Symbol:
Clca2
Name:
chloride channel accessory 2
RGD ID:
1304894
Description:
Predicted to enable intracellularly calcium-gated chloride channel activity. Predicted to be involved in chloride transmembrane transport and proteolysis. Predicted to act upstream of or within chloride transport. Predicted to be located in cell junction; cytosol; and nucleus. Predicted to be active in plasma membrane. Orthologous to human CLCA2 (chloride channel accessory 2); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
calcium-activated chloride channel regulator 2; chloride channel calcium activated 5; chloride channel, calcium activated, family member 2; Clca5; LOC308016
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CLCA2 (chloride channel accessory 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Clca2 (chloride channel accessory 2) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Clca2 (chloride channel accessory 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CLCA2 (chloride channel accessory 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CLCA2 (chloride channel accessory 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Clca2 (chloride channel accessory 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CLCA2 (chloride channel accessory 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CLCA2 (chloride channel accessory 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Clca2 (chloride channel accessory 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CLCA2 (chloride channel accessory 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Clca2 (chloride channel accessory 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
clca1 (chloride channel accessory 1)
Alliance
DIOPT (Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
clca3p
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
clca1.1
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
clca4.1
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 236,655,419 - 236,682,669 (-) NCBI GRCr8 mRatBN7.2 2 233,993,619 - 234,022,691 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 233,995,078 - 234,022,199 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 241,783,941 - 241,811,118 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 239,672,060 - 239,699,210 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 234,541,565 - 234,568,742 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 250,954,423 - 250,981,544 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 250,954,397 - 250,981,623 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 269,482,241 - 269,509,237 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 243,114,775 - 243,142,349 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 225,983,314 - 226,010,397 (-) NCBI Celera Cytogenetic Map 2 q44 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Clca2 Rat (S)-nicotine multiple interactions ISO RGD:1552051 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of CLCA2 mRNA; Nicotine inhibits the reaction more ... CTD PMID:20230807 Clca2 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO RGD:1552051 6480464 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine results in decreased expression of CLCA2 mRNA CTD PMID:20230807 Clca2 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO RGD:1552051 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of CLCA2 mRNA; Nicotine inhibits the reaction more ... CTD PMID:20230807 Clca2 Rat 17beta-estradiol increases expression ISO RGD:1552051 6480464 Estradiol results in increased expression of CLCA2 mRNA CTD PMID:19484750 Clca2 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of CLCA2 mRNA; [estradiol 3-benzoate co-treated more ... CTD PMID:26496021|PMID:32741896 Clca2 Rat 17beta-estradiol multiple interactions ISO RGD:1312594 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of CLCA2 mRNA CTD PMID:30165855 Clca2 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CLCA2 mRNA CTD PMID:32741896 Clca2 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO RGD:1312594 6480464 2,5,2',5'-tetrachlorobiphenyl analog results in decreased expression of CLCA2 mRNA CTD PMID:36804509 Clca2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1552051 6480464 Tetrachlorodibenzodioxin results in decreased expression of CLCA2 mRNA CTD PMID:18691609 Clca2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CLCA2 mRNA CTD PMID:33387578 Clca2 Rat 2,5-hexanedione multiple interactions EXP 6480464 [carbendazim co-treated with 2,5-hexanedione] results in decreased expression of CLCA2 mRNA CTD PMID:22382377 Clca2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CLCA2 mRNA CTD PMID:30047161 Clca2 Rat actinomycin D multiple interactions ISO RGD:1312594 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of CLCA2 mRNA CTD PMID:38460933 Clca2 Rat aflatoxin B1 increases expression ISO RGD:1312594 6480464 Aflatoxin B1 results in increased expression of CLCA2 mRNA CTD PMID:22100608 Clca2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of CLCA2 mRNA CTD PMID:30047161 Clca2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CLCA2 mRNA CTD PMID:16483693 Clca2 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of CLCA2 mRNA CTD PMID:30779732 Clca2 Rat arsane decreases expression ISO RGD:1552051 6480464 Arsenic results in decreased expression of CLCA2 mRNA CTD PMID:19654921 Clca2 Rat arsenic atom decreases expression ISO RGD:1552051 6480464 Arsenic results in decreased expression of CLCA2 mRNA CTD PMID:19654921 Clca2 Rat arsenous acid increases expression ISO RGD:1312594 6480464 Arsenic Trioxide results in increased expression of CLCA2 mRNA CTD PMID:26705709 Clca2 Rat benzo[a]pyrene increases mutagenesis ISO RGD:1312594 6480464 Benzo(a)pyrene results in increased mutagenesis of CLCA2 gene CTD PMID:25435355 Clca2 Rat benzo[a]pyrene increases expression ISO RGD:1312594 6480464 Benzo(a)pyrene results in increased expression of CLCA2 mRNA CTD PMID:22316170|PMID:32234424 Clca2 Rat benzo[b]fluoranthene increases expression ISO RGD:1552051 6480464 benzo(b)fluoranthene results in increased expression of CLCA2 mRNA CTD PMID:26377693 Clca2 Rat beta-damascenone increases expression ISO RGD:1552051 6480464 beta-damascenone results in increased expression of CLCA2 mRNA CTD PMID:22982537 Clca2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CLCA2 mRNA CTD PMID:25181051|PMID:30816183|PMID:32528016 Clca2 Rat bisphenol A increases expression ISO RGD:1552051 6480464 bisphenol A results in increased expression of CLCA2 mRNA CTD PMID:32156529 Clca2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of CLCA2 mRNA CTD PMID:26496021 Clca2 Rat bisphenol A increases methylation ISO RGD:1552051 6480464 bisphenol A results in increased methylation of CLCA2 promoter CTD PMID:27312807 Clca2 Rat cadmium atom increases expression ISO RGD:1312594 6480464 Cadmium results in increased expression of CLCA2 mRNA CTD PMID:21120746 Clca2 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of CLCA2 mRNA CTD PMID:25993096 Clca2 Rat cadmium dichloride decreases expression ISO RGD:1312594 6480464 Cadmium Chloride results in decreased expression of CLCA2 mRNA CTD PMID:38568856 Clca2 Rat carbendazim multiple interactions EXP 6480464 [carbendazim co-treated with 2,5-hexanedione] results in decreased expression of CLCA2 mRNA CTD PMID:22382377 Clca2 Rat carbon nanotube increases expression ISO RGD:1552051 6480464 Nanotubes, Carbon analog results in increased expression of CLCA2 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681|PMID:25620056 Clca2 Rat choline multiple interactions ISO RGD:1552051 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Clca2 Rat chromium(6+) multiple interactions ISO RGD:1312594 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression more ... CTD PMID:38479592 Clca2 Rat cisplatin increases expression ISO RGD:1312594 6480464 Cisplatin results in increased expression of CLCA2 mRNA CTD PMID:27392435 Clca2 Rat cisplatin multiple interactions ISO RGD:1312594 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of CLCA2 mRNA CTD PMID:27392435 Clca2 Rat copper atom multiple interactions ISO RGD:1552051 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ... CTD PMID:15467011 Clca2 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of CLCA2 mRNA CTD PMID:26033743 Clca2 Rat copper(0) multiple interactions ISO RGD:1552051 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ... CTD PMID:15467011 Clca2 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of CLCA2 mRNA CTD PMID:26033743 Clca2 Rat copper(II) chloride decreases expression ISO RGD:1312594 6480464 cupric chloride results in decreased expression of CLCA2 mRNA CTD PMID:38568856 Clca2 Rat diarsenic trioxide increases expression ISO RGD:1312594 6480464 Arsenic Trioxide results in increased expression of CLCA2 mRNA CTD PMID:26705709 Clca2 Rat dioxygen increases expression EXP 6480464 Oxygen results in increased expression of CLCA2 mRNA CTD PMID:22911455 Clca2 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of CLCA2 mRNA CTD PMID:29391264 Clca2 Rat ethyl methanesulfonate increases expression ISO RGD:1312594 6480464 Ethyl Methanesulfonate results in increased expression of CLCA2 mRNA CTD PMID:23649840 Clca2 Rat folic acid multiple interactions ISO RGD:1552051 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Clca2 Rat fonofos increases methylation ISO RGD:1312594 6480464 Fonofos results in increased methylation of CLCA2 promoter CTD PMID:22847954 Clca2 Rat formaldehyde increases expression ISO RGD:1312594 6480464 Formaldehyde results in increased expression of CLCA2 mRNA CTD PMID:23649840 Clca2 Rat formaldehyde decreases expression ISO RGD:1312594 6480464 Formaldehyde results in decreased expression of CLCA2 mRNA CTD PMID:28937961 Clca2 Rat furan increases expression EXP 6480464 furan results in increased expression of CLCA2 mRNA CTD PMID:27387713 Clca2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CLCA2 mRNA CTD PMID:33387578 Clca2 Rat L-methionine multiple interactions ISO RGD:1552051 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Clca2 Rat lead diacetate decreases expression ISO RGD:1312594 6480464 lead acetate results in decreased expression of CLCA2 mRNA CTD PMID:38568856 Clca2 Rat lipopolysaccharide multiple interactions ISO RGD:1312594 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CLCA2 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Clca2 Rat lucanthone increases expression ISO RGD:1312594 6480464 Lucanthone results in increased expression of CLCA2 mRNA CTD PMID:21148553 Clca2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of CLCA2 mRNA CTD PMID:30047161 Clca2 Rat methyl methanesulfonate increases expression ISO RGD:1312594 6480464 Methyl Methanesulfonate results in increased expression of CLCA2 mRNA CTD PMID:23649840 Clca2 Rat nicotine multiple interactions ISO RGD:1552051 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of CLCA2 mRNA; Nicotine inhibits the reaction more ... CTD PMID:20230807 Clca2 Rat Nutlin-3 increases expression ISO RGD:1312594 6480464 nutlin 3 results in increased expression of CLCA2 mRNA CTD PMID:38460933 Clca2 Rat Nutlin-3 multiple interactions ISO RGD:1312594 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of CLCA2 mRNA CTD PMID:38460933 Clca2 Rat okadaic acid increases expression ISO RGD:1312594 6480464 Okadaic Acid results in increased expression of CLCA2 mRNA CTD PMID:38832940 Clca2 Rat paracetamol affects expression ISO RGD:1552051 6480464 Acetaminophen affects the expression of CLCA2 mRNA CTD PMID:17562736 Clca2 Rat paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of CLCA2 mRNA CTD PMID:33387578 Clca2 Rat parathion increases methylation ISO RGD:1312594 6480464 Parathion results in increased methylation of CLCA2 promoter CTD PMID:22847954 Clca2 Rat perfluorohexanesulfonic acid increases expression ISO RGD:1312594 6480464 perfluorohexanesulfonic acid results in increased expression of CLCA2 mRNA CTD PMID:25812627 Clca2 Rat perfluorooctanoic acid increases expression ISO RGD:1312594 6480464 perfluorooctanoic acid results in increased expression of CLCA2 mRNA CTD PMID:25812627 Clca2 Rat pirinixic acid decreases expression ISO RGD:1552051 6480464 pirinixic acid results in decreased expression of CLCA2 mRNA CTD PMID:17426115 Clca2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1312594 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CLCA2 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Clca2 Rat sodium arsenite decreases expression ISO RGD:1312594 6480464 sodium arsenite results in decreased expression of CLCA2 mRNA CTD PMID:38568856 Clca2 Rat sodium arsenite increases expression ISO RGD:1312594 6480464 sodium arsenite results in increased expression of CLCA2 mRNA CTD PMID:34032870 Clca2 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of CLCA2 mRNA CTD PMID:25993096 Clca2 Rat terbufos increases methylation ISO RGD:1312594 6480464 terbufos results in increased methylation of CLCA2 promoter CTD PMID:22847954 Clca2 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CLCA2 mRNA CTD PMID:32741896 Clca2 Rat titanium dioxide increases expression ISO RGD:1552051 6480464 titanium dioxide results in increased expression of CLCA2 mRNA CTD PMID:27760801 Clca2 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of CLCA2 gene CTD PMID:27618143 Clca2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CLCA2 mRNA CTD PMID:33387578 Clca2 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of CLCA2 mRNA CTD PMID:30589522 Clca2 Rat triptonide increases expression ISO RGD:1552051 6480464 triptonide results in increased expression of CLCA2 mRNA CTD PMID:33045310 Clca2 Rat zaragozic acid A increases expression EXP 6480464 squalestatin 1 results in increased expression of CLCA2 mRNA CTD PMID:27225895 Clca2 Rat zaragozic acid A increases expression ISO RGD:1552051 6480464 squalestatin 1 results in increased expression of CLCA2 mRNA CTD PMID:27225895
(S)-nicotine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,5-hexanedione (EXP) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-damascenone (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) carbendazim (EXP) carbon nanotube (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (ISO) diarsenic trioxide (ISO) dioxygen (EXP) endosulfan (EXP) ethyl methanesulfonate (ISO) folic acid (ISO) fonofos (ISO) formaldehyde (ISO) furan (EXP) gentamycin (EXP) L-methionine (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) lucanthone (ISO) methimazole (EXP) methyl methanesulfonate (ISO) nicotine (ISO) Nutlin-3 (ISO) okadaic acid (ISO) paracetamol (EXP,ISO) parathion (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (ISO) pirinixic acid (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) sodium dichromate (EXP) terbufos (ISO) testosterone (EXP) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (EXP) triptonide (ISO) zaragozic acid A (EXP,ISO)
Clca2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 236,655,419 - 236,682,669 (-) NCBI GRCr8 mRatBN7.2 2 233,993,619 - 234,022,691 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 233,995,078 - 234,022,199 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 241,783,941 - 241,811,118 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 239,672,060 - 239,699,210 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 234,541,565 - 234,568,742 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 250,954,423 - 250,981,544 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 250,954,397 - 250,981,623 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 269,482,241 - 269,509,237 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 243,114,775 - 243,142,349 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 225,983,314 - 226,010,397 (-) NCBI Celera Cytogenetic Map 2 q44 NCBI
CLCA2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 86,424,171 - 86,456,553 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 86,424,171 - 86,456,553 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 86,889,854 - 86,922,236 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 86,662,413 - 86,694,829 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 86,601,845 - 86,634,259 NCBI Celera 1 85,133,768 - 85,166,240 (+) NCBI Celera Cytogenetic Map 1 p22.3 NCBI HuRef 1 85,000,753 - 85,032,874 (+) NCBI HuRef CHM1_1 1 87,004,629 - 87,037,098 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 86,264,193 - 86,296,574 (+) NCBI T2T-CHM13v2.0
Clca2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 144,776,021 - 144,805,204 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 144,776,024 - 144,805,204 (-) Ensembl GRCm39 Ensembl GRCm38 3 145,070,260 - 145,099,443 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 145,070,263 - 145,099,443 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 144,733,229 - 144,762,005 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 145,007,651 - 145,036,427 (-) NCBI MGSCv36 mm8 Celera 3 151,513,121 - 151,541,898 (-) NCBI Celera Cytogenetic Map 3 H2 NCBI cM Map 3 69.31 NCBI
Clca2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955423 7,728,652 - 7,760,697 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955423 7,729,032 - 7,760,340 (-) NCBI ChiLan1.0 ChiLan1.0
CLCA2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 140,503,490 - 140,536,078 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 139,655,368 - 139,691,488 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 118,954,863 - 118,987,264 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 87,808,002 - 87,840,605 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 87,808,205 - 87,840,605 (+) Ensembl panpan1.1 panPan2
CLCA2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 61,665,120 - 61,705,760 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 61,666,105 - 61,704,746 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 64,379,479 - 64,415,767 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 62,205,308 - 62,244,815 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 62,205,904 - 62,244,664 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 61,738,026 - 61,777,512 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 61,701,435 - 61,740,933 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 62,207,245 - 62,246,736 (-) NCBI UU_Cfam_GSD_1.0
Clca2
CLCA2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 129,670,638 - 129,704,846 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 129,670,634 - 129,704,765 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 142,188,545 - 142,223,419 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CLCA2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 46,974,030 - 47,007,723 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 46,975,337 - 47,006,646 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 70,803,176 - 70,835,376 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Clca2
.
Predicted Target Of
Count of predictions: 298 Count of miRNA genes: 197 Interacting mature miRNAs: 231 Transcripts: ENSRNOT00000018435 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631563 Hcuc3 Hepatic copper content QTL 3 3.87 liver copper amount (VT:0003065) liver copper weight to liver dry weight ratio (CMO:0001512) 2 229059610 249053267 Rat 1331767 Hrtrt12 Heart rate QTL 12 3.373 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 218414747 240841241 Rat 1598813 Memor9 Memory QTL 9 2.7 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 199341726 234244620 Rat 8693697 Alc36 Alcohol consumption QTL 36 2 0.592 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 2 217139753 236660713 Rat 1298075 Scl17 Serum cholesterol level QTL 17 3.4 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 211744537 249053267 Rat 2293833 Kiddil8 Kidney dilation QTL 8 2.9 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 219753301 247136170 Rat 1598835 Anxrr18 Anxiety related response QTL 18 2.98 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 2 200990457 245990457 Rat 2298479 Eau5 Experimental allergic uveoretinitis QTL 5 0.0021 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 2 202446871 237938339 Rat 1300126 Bp175 Blood pressure QTL 175 3.46 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 214226044 247136170 Rat 7207490 Bss111 Bone structure and strength QTL 111 6.4 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 2 211744537 249053267 Rat 7207484 Bss108 Bone structure and strength QTL 108 5.3 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 2 211744537 249053267 Rat 2313073 Bmd75 Bone mineral density QTL 75 4.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 2 215377404 237938339 Rat 8693622 Alc26 Alcohol consumption QTL 26 2.4 0.667 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 2 221136523 241305619 Rat 7411555 Bw132 Body weight QTL 132 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 2 223389739 249053267 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 9587428 Epfw6 Epididymal fat weight QTL 6 7.47 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 2 223389739 249053267 Rat 7207482 Bss107 Bone structure and strength QTL 107 7 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 2 211744537 249053267 Rat 2293844 Kiddil7 Kidney dilation QTL 7 3.5 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 219753301 247136170 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 2317752 Glom23 Glomerulus QTL 23 3.6 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 2 193452645 245889826 Rat 1549836 Bss2 Bone structure and strength QTL 2 7.5 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 2 211744537 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 2317885 Alcrsp28 Alcohol response QTL 28 2.1 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 212828222 249053267 Rat
RH131751
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 233,826,314 - 233,826,525 (+) MAPPER mRatBN7.2 Rnor_6.0 2 250,785,716 - 250,785,926 NCBI Rnor6.0 Rnor_5.0 2 269,312,537 - 269,312,747 UniSTS Rnor5.0 RGSC_v3.4 2 242,944,988 - 242,945,198 UniSTS RGSC3.4 Celera 2 225,815,879 - 225,816,089 UniSTS Cytogenetic Map 2 q44 UniSTS
BE199161
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 233,996,311 - 233,996,411 (+) MAPPER mRatBN7.2 Rnor_6.0 2 250,955,657 - 250,955,756 NCBI Rnor6.0 Rnor_5.0 2 269,483,497 - 269,483,596 UniSTS Rnor5.0 RGSC_v3.4 2 243,116,009 - 243,116,108 UniSTS RGSC3.4 Celera 2 225,984,548 - 225,984,647 UniSTS Cytogenetic Map 2 q44 UniSTS
RH143389
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 233,999,648 - 233,999,768 (+) MAPPER mRatBN7.2 Rnor_6.0 2 250,958,994 - 250,959,113 NCBI Rnor6.0 Rnor_5.0 2 269,486,834 - 269,486,953 UniSTS Rnor5.0 RGSC_v3.4 2 243,119,346 - 243,119,465 UniSTS RGSC3.4 Celera 2 225,987,885 - 225,988,004 UniSTS Cytogenetic Map 2 q44 UniSTS
AI008454
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 233,995,619 - 233,995,774 (+) MAPPER mRatBN7.2 Rnor_6.0 2 250,954,965 - 250,955,119 NCBI Rnor6.0 Rnor_5.0 2 269,482,805 - 269,482,959 UniSTS Rnor5.0 RGSC_v3.4 2 243,115,317 - 243,115,471 UniSTS RGSC3.4 Celera 2 225,983,856 - 225,984,010 UniSTS RH 3.4 Map 2 1662.41 UniSTS Cytogenetic Map 2 q44 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
4
9
41
68
74
43
23
43
6
139
44
28
39
48
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018435 ⟹ ENSRNOP00000018435
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 233,995,078 - 234,022,199 (-) Ensembl Rnor_6.0 Ensembl 2 250,954,397 - 250,981,623 (-) Ensembl
RefSeq Acc Id:
NM_001107450 ⟹ NP_001100920
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 236,655,423 - 236,682,458 (-) NCBI mRatBN7.2 2 233,995,077 - 234,022,112 (-) NCBI Rnor_6.0 2 250,954,423 - 250,981,544 (-) NCBI Rnor_5.0 2 269,482,241 - 269,509,237 (-) NCBI RGSC_v3.4 2 243,114,775 - 243,142,349 (-) RGD Celera 2 225,983,314 - 226,010,397 (-) RGD
Sequence:
TATTGCCTTGGAGAACTTGTAGAGACAGGTTCCAGATAGATCCACCCCAGAGTTTTCAAAGAAGGCAACTCCTTCATCATGTATATTGTAAGACCTTCTGAGTTCCGAAAGAAGCCATTTGCTTCCAC
hide sequence
RefSeq Acc Id:
XM_039102133 ⟹ XP_038958061
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 236,655,419 - 236,682,669 (-) NCBI mRatBN7.2 2 233,993,619 - 234,022,691 (-) NCBI
RefSeq Acc Id:
NP_001100920 ⟸ NM_001107450
- UniProtKB:
D3ZVT7 (UniProtKB/TrEMBL), A6HWA4 (UniProtKB/TrEMBL)
- Sequence:
MILGGNTGPVGRLKLVTLLFALSPELVFLGAGLKLKENGYDGLLVAINPRVPEDLKLIRNIQEMITEASFYLFNATKRRVFFRSVQILIPATWTAHNYSRVKQESFDKANVLVTEQNGVPGEDPYTLQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000018435 ⟸ ENSRNOT00000018435
RefSeq Acc Id:
XP_038958061 ⟸ XM_039102133
- Peptide Label:
isoform X1
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2010-11-11
Clca2
chloride channel accessory 2
Clca5
chloride channel calcium activated 5
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-03
Clca5
chloride channel calcium activated 5
Clca2_predicted
chloride channel, calcium activated, family member 2 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Clca2_predicted
chloride channel, calcium activated, family member 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
