Advanced Search (OLGA)

Gene: CRIPTO (cripto, EGF-CFC family member) Canis lupus familiaris

Subscribe to Updates

Analyze

Symbol:

CRIPTO (Ensembl: TDGF1)

Name:

cripto, EGF-CFC family member

RGD ID:

12151134

Description:

ENCODES a protein that exhibits coreceptor activity (ortholog); growth factor activity (ortholog); signaling receptor binding (ortholog); INVOLVED IN anterior/posterior axis specification (ortholog); anterior/posterior axis specification, embryo (ortholog); cardiac muscle cell differentiation (ortholog); PARTICIPATES IN glypican signaling pathway; ASSOCIATED WITH colon cancer (ortholog); congenital heart disease (ortholog); Forebrain Defects (ortholog); FOUND IN apical plasma membrane (ortholog); cell surface (ortholog); cytoplasm (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

TDGF1; teratocarcinoma-derived growth factor 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

CanFam3.1 - Dog CanFam3.1 Assembly

Position:

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	42,137,939 - 42,140,590 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	42,053,910 - 42,056,560 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	42,620,327 - 42,622,979 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	42,620,327 - 42,623,866 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	41,861,683 - 41,864,330 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	42,262,807 - 42,265,458 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	42,543,717 - 42,546,368 (-)	NCBI		UU_Cfam_GSD_1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CRIPTO	Dog	colon cancer	treatment	ISO	CRIPTO (Homo sapiens)	9068941		RGD	PMID:15173016 and REF_RGD_ID:11561894
CRIPTO	Dog	congenital heart disease		ISO	CRIPTO (Homo sapiens)	9068941	DNA:mutations:3'UTR and exons:	RGD	PMID:19853938 and REF_RGD_ID:11561893
CRIPTO	Dog	Parkinson's disease	treatment	ISO	Cripto (Mus musculus)	9068941		RGD	PMID:20641036 and REF_RGD_ID:11561895
CRIPTO	Dog	teratoma	treatment	ISO	Cripto (Mus musculus)	9068941		RGD	PMID:20641036 and REF_RGD_ID:11561895

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CRIPTO	Dog	Forebrain Defects		ISO	CRIPTO (Homo sapiens)	8554872	ClinVar Annotator: match by term: Forebrain defects	ClinVar	PMID:11062482 and PMID:12073012
CRIPTO	Dog	Progressive Microcephaly with Seizures and Cerebral and Cerebellar Atrophy		ISO	CRIPTO (Homo sapiens)	8554872	ClinVar Annotator: match by term: Microcephaly more ...	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CRIPTO	Dog	holoprosencephaly		ISO	CRIPTO (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:12073012
CRIPTO	Dog	visceral heterotaxy		ISO	CRIPTO (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:11062482

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CRIPTO	Dog	anterior/posterior axis specification	acts_upstream_of_or_within	ISO	MGI:1201414	9068941	PMID:18241853	MGI	PMID:18241853
CRIPTO	Dog	anterior/posterior axis specification, embryo	acts_upstream_of_or_within	ISO	MGI:1934206	9068941	PMID:9790191	MGI	PMID:9790191
CRIPTO	Dog	anterior/posterior pattern specification	involved_in	IBA	MGI:109448 more ...	150520179		GO_Central	GO_REF:0000033
CRIPTO	Dog	blood vessel development	involved_in	IBA	MGI:109448 more ...	150520179		GO_Central	GO_REF:0000033
CRIPTO	Dog	cardiac muscle cell differentiation	acts_upstream_of_or_within	ISO	MGI:1857518	9068941	PMID:9876177	MGI	PMID:9876177
CRIPTO	Dog	cell migration involved in sprouting angiogenesis	involved_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:17720976	UniProt	PMID:17720976
CRIPTO	Dog	cellular response to epidermal growth factor stimulus	involved_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:17720976	UniProt	PMID:17720976
CRIPTO	Dog	cellular response to fibroblast growth factor stimulus	involved_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:17720976	UniProt	PMID:17720976
CRIPTO	Dog	cellular response to hepatocyte growth factor stimulus	involved_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:17720976	UniProt	PMID:17720976
CRIPTO	Dog	cellular response to interleukin-6	involved_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:17720976	UniProt	PMID:17720976
CRIPTO	Dog	cellular response to tumor necrosis factor	involved_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:17720976	UniProt	PMID:17720976
CRIPTO	Dog	cellular response to type II interferon	involved_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:17720976	UniProt	PMID:17720976
CRIPTO	Dog	determination of left/right symmetry	involved_in	IBA	MGI:109448 more ...	150520179		GO_Central	GO_REF:0000033
CRIPTO	Dog	epidermal growth factor receptor signaling pathway	NOT\|acts_upstream_of_or_within	ISO	CRIPTO (Homo sapiens)	9068941	PMID:8006041	MGI	PMID:8006041
CRIPTO	Dog	fibroblast proliferation	acts_upstream_of	ISO	MGI:1857518	9068941	PMID:9876177	MGI	PMID:9876177
CRIPTO	Dog	gastrulation	acts_upstream_of_or_within	ISO	MGI:1201414	9068941	PMID:18241853	MGI	PMID:18241853
CRIPTO	Dog	heart development	involved_in	IBA	MGI:109448 more ...	150520179		GO_Central	GO_REF:0000033
CRIPTO	Dog	in utero embryonic development	acts_upstream_of_or_within	ISO	MGI:1857518	9068941	PMID:9876177	MGI	PMID:9876177
CRIPTO	Dog	morphogenesis of a branching structure	involved_in	ISO	Cripto (Mus musculus)	9068941	PMID:11133982	UniProt	PMID:11133982
CRIPTO	Dog	negative regulation of apoptotic process	involved_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:10493495	UniProt	PMID:10493495
CRIPTO	Dog	negative regulation of transforming growth factor beta receptor signaling pathway	acts_upstream_of_or_within	ISO	MGI:95835	9068941	PMID:17991893	MGI	PMID:17991893
CRIPTO	Dog	nodal signaling pathway	involved_in	IBA	MGI:109448 more ...	150520179		GO_Central	GO_REF:0000033
CRIPTO	Dog	positive regulation of cell migration	involved_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:12649175	UniProt	PMID:12649175
CRIPTO	Dog	positive regulation of cell migration	involved_in	ISO	Cripto (Mus musculus)	9068941	PMID:11133982	UniProt	PMID:11133982
CRIPTO	Dog	positive regulation of cell population proliferation	acts_upstream_of_or_within	ISO	CRIPTO (Homo sapiens)	9068941	PMID:8006041	MGI	PMID:8006041
CRIPTO	Dog	positive regulation of cell-matrix adhesion	acts_upstream_of_or_within	ISO	MGI:1857518	9068941	PMID:9876177	MGI	PMID:9876177
CRIPTO	Dog	positive regulation of endothelial cell migration	involved_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:17720976	UniProt	PMID:17720976
CRIPTO	Dog	positive regulation of fibroblast proliferation	acts_upstream_of_or_within	ISO	MGI:1857518	9068941	PMID:9876177	MGI	PMID:9876177
CRIPTO	Dog	positive regulation of MAP kinase activity	acts_upstream_of_or_within	ISO	CRIPTO (Homo sapiens)	9068941	PMID:9013573	MGI	PMID:9013573
CRIPTO	Dog	positive regulation of MAPK cascade	involved_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:9013573	UniProt	PMID:9013573
CRIPTO	Dog	positive regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	ISO	MGI:1347465 and MGI:97359	9068941	PMID:17568773	MGI	PMID:17568773
CRIPTO	Dog	regulation of fibroblast migration	acts_upstream_of_or_within	ISO	MGI:1857518	9068941	PMID:9876177	MGI	PMID:9876177
CRIPTO	Dog	regulation of signal transduction	involved_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:12649175	UniProt	PMID:12649175
CRIPTO	Dog	regulation of signal transduction	acts_upstream_of_or_within	ISO	Cripto (Mus musculus)	9068941	PMID:17936261	MGI	PMID:17936261
CRIPTO	Dog	signal transduction	involved_in	IEA	ARBA:ARBA00029050	150520179		UniProt	GO_REF:0000117
CRIPTO	Dog	vasculogenesis	acts_upstream_of_or_within	ISO	MGI:1857518	9068941	PMID:9876177	MGI	PMID:9876177

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CRIPTO	Dog	apical plasma membrane	located_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:17720976	UniProt	PMID:17720976
CRIPTO	Dog	cell surface	located_in	ISO	Cripto (Mus musculus)	9068941	PMID:17991893	MGI	PMID:17991893
CRIPTO	Dog	cell surface	is_active_in	IBA	MGI:98658 more ...	150520179		GO_Central	GO_REF:0000033
CRIPTO	Dog	cell surface	located_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:12925698	UniProt	PMID:12925698
CRIPTO	Dog	cytoplasm	located_in	ISO	Cripto (Mus musculus)	9068941	PMID:18425773 and PMID:8588926	MGI	PMID:18425773 and PMID:8588926
CRIPTO	Dog	extracellular region	is_active_in	IBA	FB:FBgn0003390 more ...	150520179		GO_Central	GO_REF:0000033
CRIPTO	Dog	extracellular region	located_in	ISO	Cripto (Mus musculus)	9068941	PMID:12052855	UniProt	PMID:12052855
CRIPTO	Dog	extracellular space	located_in	ISO	Cripto (Mus musculus)	9068941	PMID:10640699	MGI	PMID:10640699
CRIPTO	Dog	extracellular space	located_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:17720976	UniProt	PMID:17720976
CRIPTO	Dog	Golgi apparatus	located_in	ISO	Cripto (Mus musculus)	9068941	PMID:8588926	MGI	PMID:8588926
CRIPTO	Dog	membrane raft	located_in	ISO	CRIPTO (Homo sapiens)	9068941	PMID:17720976	UniProt	PMID:17720976
CRIPTO	Dog	nucleus	located_in	ISO	Cripto (Mus musculus)	9068941	PMID:8588926	MGI	PMID:8588926
CRIPTO	Dog	perinuclear region of cytoplasm	located_in	ISO	Cripto (Mus musculus)	9068941	PMID:8588926	MGI	PMID:8588926
CRIPTO	Dog	plasma membrane	located_in	ISO	Cripto (Mus musculus)	9068941	PMID:10640699	MGI	PMID:10640699

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CRIPTO	Dog	activin receptor binding	enables	IBA	MGI:109448 more ...	150520179		GO_Central	GO_REF:0000033
CRIPTO	Dog	coreceptor activity	enables	ISO	Cripto (Mus musculus)	9068941	PMID:11389842	UniProt	PMID:11389842
CRIPTO	Dog	growth factor activity	enables	ISO	CRIPTO (Homo sapiens)	9068941	PMID:12925698 and PMID:8006041	UniProt	PMID:12925698 and PMID:8006041
CRIPTO	Dog	nodal binding	enables	IBA	MGI:98658 more ...	150520179		GO_Central	GO_REF:0000033
CRIPTO	Dog	protein binding	enables	ISO	UniProtKB:O13144 and UniProtKB:Q9PW55	9068941	PMID:14966532	IntAct	PMID:14966532
CRIPTO	Dog	protein binding	enables	ISO	PR:P20029	9068941	PMID:17991893	MGI	PMID:17991893
CRIPTO	Dog	protein binding	enables	ISO	PR:Q07104	9068941	PMID:16368929	MGI	PMID:16368929
CRIPTO	Dog	protein binding	enables	ISO	UniProtKB:P36896	9068941	PMID:12919325	HGNC-UCL	PMID:12919325
CRIPTO	Dog	signaling receptor binding	enables	ISO	CRIPTO (Homo sapiens)	9068941	PMID:11909953	UniProt	PMID:11909953
CRIPTO	Dog	type I activin receptor binding	enables	ISO	UniProtKB:P36896	9068941	PMID:11389842 and PMID:12052855	UniProt	PMID:11389842 and PMID:12052855
CRIPTO	Dog	Wnt-protein binding	enables	ISO	UniProtKB:P49893	9068941	PMID:15797385	UniProt	PMID:15797385

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CRIPTO	Dog	glypican signaling pathway		ISO	CRIPTO (Homo sapiens)	9068941		PID	PID:200026

CRIPTO
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	42,137,939 - 42,140,590 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	42,053,910 - 42,056,560 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	42,620,327 - 42,622,979 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	42,620,327 - 42,623,866 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	41,861,683 - 41,864,330 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	42,262,807 - 42,265,458 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	42,543,717 - 42,546,368 (-)	NCBI		UU_Cfam_GSD_1.0

CRIPTO
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	46,574,535 - 46,582,457 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	46,574,534 - 46,582,457 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	46,616,025 - 46,623,947 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	46,594,217 - 46,598,957 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	46,594,216 - 46,598,954	NCBI
Celera	3	46,553,783 - 46,561,683 (+)	NCBI		Celera
Cytogenetic Map	3	p21.31	NCBI
HuRef	3	46,658,557 - 46,666,459 (+)	NCBI		HuRef
CHM1_1	3	46,566,173 - 46,574,073 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	46,590,623 - 46,598,545 (+)	NCBI		T2T-CHM13v2.0

Cripto
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	110,768,676 - 110,775,226 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	110,768,671 - 110,775,226 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	110,939,608 - 110,946,158 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	110,939,603 - 110,946,158 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	110,842,112 - 110,848,662 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	110,784,418 - 110,790,883 (-)	NCBI		MGSCv36	mm8
Celera	9	110,664,719 - 110,671,594 (-)	NCBI		Celera
Cytogenetic Map	9	F2	NCBI
cM Map	9	60.79	NCBI

Cripto
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	119,803,182 - 119,808,714 (-)	NCBI		GRCr8
mRatBN7.2	8	110,924,774 - 110,938,545 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	110,925,024 - 110,930,308 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	8	119,215,266 - 119,220,909 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	119,215,495 - 119,219,232 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	118,554,829 - 118,560,094 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	115,341,587 - 115,346,871 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	110,206,645 - 110,212,260 (-)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

Cripto
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	25,477,122 - 25,479,969 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955420	25,476,975 - 25,479,969 (-)	NCBI	ChiLan1.0	ChiLan1.0

CRIPTO
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	46,530,938 - 46,535,958 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	46,535,714 - 46,540,728 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	46,473,282 - 46,478,454 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	47,577,949 - 47,583,126 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	47,577,949 - 47,583,126 (+)	Ensembl	panpan1.1		panPan2

Cripto
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	200,900,937 - 200,905,070 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936596	451,483 - 453,892 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CRIPTO
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	29,540,314 - 29,543,893 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	29,537,874 - 29,544,686 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	32,774,947 - 32,777,177 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CRIPTO
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	7,993,724 - 8,000,935 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	7,997,383 - 8,000,629 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	159,149,573 - 159,153,094 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cripto
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624730	74,547,226 - 74,550,526 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in CRIPTO
40 total Variants

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_005633193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_038426632	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_038504944	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_038565359	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_038629472	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AAEX04000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAHUQ010000236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAQRD010000058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAUVH010000291	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	REHQ01000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSCAFT00845020967 ⟹ ENSCAFP00845016474

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
ROS_Cfam_1.0 Ensembl	20	42,620,327 - 42,623,866 (-)	Ensembl

RefSeq Acc Id:

XM_005633193 ⟹ XP_005633250

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1	20	42,137,939 - 42,140,590 (-)	NCBI
Dog10K_Boxer_Tasha	20	42,053,910 - 42,056,560 (-)	NCBI

Sequence:

show sequence

TTGATTATGACCATTTCCAAAGCGTTTGAACTGGAATTAGTTGCTGGGTTGGGCCACCGTGAACTTTCGAGGAGAGAGCCGCCCTTAAGAGATGGCAGTGTCTGGTCCCGGGAGGAGCCTGCTTTTCA
TCACCGGGCTTCCCACTTTGTGCCCTCCATAGGGATCCAGGACAGTAAGGAGTTAAACAAAACTTGCTGTCTGAATGGGGGAACCTGCATGCTGGGATCCTTCTGTGCCTGCCCCCCCTCCTTCTATG
GTCGCAACTGTGAGCACGATTCTCGAAAAGAGAACTGTGAGTCTGTGCCCCATGACACCTGGCTGCCTAAGAGATGTTCCATGTGTAAATGCTGGCGCGGCCGGCTGCACTGCTTTCGGCAGACATTT
CTACCAGGGTGTGATGGCCACGTGATGGATGAGCACTTCCTGGTTTCCAGGACTCCAGAATTAACACTGTCTTCGGGCACCACTTTTTTGCTAGCTGGCATCTGCCTTGCTCTACAAAGTTACTGTTA
G

hide sequence

RefSeq Acc Id:

XM_038426632 ⟹ XP_038282560

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
ROS_Cfam_1.0	20	42,620,327 - 42,622,979 (-)	NCBI

RefSeq Acc Id:

XM_038504944 ⟹ XP_038360872

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
UMICH_Zoey_3.1	20	41,861,683 - 41,864,330 (-)	NCBI

RefSeq Acc Id:

XM_038565359 ⟹ XP_038421287

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
UU_Cfam_GSD_1.0	20	42,543,717 - 42,546,368 (-)	NCBI

RefSeq Acc Id:

XM_038629472 ⟹ XP_038485400

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
UNSW_CanFamBas_1.0	20	42,262,807 - 42,265,458 (-)	NCBI


Protein RefSeqs	XP_005633250	(Get FASTA)	NCBI Sequence Viewer
	XP_038282560	(Get FASTA)	NCBI Sequence Viewer
	XP_038360872	(Get FASTA)	NCBI Sequence Viewer
	XP_038421287	(Get FASTA)	NCBI Sequence Viewer
	XP_038485400	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSCAFP00030040568.1
	ENSCAFP00040028197.1
	ENSCAFP00845016474
	ENSCAFP00845016474.1

RefSeq Acc Id:	XP_005633250 ⟸ XM_005633193
- UniProtKB:	A0A8C0T1P2 (UniProtKB/TrEMBL), A0A8I3NGL9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTISKAFELELVAGLGHRELSRREPPLRDGSVWSREEPAFHHRASHFVPSIGIQDSKELNKTCCLNGGTCMLGSFCACPPSFYGRNCEHDSRKENCESVPHDTWLPKRCSMCKCWRGRLHCFRQTFLP GCDGHVMDEHFLVSRTPELTLSSGTTFLLAGICLALQSYC hide sequence

RefSeq Acc Id:

XP_038360872 ⟸ XM_038504944

RefSeq Acc Id:

XP_038485400 ⟸ XM_038629472

RefSeq Acc Id:	XP_038282560 ⟸ XM_038426632
- UniProtKB:	A0A8C0T1P2 (UniProtKB/TrEMBL), A0A8I3NGL9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038421287 ⟸ XM_038565359
- UniProtKB:	A0A8C0T1P2 (UniProtKB/TrEMBL), A0A8I3NGL9 (UniProtKB/TrEMBL)

Protein Domains

EGF-like

Database	Acc Id	Source(s)
Ensembl Genes	ENSCAFG00030025136	UniProtKB/TrEMBL
	ENSCAFG00040017484	UniProtKB/TrEMBL
	ENSCAFG00845011802	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSCAFT00030046420.1	UniProtKB/TrEMBL
	ENSCAFT00040032412.1	UniProtKB/TrEMBL
	ENSCAFT00845020967	ENTREZGENE
	ENSCAFT00845020967.1	UniProtKB/TrEMBL
Gene3D-CATH	Laminin	UniProtKB/TrEMBL
InterPro	Cryptic/Cripto_CFC-dom	UniProtKB/TrEMBL
	EGF-like_dom	UniProtKB/TrEMBL
NCBI Gene	TDGF1	ENTREZGENE
Pfam	CFC	UniProtKB/TrEMBL
PROSITE	EGF_1	UniProtKB/TrEMBL
	EGF_3	UniProtKB/TrEMBL
Superfamily-SCOP	EGF/Laminin	UniProtKB/TrEMBL
UniProt	A0A8C0T1P2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I3NGL9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-06-13	CRIPTO	cripto, EGF-CFC family member	TDGF1	teratocarcinoma-derived growth factor 1	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)