCCAGGAAACTCTTTGCAAGCTCAAGGGAGACCAGCCCAGTCCTTGTCTGAGCAGTGCTGAGGACTCCGGGGTAGACGAGGGCCAGGGTAGCCCCTCAGAGATGACGCACCCCTCAGAGT
TCAGAGTAGACAACAACCACTTGCTCCTACTCATGATTCACGTCTTTCGAGAAAATGAAGAACAGTTGTTCAAAATGATCCGGATGAGCACAGGGCACATGGAGGGTAACCTACAGCTGCTCTACGTG
CTACTCACAGACTGCTATGTCTACCTGCTTCGGAAAGGGGCCACAGAAAAGCCATACCTGGTGGAAGAGGCTGTTTCTTACAATGAACTTGACTATGTGTCGGTTGGCCTGGACCAACAGACTGTCAA
GCTGGTGTGCACCAACCGCAGGAAGCAGTTTCTGCTGGACACGGCCGACGTGGCCCTGGCTGAGCTGTTCTTGGCGTCTCTGAAGTCAGCCATGATCAAAGGTTGCCGGGAACCACCCTACCCCAGCG
TCTTGACTGATGCCACCATGGAGAGGCTGGCGCTGGCAAAATTTGTCGCCCAGGAATCCAAATGTGAGGCATCCACTGTGACCGTGCACTTCTACGGACTTGTACACTGGGAGGACCCCATGGAAGAG
GCCCTGGGCCCTGTTCCTTGCCAGTGCTCACCCGCTGAGGGCACGATCACCAAAGAAGGCATGCTCCACTATAAGGCCAGCACCTCCTACCTGGGCAAAGAGCACTGGAAGGCCTGCTTCGTGGTGCT
CAGCAATGGGATCCTCTACCAGTATCCTGATCGCACTGACGTCATCCCCCTGCTCTCCGTGAACATGGGTGGGGAGCAGTGCGGTGGCTGCCGGAGATCCAACACCACGGATCGGCCCCACGCCTTCC
AGGTCATTCTGGCTGACCGGCCTTGCCTGGAGCTAAGCGCCGACAGTGAGGCCGAGATGGCAGACTGGATGCAACATCTTTGCCAGGCCGTATCCAAAGGAGTCATACCCCAGGGCATAGCTCCCAGC
CCCTGTATCCCTTGCTGTCTGGTGATCACGGAGGACCGCCTCTTCACATGCCACGAAGATTGCCAAACCAGCTTCTTCCGCTCCCTGGGCACAGCCAGACTGGCGGACATCACTGCTATCTCCACTGA
GTTAGGCAAGGAGTACTGTGTCCTGGAGTTCTCCCAGGATAGCCCCCAGCTGCCGAAGCCCTGGGTCATCTACATGAGCTGCACTTCCGAGTTGGACCGGTTCCTGACCGCCCTGAGCTCTGGGTGGA
AAGCCATCTACCAGGTAGACCTTCCTCACAAGGCAATCCATGAAGCTTCCATCAAGCAGAAATTTGAAGATGCCCTGAGCCTCATCCACAGCGCCTGGCAGCGGAGCGACAGCCTCTGCCGCGGCAGG
GCCTCCCGGGACCCCTGGTGCTGAGGCTGGGCAACCCTGTGGGCAGGCGGGAAGGAGGTGTGCTGACCAGCCTCTGCACTGTGGTGTGCCGCCATGGCGTTTCAGAGCCAGGGGCCAACAACCCACTC
CTGCCTTGGGGTGGCAGAACCACTTAGTGTGGCTGGCGTGAGAGAGGAATTCAGTCAGTGCCTGGCAC

hide sequence

RefSeq Acc Id:

XM_039110081 ⟹ XP_038966009

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	159,222,620 - 159,261,666 (-)	NCBI
mRatBN7.2	5	153,939,582 - 153,978,625 (-)	NCBI


Protein RefSeqs	NP_001178696	(Get FASTA)	NCBI Sequence Viewer
	XP_038966009	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016333
	ENSRNOP00000016333.5
	ENSRNOP00000087716
	ENSRNOP00000087716.1
	ENSRNOP00000089483.1

RefSeq Acc Id:

NP_001178696 ⟸ NM_001191767

- UniProtKB:

D4A932 (UniProtKB/TrEMBL), A0A8I6GI53 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEPREVKDRILENISLSVKKLQSYFAACEDETPAIRNHDKVLQRLCEHLDHALLYGLQDLSSGYWVVVVHFTRREAIRQIEVLQHVATNLGRSRAWLYLALNENSLESYLRLFQENLGLLQKYYVRNA
LVCSHDHLTLFLTLVSGLEFIRFDLDLDAPYLDLAPYMPDYYKPQYLLDFEDRLPSSVHGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEDYDFGDVFPAVPSVPSTDWEDGDLTDTISGPRSTASDLT
SSKASTKSPTQRHNPFNEEQAESASSETTPVHTTSQEKEEAQAPDQPDACTELEVIRVTKKKKIGKKKKTKLDEEASPLHPNCSQQKCGRQGDGDGLVGTPGLARNCSDTILASPQEQGEGPGSTAGS
CEHSELSQMGLLIPEMKDTSMECLGQPLSKVIDQLHGQLDPSTWCSRVEPPDQSFRTGSPGEAPEKPPFCDFSEGLPAPMDFYRFTVESPSTVAPGGGHHDPPGSSQPLHVPGSPAPALQEEEGGRGE
GQTSQPLEDQQGKEIQEPEPQEPDSQLPLVSQEPGPEPVSQPEPGTQETLCKLKGDQPSPCLSSAEDSGVDEGQGSPSEMTHPSEFRVDNNHLLLLMIHVFRENEEQLFKMIRMSTGHMEGNLQLLYV
LLTDCYVYLLRKGATEKPYLVEEAVSYNELDYVSVGLDQQTVKLVCTNRRKQFLLDTADVALAELFLASLKSAMIKGCREPPYPSVLTDATMERLALAKFVAQESKCEASTVTVHFYGLVHWEDPMEE
ALGPVPCQCSPAEGTITKEGMLHYKASTSYLGKEHWKACFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCRRSNTTDRPHAFQVILADRPCLELSADSEAEMADWMQHLCQAVSKGVIPQGIAPS
PCIPCCLVITEDRLFTCHEDCQTSFFRSLGTARLADITAISTELGKEYCVLEFSQDSPQLPKPWVIYMSCTSELDRFLTALSSGWKAIYQVDLPHKAIHEASIKQKFEDALSLIHSAWQRSDSLCRGR
ASRDPWC

hide sequence

Ensembl Acc Id:

ENSRNOP00000016333 ⟸ ENSRNOT00000016333

RefSeq Acc Id:	XP_038966009 ⟸ XM_039110081
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A4P1 (UniProtKB/TrEMBL), A0A8I6GI53 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000087716 ⟸ ENSRNOT00000096039

Ensembl Acc Id:

ENSRNOP00000089483 ⟸ ENSRNOT00000102733

Protein Domains

PH RUN

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A932-F1-model_v2	AlphaFold	D4A932	1-1031	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-39335	BioCyc
Ensembl Genes	ENSRNOG00000012163	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016333	ENTREZGENE
	ENSRNOT00000016333.8	UniProtKB/TrEMBL
	ENSRNOT00000096039	ENTREZGENE
	ENSRNOT00000096039.1	UniProtKB/TrEMBL
	ENSRNOT00000102733.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.58.900	UniProtKB/TrEMBL
	2.30.29.30	UniProtKB/TrEMBL
InterPro	PH_domain-containing_M2	UniProtKB/TrEMBL
	PH_type	UniProtKB/TrEMBL
	Pleckstrin_homology	UniProtKB/TrEMBL
	Run	UniProtKB/TrEMBL
	Run_dom_sf	UniProtKB/TrEMBL
	RUN_PLEKHM2	UniProtKB/TrEMBL
KEGG Report	rno:313667	UniProtKB/TrEMBL
NCBI Gene	313667	ENTREZGENE
PANTHER	PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING FAMILY M MEMBER 2	UniProtKB/TrEMBL
	PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING FAMILY M MEMBER 2	UniProtKB/TrEMBL
Pfam	PF00169	UniProtKB/TrEMBL
	RUN	UniProtKB/TrEMBL
PhenoGen	Plekhm2	PhenoGen
PROSITE	PH_DOMAIN	UniProtKB/TrEMBL
	RUN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012163	RatGTEx
SMART	RUN	UniProtKB/TrEMBL
	SM00233	UniProtKB/TrEMBL
Superfamily-SCOP	PH domain-like	UniProtKB/TrEMBL
	SSF140741	UniProtKB/TrEMBL
UniProt	A0A8I6A4P1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GI53	ENTREZGENE, UniProtKB/TrEMBL
	D4A932	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-30	Plekhm2	pleckstrin homology and RUN domain containing M2	Plekhm2	pleckstrin homology domain containing, family M (with RUN domain) member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Plekhm2	pleckstrin homology domain containing, family M (with RUN domain) member 2	Plekhm2_predicted	pleckstrin homology domain containing, family M (with RUN domain) member 2 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Plekhm2_predicted	pleckstrin homology domain containing, family M (with RUN domain) member 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar