Symbol:
Vars2
Name:
valyl-tRNA synthetase 2, mitochondrial
RGD ID:
1303122
Description:
Predicted to enable valine-tRNA ligase activity. Predicted to be involved in valyl-tRNA aminoacylation. Predicted to be located in mitochondrion. Predicted to be active in cytosol. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 20. Orthologous to human VARS2 (valyl-tRNA synthetase 2, mitochondrial); PARTICIPATES IN aminoacyl-tRNA biosynthetic pathway; valine, leucine and isoleucine biosynthetic pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding (Ensembl: pseudogene)
RefSeq Status:
VALIDATED
Previously known as:
KIAA1885; valine--tRNA ligase; valine--tRNA ligase, mitochondrial; valRS; valyl-tRNA synthetase 2, mitochondrial (putative); valyl-tRNA synthetase 2-like; valyl-tRNA synthetase, mitochondrial; valyl-tRNA synthetase-like; Vars2l; Varsl
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
VARS2 (valyl-tRNA synthetase 2, mitochondrial) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Vars2 (valyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Vars2 (valyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
VARS2 (valyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
VARS2 (valyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Vars2 (valyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
VARS2 (valyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
VARS2 (valyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Vars2 (valyl-tRNA synthetase 2, mitochondrial) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GPM6A (glycoprotein M6A) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Vars2 (valyl-tRNA synthetase 2, mitochondrial)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
VARS2 (valyl-tRNA synthetase 2, mitochondrial)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
vars2 (valyl-tRNA synthetase 2, mitochondrial (putative))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
VAS1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
ValRS-m
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
vars-1
Alliance
DIOPT (OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
vars2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 3,081,869 - 3,092,907 (+) NCBI GRCr8 mRatBN7.2 20 3,077,132 - 3,087,994 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 3,077,132 - 3,087,994 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 3,128,469 - 3,139,341 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 3,133,442 - 3,144,314 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 3,159,764 - 3,170,643 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 3,588,462 - 3,599,514 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 3,588,497 - 3,599,514 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 5,685,445 - 5,696,499 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 3,228,063 - 3,238,909 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 3,228,289 - 3,239,136 (+) NCBI Celera 20 502,836 - 513,682 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Vars2 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1332485 6480464 1,2-Dimethylhydrazine results in increased expression of VARS2 mRNA CTD PMID:22206623 Vars2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of VARS2 mRNA CTD PMID:16174780 Vars2 Rat 17beta-estradiol increases expression ISO RGD:1346332 6480464 Estradiol results in increased expression of VARS2 mRNA CTD PMID:19167446 Vars2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of VARS2 mRNA] CTD PMID:21215274 Vars2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of VARS2 mRNA CTD PMID:32109520|PMID:33387578 Vars2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1332485 6480464 Tetrachlorodibenzodioxin affects the expression of VARS2 mRNA CTD PMID:21570461|PMID:24680724 Vars2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of VARS2 mRNA CTD PMID:21215274 Vars2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of VARS2 mRNA CTD PMID:21346803 Vars2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of VARS2 mRNA CTD PMID:21346803 Vars2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:1332485 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of VARS2 mRNA CTD PMID:20188158 Vars2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1346332 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Vars2 Rat 4,4'-diaminodiphenylmethane increases expression ISO RGD:1332485 6480464 4,4'-diaminodiphenylmethane results in increased expression of VARS2 mRNA CTD PMID:18648102 Vars2 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1332485 6480464 bisphenol S results in decreased expression of VARS2 mRNA CTD PMID:39298647 Vars2 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Vars2 Rat 4,4'-sulfonyldiphenol affects expression ISO RGD:1346332 6480464 bisphenol S affects the expression of VARS2 protein CTD PMID:31945527 Vars2 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of VARS2 mRNA CTD PMID:21346803 Vars2 Rat aflatoxin B1 increases expression ISO RGD:1332485 6480464 Aflatoxin B1 results in increased expression of VARS2 mRNA CTD PMID:19770486 Vars2 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of VARS2 mRNA CTD PMID:20488242 Vars2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of VARS2 mRNA CTD PMID:16483693 Vars2 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of VARS2 mRNA CTD PMID:30779732 Vars2 Rat aristolochic acid A increases expression ISO RGD:1346332 6480464 aristolochic acid I results in increased expression of VARS2 mRNA CTD PMID:33212167 Vars2 Rat Aroclor 1254 decreases expression ISO RGD:1332485 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of VARS2 mRNA CTD PMID:23650126 Vars2 Rat arsane affects methylation ISO RGD:1346332 6480464 Arsenic affects the methylation of VARS2 gene CTD PMID:25304211 Vars2 Rat arsenic atom affects methylation ISO RGD:1346332 6480464 Arsenic affects the methylation of VARS2 gene CTD PMID:25304211 Vars2 Rat benzo[a]pyrene decreases expression ISO RGD:1332485 6480464 Benzo(a)pyrene results in decreased expression of VARS2 mRNA CTD PMID:19770486 Vars2 Rat benzo[a]pyrene increases methylation ISO RGD:1346332 6480464 Benzo(a)pyrene results in increased methylation of VARS2 promoter CTD PMID:27901495 Vars2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of VARS2 mRNA CTD PMID:30816183 Vars2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Vars2 Rat bisphenol F multiple interactions ISO RGD:1346332 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Vars2 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Vars2 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of VARS2 promoter CTD PMID:22457795 Vars2 Rat carbon nanotube decreases expression ISO RGD:1332485 6480464 Nanotubes, Carbon analog results in decreased expression of VARS2 mRNA CTD PMID:25620056 Vars2 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of VARS2 mRNA CTD PMID:24386269 Vars2 Rat copper(II) sulfate decreases expression ISO RGD:1346332 6480464 Copper Sulfate results in decreased expression of VARS2 mRNA CTD PMID:19549813 Vars2 Rat coumestrol multiple interactions ISO RGD:1346332 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of VARS2 mRNA CTD PMID:19167446 Vars2 Rat coumestrol increases expression ISO RGD:1346332 6480464 Coumestrol results in increased expression of VARS2 mRNA CTD PMID:19167446 Vars2 Rat cyclosporin A decreases expression ISO RGD:1346332 6480464 Cyclosporine results in decreased expression of VARS2 mRNA CTD PMID:20106945 Vars2 Rat dexamethasone multiple interactions ISO RGD:1346332 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Vars2 Rat elemental selenium increases expression ISO RGD:1346332 6480464 Selenium results in increased expression of VARS2 mRNA CTD PMID:19244175 Vars2 Rat Enterolactone multiple interactions ISO RGD:1346332 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of VARS2 mRNA CTD PMID:19167446 Vars2 Rat FR900359 increases phosphorylation ISO RGD:1346332 6480464 FR900359 results in increased phosphorylation of VARS2 protein CTD PMID:37730182 Vars2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of VARS2 mRNA CTD PMID:33387578 Vars2 Rat hypochlorous acid decreases expression ISO RGD:1332485 6480464 Hypochlorous Acid results in decreased expression of VARS2 mRNA CTD PMID:19376150 Vars2 Rat indometacin multiple interactions ISO RGD:1346332 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Vars2 Rat levetiracetam decreases expression EXP 6480464 Levetiracetam results in decreased expression of VARS2 mRNA CTD PMID:20345932 Vars2 Rat lipopolysaccharide decreases expression ISO RGD:1346332 6480464 Lipopolysaccharides results in decreased expression of VARS2 mRNA CTD PMID:31059760 Vars2 Rat lipopolysaccharide multiple interactions ISO RGD:1346332 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of VARS2 mRNA CTD PMID:31059760 Vars2 Rat menadione affects expression ISO RGD:1346332 6480464 Vitamin K 3 affects the expression of VARS2 mRNA CTD PMID:20044591 Vars2 Rat paracetamol decreases expression ISO RGD:1346332 6480464 Acetaminophen results in decreased expression of VARS2 mRNA CTD PMID:21420995|PMID:25704631|PMID:31059760 Vars2 Rat paracetamol multiple interactions ISO RGD:1346332 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of VARS2 mRNA CTD PMID:31059760 Vars2 Rat phenytoin increases expression EXP 6480464 Phenytoin results in increased expression of VARS2 mRNA CTD PMID:20345932 Vars2 Rat selenium atom increases expression ISO RGD:1346332 6480464 Selenium results in increased expression of VARS2 mRNA CTD PMID:19244175 Vars2 Rat sodium arsenite decreases expression ISO RGD:1346332 6480464 sodium arsenite results in decreased expression of VARS2 mRNA CTD PMID:38568856 Vars2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of VARS2 mRNA CTD PMID:34492290 Vars2 Rat titanium dioxide increases expression ISO RGD:1332485 6480464 titanium dioxide results in increased expression of VARS2 mRNA CTD PMID:23557971 Vars2 Rat titanium dioxide decreases methylation ISO RGD:1332485 6480464 titanium dioxide results in decreased methylation of VARS2 gene CTD PMID:35295148 Vars2 Rat trimellitic anhydride increases expression ISO RGD:1332485 6480464 trimellitic anhydride results in increased expression of VARS2 mRNA CTD PMID:19042947 Vars2 Rat triphenyl phosphate affects expression ISO RGD:1346332 6480464 triphenyl phosphate affects the expression of VARS2 mRNA CTD PMID:37042841 Vars2 Rat valproic acid decreases expression ISO RGD:1346332 6480464 Valproic Acid results in decreased expression of VARS2 mRNA CTD PMID:29154799 Vars2 Rat valproic acid affects expression ISO RGD:1346332 6480464 Valproic Acid affects the expression of VARS2 mRNA CTD PMID:25979313 Vars2 Rat vitamin E increases expression ISO RGD:1346332 6480464 Vitamin E results in increased expression of VARS2 mRNA CTD PMID:19244175
Imported Annotations - KEGG (archival)
External Pathway Database Links
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-amino-2,6-dinitrotoluene (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) bisphenol F (EXP,ISO) cadmium dichloride (EXP) carbon nanotube (ISO) cobalt dichloride (EXP) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) dexamethasone (ISO) elemental selenium (ISO) Enterolactone (ISO) FR900359 (ISO) gentamycin (EXP) hypochlorous acid (ISO) indometacin (ISO) levetiracetam (EXP) lipopolysaccharide (ISO) menadione (ISO) paracetamol (ISO) phenytoin (EXP) selenium atom (ISO) sodium arsenite (ISO) thioacetamide (EXP) titanium dioxide (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vitamin E (ISO)
External Pathway Database Links
Vars2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 3,081,869 - 3,092,907 (+) NCBI GRCr8 mRatBN7.2 20 3,077,132 - 3,087,994 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 3,077,132 - 3,087,994 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 3,128,469 - 3,139,341 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 3,133,442 - 3,144,314 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 3,159,764 - 3,170,643 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 3,588,462 - 3,599,514 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 3,588,497 - 3,599,514 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 5,685,445 - 5,696,499 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 3,228,063 - 3,238,909 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 3,228,289 - 3,239,136 (+) NCBI Celera 20 502,836 - 513,682 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
VARS2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 30,914,238 - 30,926,459 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 30,914,205 - 30,926,459 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 30,882,015 - 30,894,236 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 30,989,961 - 31,002,212 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 30,989,960 - 31,002,212 NCBI Celera 6 32,480,085 - 32,492,348 (+) NCBI Celera Cytogenetic Map 6 p21.33 NCBI HuRef 6 30,682,069 - 30,694,336 (+) NCBI HuRef CHM1_1 6 30,884,168 - 30,896,411 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 30,778,904 - 30,791,138 (+) NCBI T2T-CHM13v2.0
Vars2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 35,966,526 - 35,978,531 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 35,966,526 - 35,978,484 (-) Ensembl GRCm39 Ensembl GRCm38 17 35,655,634 - 35,667,639 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 35,655,634 - 35,667,592 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 35,792,579 - 35,804,537 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 34,743,659 - 34,754,865 (-) NCBI MGSCv36 mm8 MGSCv36 17 35,264,443 - 35,275,645 (-) NCBI MGSCv36 mm8 Cytogenetic Map 17 B1 NCBI cM Map 17 18.7 NCBI
Vars2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955583 848,481 - 866,424 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955583 848,166 - 862,360 (+) NCBI ChiLan1.0 ChiLan1.0
VARS2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 45,475,141 - 45,487,472 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 41,437,981 - 41,452,350 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 30,659,346 - 30,671,678 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 31,527,503 - 31,539,814 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 31,527,372 - 31,539,814 (+) Ensembl panpan1.1 panPan2
VARS2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 681,638 - 694,154 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 680,484 - 693,913 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 819,638 - 832,091 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 826,116 - 838,552 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 826,144 - 839,748 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 685,417 - 697,855 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 753,862 - 766,305 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 821,750 - 834,201 (+) NCBI UU_Cfam_GSD_1.0
Vars2
VARS2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 23,404,429 - 23,416,442 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 23,404,400 - 23,416,442 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 27,126,633 - 27,138,695 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
VARS2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 41,537,842 - 41,550,063 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 41,534,552 - 41,549,439 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 30,615,225 - 30,627,428 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Vars2
.
Predicted Target Of
Count of predictions: 81 Count of miRNA genes: 69 Interacting mature miRNAs: 79 Transcripts: ENSRNOT00000048103 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61472 Aia1 Adjuvant induced arthritis QTL 1 18 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 2646395 4597031 Rat 2306850 Pia40 Pristane induced arthritis QTL 40 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 1527959 5304575 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 61448 Ciaa1 CIA Autoantibody QTL 1 30 0.001 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 20 2646395 4597031 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 724519 Bp144 Blood pressure QTL 144 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 20 1 3624629 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000048103 ⟹ ENSRNOP00000046565
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 3,077,132 - 3,087,994 (+) Ensembl Rnor_6.0 Ensembl 20 3,588,497 - 3,598,904 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000091232
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 3,598,171 - 3,599,514 (+) Ensembl
RefSeq Acc Id:
NM_213563 ⟹ NP_998728
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,081,908 - 3,092,754 (+) NCBI mRatBN7.2 20 3,077,132 - 3,087,994 (+) NCBI Rnor_6.0 20 3,588,513 - 3,599,359 (+) NCBI Rnor_5.0 20 5,685,445 - 5,696,499 (+) NCBI RGSC_v3.4 20 3,228,063 - 3,238,909 (+) RGD Celera 20 502,836 - 513,682 (+) RGD
Sequence:
GAGTTCGCTGCGGCGTTCGCGGTAGATTCGCGTGGCCCAGGTTGAGACCTGGGTGTCCCTAGTTTCCGAACCCCAACCTTCGTGTCCTGGTGAGGGGCAGAGCTCCCGCCTCTTCCGGACGCCCTGGT
hide sequence
RefSeq Acc Id:
XM_063279089 ⟹ XP_063135159
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,081,869 - 3,092,907 (+) NCBI
RefSeq Acc Id:
XM_063279090 ⟹ XP_063135160
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,082,264 - 3,092,907 (+) NCBI
RefSeq Acc Id:
XM_063279091 ⟹ XP_063135161
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,081,895 - 3,088,478 (+) NCBI
RefSeq Acc Id:
XM_063279092 ⟹ XP_063135162
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,081,895 - 3,088,439 (+) NCBI
RefSeq Acc Id:
XM_063279093 ⟹ XP_063135163
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,081,895 - 3,092,907 (+) NCBI
RefSeq Acc Id:
XR_010060661
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,081,895 - 3,089,074 (+) NCBI
RefSeq Acc Id:
XR_010060662
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,081,895 - 3,088,796 (+) NCBI
RefSeq Acc Id:
XR_010060663
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,081,894 - 3,088,796 (+) NCBI
RefSeq Acc Id:
NP_998728 ⟸ NM_213563
- Peptide Label:
precursor
- Sequence:
MPHLPLASFRPPLWGLRPSWGLARPRALCTQPEPHGSPVSRRNREAKQKRLREKQAALEAGLAEKSKTPAVPTKAWSHKEVVLYEIPTRPGEKKDVSGPLPPAYSPQYVEAAWYQWWVREGFFKPEYQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000046565 ⟸ ENSRNOT00000048103
RefSeq Acc Id:
XP_063135159 ⟸ XM_063279089
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063135163 ⟸ XM_063279093
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063135161 ⟸ XM_063279091
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063135162 ⟸ XM_063279092
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063135160 ⟸ XM_063279090
- Peptide Label:
isoform X2
RGD ID: 13701307 Promoter ID: EPDNEW_R11831 Type: initiation region Name: Vars2_1 Description: valyl-tRNA synthetase 2, mitochondrial SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 3,588,536 - 3,588,596 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-11-07
Vars2
valyl-tRNA synthetase 2, mitochondrial
Vars2
valyl-tRNA synthetase 2, mitochondrial (putative)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-07
Vars2
valyl-tRNA synthetase 2, mitochondrial (putative)
Varsl
valyl-tRNA synthetase-like
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-15
Varsl
valyl-tRNA synthetase-like
Vars2l
valyl-tRNA synthetase 2-like
Symbol and Name updated
1299863 APPROVED
2006-03-30
Vars2l
valyl-tRNA synthetase 2-like
Symbol and Name status set to approved
1299863 APPROVED
2005-02-14
Vars2l
valyl-tRNA synthetase 2-like
Symbol and Name status set to provisional
70820 PROVISIONAL
