Advanced Search (OLGA)

Gene: Bhlhe22 (basic helix-loop-helix family, member e22) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Bhlhe22

Name:

basic helix-loop-helix family, member e22

RGD ID:

1305451

Description:

Predicted to enable several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; E-box binding activity; and identical protein binding activity. Predicted to be involved in axon development; positive regulation of transcription by RNA polymerase II; and sensory organ development. Predicted to act upstream of or within cerebral cortex regionalization; negative regulation of DNA-templated transcription; and neuron differentiation. Predicted to be active in nucleus. Orthologous to human BHLHE22 (basic helix-loop-helix family member e22); INTERACTS WITH 17beta-estradiol 3-benzoate; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

basic helix-loop-helix domain containing, class B5; Bhlhb5; class E basic helix-loop-helix protein 22; LOC365748

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BHLHE22 (basic helix-loop-helix family member e22)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Bhlhe22 (basic helix-loop-helix family, member e22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Bhlhe22 (basic helix-loop-helix family member e22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BHLHE22 (basic helix-loop-helix family member e22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BHLHE22 (basic helix-loop-helix family member e22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Bhlhe22 (basic helix-loop-helix family member e22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BHLHE22 (basic helix-loop-helix family member e22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BHLHE22 (basic helix-loop-helix family member e22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Bhlhe22 (basic helix-loop-helix family member e22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	BHLHE22 (basic helix-loop-helix family member e22)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Bhlhe22 (basic helix-loop-helix family, member e22)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	bhlhe22 (basic helix-loop-helix family, member e22)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Oli	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	hlh-17	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	hlh-31	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	hlh-32	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	bhlhe22	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	102,402,622 - 102,405,732 (+)	NCBI		GRCr8
mRatBN7.2	2	100,486,400 - 100,489,510 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	100,486,400 - 100,489,510 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	107,001,053 - 107,004,167 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	105,122,157 - 105,125,271 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	100,115,930 - 100,119,038 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	102,685,513 - 102,688,624 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	102,685,513 - 102,688,624 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	122,425,612 - 122,428,723 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	103,086,407 - 103,089,400 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	103,031,370 - 103,034,367 (+)	NCBI
Celera	2	95,892,507 - 95,895,619 (+)	NCBI		Celera
Cytogenetic Map	2	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bhlhe22	Rat	(+)-catechin	multiple interactions	ISO	BHLHE22 (Homo sapiens)	6480464	[Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of BHLHE22 mRNA	CTD	PMID:24763279
Bhlhe22	Rat	1,2-dichloroethane	decreases expression	ISO	Bhlhe22 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of BHLHE22 mRNA	CTD	PMID:28960355
Bhlhe22	Rat	17beta-estradiol 3-benzoate	increases expression	EXP		6480464	estradiol 3-benzoate results in increased expression of BHLHE22 mRNA	CTD	PMID:32741896
Bhlhe22	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Bhlhe22 (Mus musculus)	6480464	Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to BHLHE22 promoter]	CTD	PMID:19654925
Bhlhe22	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of BHLHE22 mRNA	CTD	PMID:24780913
Bhlhe22	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of BHLHE22 mRNA	CTD	PMID:30047161
Bhlhe22	Rat	aflatoxin B1	decreases methylation	ISO	BHLHE22 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of BHLHE22 gene	CTD	PMID:27153756
Bhlhe22	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of BHLHE22 mRNA	CTD	PMID:30047161
Bhlhe22	Rat	amphetamine	decreases expression	EXP		6480464	Amphetamine results in decreased expression of BHLHE22 mRNA	CTD	PMID:30779732
Bhlhe22	Rat	arsenite(3-)	increases methylation	ISO	BHLHE22 (Homo sapiens)	6480464	arsenite results in increased methylation of BHLHE22 promoter	CTD	PMID:23974009
Bhlhe22	Rat	benzo[a]pyrene	increases methylation	ISO	BHLHE22 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of BHLHE22 exon	CTD	PMID:27901495
Bhlhe22	Rat	benzo[a]pyrene	affects methylation	ISO	BHLHE22 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of BHLHE22 promoter	CTD	PMID:27901495
Bhlhe22	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	BHLHE22 (Homo sapiens)	6480464	Diethylhexyl Phthalate results in decreased expression of BHLHE22 mRNA	CTD	PMID:31163220
Bhlhe22	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	BHLHE22 (Homo sapiens)	6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of BHLHE22 promoter and [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of BHLHE22 gene	CTD	PMID:33872906
Bhlhe22	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of BHLHE22 mRNA	CTD	PMID:25181051 and PMID:34947998
Bhlhe22	Rat	bisphenol A	increases methylation	ISO	BHLHE22 (Homo sapiens)	6480464	bisphenol A results in increased methylation of BHLHE22 gene	CTD	PMID:31601247
Bhlhe22	Rat	bisphenol A	increases expression	ISO	Bhlhe22 (Mus musculus)	6480464	bisphenol A results in increased expression of BHLHE22 mRNA	CTD	PMID:32365465
Bhlhe22	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of BHLHE22 mRNA	CTD	PMID:33296240
Bhlhe22	Rat	CGP 52608	multiple interactions	ISO	BHLHE22 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to BHLHE22 gene]	CTD	PMID:28238834
Bhlhe22	Rat	clotrimazole	decreases expression	EXP		6480464	Clotrimazole results in decreased expression of BHLHE22 mRNA	CTD	PMID:30047161
Bhlhe22	Rat	cocaine	increases expression	EXP		6480464	Cocaine results in increased expression of BHLHE22 mRNA	CTD	PMID:17898221
Bhlhe22	Rat	crocidolite asbestos	decreases expression	ISO	Bhlhe22 (Mus musculus)	6480464	Asbestos and Crocidolite results in decreased expression of BHLHE22 mRNA	CTD	PMID:19446018
Bhlhe22	Rat	crocidolite asbestos	increases expression	ISO	Bhlhe22 (Mus musculus)	6480464	Asbestos and Crocidolite results in increased expression of BHLHE22 mRNA	CTD	PMID:29279043
Bhlhe22	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of BHLHE22 mRNA	CTD	PMID:27523638
Bhlhe22	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of BHLHE22 mRNA	CTD	PMID:26577399
Bhlhe22	Rat	cytarabine	increases expression	ISO	BHLHE22 (Homo sapiens)	6480464	Cytarabine results in increased expression of BHLHE22 mRNA	CTD	PMID:21198554
Bhlhe22	Rat	dioxygen	multiple interactions	ISO	Bhlhe22 (Mus musculus)	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of BHLHE22 mRNA	CTD	PMID:30529165
Bhlhe22	Rat	entinostat	decreases expression	ISO	BHLHE22 (Homo sapiens)	6480464	entinostat results in decreased expression of BHLHE22 mRNA	CTD	PMID:27188386
Bhlhe22	Rat	ethyl methanesulfonate	decreases expression	ISO	BHLHE22 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in decreased expression of BHLHE22 mRNA	CTD	PMID:23649840
Bhlhe22	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of BHLHE22 mRNA	CTD	PMID:27387713
Bhlhe22	Rat	furan	decreases methylation	EXP		6480464	furan results in decreased methylation of BHLHE22 gene	CTD	PMID:27387713
Bhlhe22	Rat	glycidol	decreases expression	EXP		6480464	glycidol results in decreased expression of BHLHE22 mRNA	CTD	PMID:24915197
Bhlhe22	Rat	ketamine	decreases expression	EXP		6480464	Ketamine results in decreased expression of BHLHE22 mRNA	CTD	PMID:20080153
Bhlhe22	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of BHLHE22 mRNA	CTD	PMID:30047161
Bhlhe22	Rat	methyl methanesulfonate	decreases expression	ISO	BHLHE22 (Homo sapiens)	6480464	Methyl Methanesulfonate results in decreased expression of BHLHE22 mRNA	CTD	PMID:23649840
Bhlhe22	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	BHLHE22 (Homo sapiens)	6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of BHLHE22 promoter and [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of BHLHE22 gene	CTD	PMID:33872906
Bhlhe22	Rat	nickel atom	decreases expression	ISO	BHLHE22 (Homo sapiens)	6480464	Nickel results in decreased expression of BHLHE22 mRNA	CTD	PMID:24768652
Bhlhe22	Rat	pirinixic acid	increases expression	ISO	Bhlhe22 (Mus musculus)	6480464	pirinixic acid results in increased expression of BHLHE22 mRNA	CTD	PMID:20813756
Bhlhe22	Rat	potassium dichromate	increases expression	ISO	Bhlhe22 (Mus musculus)	6480464	Potassium Dichromate results in increased expression of BHLHE22 mRNA	CTD	PMID:23608068
Bhlhe22	Rat	silver atom	decreases expression	ISO	Bhlhe22 (Mus musculus)	6480464	Silver results in decreased expression of BHLHE22 mRNA	CTD	PMID:27131904
Bhlhe22	Rat	silver(0)	decreases expression	ISO	Bhlhe22 (Mus musculus)	6480464	Silver results in decreased expression of BHLHE22 mRNA	CTD	PMID:27131904
Bhlhe22	Rat	sodium arsenite	affects methylation	ISO	BHLHE22 (Homo sapiens)	6480464	sodium arsenite affects the methylation of BHLHE22 gene	CTD	PMID:28589171
Bhlhe22	Rat	sodium arsenite	decreases expression	ISO	Bhlhe22 (Mus musculus)	6480464	sodium arsenite results in decreased expression of BHLHE22 mRNA	CTD	PMID:37682722
Bhlhe22	Rat	Soman	decreases expression	EXP		6480464	Soman results in decreased expression of BHLHE22 mRNA	CTD	PMID:19281266
Bhlhe22	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of BHLHE22 mRNA	CTD	PMID:30047161
Bhlhe22	Rat	tetrachloromethane	increases expression	ISO	Bhlhe22 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of BHLHE22 mRNA	CTD	PMID:17484886
Bhlhe22	Rat	titanium dioxide	increases methylation	ISO	Bhlhe22 (Mus musculus)	6480464	titanium dioxide results in increased methylation of BHLHE22 gene	CTD	PMID:35295148
Bhlhe22	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of BHLHE22 mRNA	CTD	PMID:33387578
Bhlhe22	Rat	valproic acid	increases methylation	ISO	BHLHE22 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of BHLHE22 gene	CTD	PMID:29154799
Bhlhe22	Rat	valproic acid	affects expression	ISO	BHLHE22 (Homo sapiens)	6480464	Valproic Acid affects the expression of BHLHE22 mRNA	CTD	PMID:25979313
Bhlhe22	Rat	valproic acid	increases expression	ISO	BHLHE22 (Homo sapiens)	6480464	Valproic Acid results in increased expression of BHLHE22 mRNA	CTD	PMID:28001369

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bhlhe22	Rat	amacrine cell differentiation	acts_upstream_of_or_within	ISO	Bhlhe22 (Mus musculus)	1624291	MGI:3707409 PMID:17092954	RGD	PMID:17092954
Bhlhe22	Rat	anterior commissure morphogenesis	acts_upstream_of_or_within	ISO	Bhlhe22 (Mus musculus)	1624291	MGI:4440742 PMID:22284184	RGD	PMID:22284184
Bhlhe22	Rat	axon development	involved_in	IBA	FB:FBgn0015550 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bhlhe22	Rat	central nervous system projection neuron axonogenesis	acts_upstream_of_or_within	ISO	Bhlhe22 (Mus musculus)	1624291	MGI:2684610 more ...	RGD	PMID:22284184
Bhlhe22	Rat	cerebral cortex regionalization	acts_upstream_of_or_within	ISO	Bhlhe22 (Mus musculus)	1624291	MGI:3707409 PMID:23431145	RGD	PMID:23431145
Bhlhe22	Rat	corpus callosum morphogenesis	acts_upstream_of_or_within	ISO	Bhlhe22 (Mus musculus)	1624291	MGI:2684610 more ...	RGD	PMID:22284184
Bhlhe22	Rat	corticospinal tract morphogenesis	acts_upstream_of_or_within	ISO	Bhlhe22 (Mus musculus)	1624291	MGI:2684610 more ...	RGD	PMID:22284184
Bhlhe22	Rat	GABAergic neuron differentiation	acts_upstream_of_or_within	ISO	Bhlhe22 (Mus musculus)	1624291	MGI:3707409 PMID:17092954	RGD	PMID:17092954
Bhlhe22	Rat	negative regulation of DNA-templated transcription	acts_upstream_of_or_within	ISO	Bhlhe22 (Mus musculus)	1624291	MGI:4440742 PMID:12213201 and PMID:22284184	RGD	PMID:12213201 and PMID:22284184
Bhlhe22	Rat	positive regulation of transcription by RNA polymerase II	involved_in	IBA	FB:FBgn0010433 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bhlhe22	Rat	retina morphogenesis in camera-type eye	acts_upstream_of_or_within	ISO	Bhlhe22 (Mus musculus)	1624291	MGI:3707409 PMID:17092954	RGD	PMID:17092954
Bhlhe22	Rat	retinal bipolar neuron differentiation	acts_upstream_of_or_within	ISO	Bhlhe22 (Mus musculus)	1624291	MGI:3707409 PMID:17092954	RGD	PMID:17092954
Bhlhe22	Rat	sensory organ development	involved_in	IBA	FB:FBgn0003270 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bhlhe22	Rat	nucleus	is_active_in	IBA	FB:FBgn0010433 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bhlhe22	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Bhlhe22	Rat	nucleus	located_in	ISO	Bhlhe22 (Mus musculus)	1624291	PMID:22284184	RGD	PMID:22284184

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Bhlhe22	Rat	chromatin binding	enables	ISO	Bhlhe22 (Mus musculus)	1624291	PMID:22284184	RGD	PMID:22284184
Bhlhe22	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IBA	MGI:103239 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bhlhe22	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	ISO	Bhlhe22 (Mus musculus)	1624291	MGI:4440742 PMID:22284184	RGD	PMID:22284184
Bhlhe22	Rat	E-box binding	enables	IBA	MGI:107754 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Bhlhe22	Rat	identical protein binding	enables	ISO	Bhlhe22 (Mus musculus)	1624291	PR:Q8C6A8 PMID:22284184	RGD	PMID:22284184
Bhlhe22	Rat	protein binding	enables	ISO	Bhlhe22 (Mus musculus)	1624291	PR:Q8BZ97 PMID:22284184	RGD	PMID:22284184
Bhlhe22	Rat	protein dimerization activity	enables	IEA	InterPro:IPR011598 and InterPro:IPR036638	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Bhlhe22	Rat	sequence-specific double-stranded DNA binding	enables	ISO	BHLHE22 (Homo sapiens)	1624291	PMID:28473536	RGD	PMID:28473536

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12213201	PMID:17092954	PMID:22284184	PMID:23431145

Bhlhe22
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	102,402,622 - 102,405,732 (+)	NCBI		GRCr8
mRatBN7.2	2	100,486,400 - 100,489,510 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	100,486,400 - 100,489,510 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	107,001,053 - 107,004,167 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	105,122,157 - 105,125,271 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	100,115,930 - 100,119,038 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	102,685,513 - 102,688,624 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	102,685,513 - 102,688,624 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	122,425,612 - 122,428,723 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	103,086,407 - 103,089,400 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	103,031,370 - 103,034,367 (+)	NCBI
Celera	2	95,892,507 - 95,895,619 (+)	NCBI		Celera
Cytogenetic Map	2	q24	NCBI

BHLHE22
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	64,580,365 - 64,583,627 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	64,580,365 - 64,583,627 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	65,492,922 - 65,496,184 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	65,655,368 - 65,658,740 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	65,655,367 - 65,658,739	NCBI
Celera	8	61,482,821 - 61,486,193 (+)	NCBI		Celera
Cytogenetic Map	8	q12.3	NCBI
HuRef	8	60,983,033 - 60,986,429 (+)	NCBI		HuRef
CHM1_1	8	65,546,484 - 65,549,880 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	65,005,787 - 65,009,049 (+)	NCBI		T2T-CHM13v2.0

Bhlhe22
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	18,108,489 - 18,111,678 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	18,108,338 - 18,111,681 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	18,054,325 - 18,057,514 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	18,054,174 - 18,057,517 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	17,954,325 - 17,957,514 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	18,246,553 - 18,249,657 (+)	NCBI		MGSCv36	mm8
Celera	3	18,050,108 - 18,053,297 (+)	NCBI		Celera
Cytogenetic Map	3	A1	NCBI
cM Map	3	4.98	NCBI

Bhlhe22
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955444	14,458,307 - 14,460,441 (-)	NCBI	ChiLan1.0	ChiLan1.0

BHLHE22
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	80,312,550 - 80,316,583 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	55,952,394 - 55,955,669 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	61,119,561 - 61,122,827 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	62,791,428 - 62,793,614 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

BHLHE22
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	29	14,752,451 - 14,755,292 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	14,529,337 - 14,532,177 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	14,529,361 - 14,530,479 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	14,541,913 - 14,544,744 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	14,654,476 - 14,657,307 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	14,921,835 - 14,924,672 (+)	NCBI		UU_Cfam_GSD_1.0

Bhlhe22
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	65,697,850 - 65,700,286 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936496	9,085,894 - 9,087,623 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BHLHE22
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	69,802,200 - 69,803,309 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	69,801,619 - 69,803,375 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	75,987,017 - 75,988,825 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BHLHE22
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	60,476,555 - 60,483,693 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	60,480,825 - 60,481,976 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	81,076,562 - 81,079,844 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bhlhe22
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624744	27,008,471 - 27,009,583 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624744	27,008,292 - 27,009,602 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Bhlhe22
8 total Variants

Assembly: mRatBN7.2

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
2	100486815	100486816	C	A	snv	FXLE16/Stm (2020), FXLE25/StmMcwi (2023), LE/Stm (2019), FXLE14/StmMcwi (2023), FXLE13/Stm (2019NG), FXLE14/Stm (2019NG), FXLE20/Stm (2019NG), FXLE23/Stm (2022), FXLE25/Stm (2022), FXLE26/Stm (2022), LEXF10B/StmMcwi (2022), LEXF7A/Stm (2019NG), LEXF9/StmMcwi (2022), FXLE26/StmMcwi (2023), FXLE13/StmMcwi (2023), FXLE20/StmMcwi (2023), FXLE23/StmMcwi (2023), LEXF3/Stm (2020)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	204
Count of miRNA genes:	132
Interacting mature miRNAs:	173
Transcripts:	ENSRNOT00000033940
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	59846005	104846005	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	81018907	126018907	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	82345893	130923501	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
2293676	Bmd19	Bone mineral density QTL 19	10.7	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	43162366	111362592	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
2293682	Bmd24	Bone mineral density QTL 24	8.9	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	43162366	111362592	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	38573329	122609194	Rat
1598862	Glom9	Glomerulus QTL 9	3.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	2	92337601	137337601	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	76539322	150540526	Rat
1598863	Cm65	Cardiac mass QTL 65	2.3		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	92337601	137337601	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	76539322	102785628	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	40067944	102785628	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
2300165	Bmd49	Bone mineral density QTL 49	4.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	2	88862519	133862519	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	59324377	103795077	Rat
2300170	Bmd45	Bone mineral density QTL 45	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
7411551	Bw131	Body weight QTL 131	29.6	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	67942638	112942638	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	78665616	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
2300185	Bmd46	Bone mineral density QTL 46	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	59324719	102755241	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	80270434	125270434	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	59324377	103795077	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
7207808	Bmd89	Bone mineral density QTL 89	4.1		femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	2	88862519	133862519	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	64366971	109366971	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat

RH141616

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	100,488,307 - 100,488,524 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	102,687,420 - 102,687,636	NCBI	Rnor6.0
Rnor_5.0	2	122,427,519 - 122,427,735	UniSTS	Rnor5.0
RGSC_v3.4	2	103,088,198 - 103,088,414	UniSTS	RGSC3.4
Celera	2	95,894,415 - 95,894,631	UniSTS
RH 3.4 Map	2	622.3	UniSTS
Cytogenetic Map	2	q24	UniSTS

D8S1572E

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_6.0	2	102,688,304 - 102,688,375	NCBI	Rnor6.0
Rnor_5.0	2	122,428,403 - 122,428,474	UniSTS	Rnor5.0
RGSC_v3.4	2	103,089,081 - 103,089,151	UniSTS	RGSC3.4
Celera	2	95,895,298 - 95,895,368	UniSTS
Cytogenetic Map	2	q24	UniSTS

Bhlhb5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	100,487,952 - 100,488,823 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	102,687,065 - 102,687,935	NCBI	Rnor6.0
Rnor_5.0	2	122,427,164 - 122,428,034	UniSTS	Rnor5.0
RGSC_v3.4	2	103,087,843 - 103,088,713	UniSTS	RGSC3.4
Celera	2	95,894,060 - 95,894,930	UniSTS
Cytogenetic Map	2	q24	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	20	113	77	76	45	25	45	6	173	66	93	45	55	31


RefSeq Transcripts	NM_001108940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000033940 ⟹ ENSRNOP00000038593

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	100,486,400 - 100,489,510 (+)	Ensembl
Rnor_6.0 Ensembl	2	102,685,513 - 102,688,624 (+)	Ensembl

RefSeq Acc Id:

NM_001108940 ⟹ NP_001102410

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	102,402,622 - 102,405,732 (+)	NCBI
mRatBN7.2	2	100,486,400 - 100,489,510 (+)	NCBI
Rnor_6.0	2	102,685,513 - 102,688,624 (+)	NCBI
Rnor_5.0	2	122,425,612 - 122,428,723 (+)	NCBI
RGSC_v3.4	2	103,086,407 - 103,089,400 (+)	RGD
Celera	2	95,892,507 - 95,895,619 (+)	RGD

Sequence:

show sequence

TAAAAGACTCCCCCGTCTGTGGCGGTGGCTGGTTGATGGGTCCGGAAATCTCTTGAAGGTGAATCCAAGCAAGATAAACGGTGCAGAGAGGAGGCGCGGGGTTGGACTCAGAGGCGGCAGCGGCGGCA
GCTCCACTCCCTCCGCGACCAGCCTCCCACCATGAGGGGCCGCGGCCCATGGTGAGCCTTAGCAGCCAGCACCGTCGGCTGGAAACGAAGAAGAAGAAGAAGAGGAGGCGGCGAGCGCGGGGGAAGGC
GAAAAAGAAAAAGAAGGGGACAGGGCTGCGGGCAGTGCGGGGACCGACGCACGCAGCAGCTCCGGAGCCCGGCCGGCGCGCGTCTGTGCAGCCGCCTGACTCCCGAGCCCAGGCGGCGGCTGGCCGGG
ACGATGGAGCGCGGTTTGCACCTTGGTGCGGCGGCCGCCAGCGAAGACGACCTCTTCCTGCACAAGAGCCTGGGCGCCTCCGCCGCCAAACGCCTGGAGGCGGCTTTTCGCTCCACGCCCCCGGGCAT
GGACCTGTCCCTGGCGCCGCCAACTCGCGAACGCCCGGCGTCGTCCTCGTCGCCCCTCGGCTGCTTCGAGCCTGCTGACCCCGAAGGGGCCGGGCTGCTGTTGCCTCCGCCCGGAGGAGGCGGCGGTG
CGAGCGGCGGCGGGGTGAGTGTCCCCGGGCTACTCGTGGGCTCAGCGGGCGTGGGGGGCGAGCCGAGCCTGAGCAGCCTGCCGGCGGGGGCTGCCCTGTGCCTCAAGTACGGCGAGAGCGCGGGCCGC
GGCTCCGTGGCCGAGAGTAGCGGCGGGGAGCAGAGCCCCGACGACGACAGCGACGGCCGCTGCGAGCTGGTGCTGCGAGCCGGGGGCCCCGACCCACGGGCATCGCCAGGAGCGGGGAGCGGCGGTGC
CAAGGTGGCGGAGGGCTGCTCCAACGCCCACTTGCACGGTGGCTCGGGCCTCCCCCCGGGGGGGCCCACAAGTGGCAGCGGCGGCAACGGCGGCGGCGGCAGCAGCAAGAAATCCAAAGAGCAGAAGG
CGCTGCGCCTCAACATCAACGCCCGCGAGCGCCGGAGGATGCACGACCTGAACGACGCTCTAGATGAGCTGCGCGCGGTCATCCCTTACGCGCACAGCCCTTCGGTGCGGAAGCTCTCCAAAATCGCC
ACGCTGCTCCTCGCCAAGAACTACATCCTCATGCAGGCACAGGCCCTGGAGGAAATGCGGCGCCTAGTCGCCTACCTCAACCAAGGCCAGGCCATCTCGGCAGCCTCTCTACCCAGTTCGGCGGCCGC
CGCCGCGGCGGCCGCTGCCCTGCACCCAGCGCTAGGCGCCTACGAGCAGGCAGCCGGCTACCCCTTTAGTGCAGGGCTGCCGCCCGCTGCCTCCTGTCCCGAAAAGTGTGCCCTATTCAACAGCGTCT
CATCTAGCCTCTGCAAACAGTGCACGGAGAAGCCTTAAACACTCCCTCCCTCGAAAAACCTCGAGACCGACCCCAAAGCTAGAGGAAAGTGAGAAGCTGCTCCCCATCCCTTTTACTCTCCTAAATTG
TCAAACACTTGCAGGGCAAACAAAGCAGAGGCAGGGACGTAGAAAGTATCAGAGACAAACCGGACTTTCAGCCTTGGCATGCCGGGAATCTCGGTCTTTGGGGTGGGGAGGGAGGGCAGAGGGAGGTT
TAGTCGGGATGAAGTGTGGTTCTTTTTTCCCCTCAGAAAAGTGGCAACTTTGATGGCAACCTAGACTTCAAGGAAGTACAGTTTTCTTTGAAGGTGAAAAATAAGTTGAAAAGTAGTGCTGGATTATT
AGATGGGAAAAGTACGGAGTGGCAAAATTCTAATCCTACTAACAGCTGAGAATTGGCAAGTGATGAAGGGGAGAGGGGTTCAGAGTTGAGAGGCTTGGGGACAGAATATTCATCCAGACAAATCAGAA
AGGGCACTCAAAAATACATCTTGATTCTGAGCCAGGAGAAAAACTTGAAATGAAGACTTATTTAAGTGGAGGGGAAAGCAGAGAGACATGTTGCTATGAAAGACTTGTATTTTTTATTGTCTCTGAAC
TTAAAATCCTGTGAAAATGCTCAAAGTTTTGGTGAGAGTGATATAAAAAGCAGGCTGTGGCTGAAAGAATTGCATTTAAAATATTTATGTGCACCTTGTTACTTTCTACTCTGCAATGATGTATTAAC
AATTTATGATATTTATTTGTTATTCTTCAATGATCCACATCAACAGTATTTATTATGTGTTACAGTCTTGGGTCTTAAGTGTAGTTTTTTTTTAACGCTTCAAAAATTCTGTTTTATATATTAACTTA
CACTGTGTGCCTAGTGTTCAAAGGTATATTTGCCAACAAATATGAAGAAAAGTATTGATGTATCTGAGCTGCTGAGGTTTTTGGAAGGTCATTGGATATTTTCAGTTGCATCATCCATGTATTCAAAT
TGAGCTTTAATAAATTGCTTCAGTCCAAAAATTACAGGAAAGGTGTATTCTTAATTGATGAATAAATTGATCTCTTTCCCAAAAGGCACCTATTTGCATTCCAAAATTGAAAAAAAAAACAGCAATAG
ATTTTATAAGTAAGGACATTCTAGGCAAATATATTTTTCAGGTTGTGCTGTGCATTTTCGAAGGTCTAATTTAATTGTCTTTAATATAGATGTACATATATAAGTTATTCTAACTGTGACGAATTAAG
TTAAGAGACTGGTTTGATTTGCTTTTGGTGTGAAATCCTTTGTTATTTTTCTAAGAAAAATAAAATTTAAAAGAAATGAAATAAAGCTAAGGAAGAGCAAGAAGCTATTTACCCAAAGTGAGCTTTCA
GTTTTAGTTTGCATGGCTATCTGCCTGCCTTTCCTCCTATGAAAATCCAGAAAACCTCTTTTTAAAATGGAGTCTTGCTATTTTCCACTCCTTACAGATAATACAAATTCAGTTTGTCAGGTTGGATG
GTGATTTCAGAGCTATGGTGGATCTATCGGTGGGTTTCGGATGTGTAAAGATTGATATATATATATATATATATATATATTAAATAGGTCAATCAGACTATGACAGCAATGTACGACCATTTGTATGT
GTATGTATGTCAGAAAGAATCTTTATTAAAATATTTTGATC

hide sequence


Protein RefSeqs	NP_001102410	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM01053	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000038593
	ENSRNOP00000038593.4

RefSeq Acc Id:

NP_001102410 ⟸ NM_001108940

- UniProtKB:

D4A287 (UniProtKB/TrEMBL), A6IHA5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MERGLHLGAAAASEDDLFLHKSLGASAAKRLEAAFRSTPPGMDLSLAPPTRERPASSSSPLGCFEPADPEGAGLLLPPPGGGGGASGGGVSVPGLLVGSAGVGGEPSLSSLPAGAALCLKYGESAGRG
SVAESSGGEQSPDDDSDGRCELVLRAGGPDPRASPGAGSGGAKVAEGCSNAHLHGGSGLPPGGPTSGSGGNGGGGSSKKSKEQKALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIAT
LLLAKNYILMQAQALEEMRRLVAYLNQGQAISAASLPSSAAAAAAAAALHPALGAYEQAAGYPFSAGLPPAASCPEKCALFNSVSSSLCKQCTEKP

hide sequence

Ensembl Acc Id:

ENSRNOP00000038593 ⟸ ENSRNOT00000033940

Protein Domains

bHLH

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A287-F1-model_v2	AlphaFold	D4A287	1-352	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-53641	BioCyc
Ensembl Genes	ENSRNOG00000021745	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000033940	ENTREZGENE
	ENSRNOT00000033940.5	UniProtKB/TrEMBL
Gene3D-CATH	4.10.280.10	UniProtKB/TrEMBL
InterPro	bHLH_transcription_factors	UniProtKB/TrEMBL
	HLH_DNA-bd	UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	rno:365748	UniProtKB/TrEMBL
NCBI Gene	365748	ENTREZGENE
PANTHER	BASIC HELIX-LOOP-HELIX PROTEIN NEUROGENIN-RELATED	UniProtKB/TrEMBL
	PTHR19290:SF52	UniProtKB/TrEMBL
Pfam	HLH	UniProtKB/TrEMBL
PhenoGen	Bhlhe22	PhenoGen
PROSITE	HLH	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000021745	RatGTEx
SMART	HLH	UniProtKB/TrEMBL
Superfamily-SCOP	HLH_basic	UniProtKB/TrEMBL
UniProt	A6IHA5	ENTREZGENE, UniProtKB/TrEMBL
	D4A287	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-02-19	Bhlhe22	basic helix-loop-helix family, member e22	Bhlhb5	basic helix-loop-helix domain containing, class B5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Bhlhb5	basic helix-loop-helix domain containing, class B5	Bhlhb5_predicted	basic helix-loop-helix domain containing, class B5 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Bhlhb5_predicted	basic helix-loop-helix domain containing, class B5 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message