Symbol:
S100b
Name:
S100 calcium binding protein B
RGD ID:
3615
Description:
Enables RAGE receptor binding activity; identical protein binding activity; and metal ion binding activity. Involved in several processes, including long-term synaptic potentiation; positive regulation of myelination; and response to anesthetic. Located in extracellular space. Used to study demyelinating disease. Biomarker of several diseases, including bipolar disorder; borna disease; brain edema; cerebrovascular disease (multiple); and depressive disorder. Human ortholog(s) of this gene implicated in Alzheimer's disease; aspergillosis; and schizophrenia. Orthologous to human S100B (S100 calcium binding protein B); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH (+)-pilocarpine; (R)-lipoic acid; 1,2-dimethylhydrazine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC93559; protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; S100 calcium-binding protein beta (neural); S100 calcium-binding protein, beta (neural); S100 protein, beta polypeptide; S100 protein, beta polypeptide, neural; S100P
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
S100B (S100 calcium binding protein B) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
S100b (S100 protein, beta polypeptide, neural) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
S100b (S100 calcium binding protein B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
S100B (S100 calcium binding protein B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
S100B (S100 calcium binding protein B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
S100B (S100 calcium binding protein B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
S100B (S100 calcium binding protein B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
S100b (S100 calcium binding protein B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
S100b (S100 protein, beta polypeptide, neural)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
S100B (S100 calcium binding protein B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
s100b (S100 calcium binding protein, beta (neural))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 12,372,345 - 12,381,159 (-) NCBI GRCr8 mRatBN7.2 20 12,372,866 - 12,381,619 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 12,372,881 - 12,394,743 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 13,071,830 - 13,080,530 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 12,432,755 - 12,441,455 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 12,904,538 - 12,913,238 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 13,130,633 - 13,142,856 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 13,130,636 - 13,142,856 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 15,287,745 - 15,296,485 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 12,791,440 - 12,824,508 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 12,791,666 - 12,824,735 (-) NCBI Celera 20 13,867,276 - 13,875,895 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
S100b Rat (+)-catechin multiple interactions ISO S100B (Homo sapiens) 6480464 Catechin inhibits the reaction [S100B protein results in increased abundance of Reactive Oxygen Species] more ... CTD PMID:17103373 S100b Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of S100B protein CTD PMID:18226170 S100b Rat (R)-lipoic acid multiple interactions EXP 6480464 [Furosemide results in decreased activity of SLC12A2 protein] affects the reaction [Thioctic Acid inhibits the reaction [Ammonia results in increased secretion of S100B protein]] and Thioctic Acid inhibits the reaction [Ammonia results in increased secretion of S100B protein] CTD PMID:23880158 S100b Rat (R)-noradrenaline increases expression ISO S100B (Homo sapiens) 6480464 Norepinephrine results in increased expression of S100B mRNA and Norepinephrine results in increased expression of S100B protein CTD PMID:9788975 S100b Rat (R)-noradrenaline affects response to substance ISO S100B (Homo sapiens) 6480464 S100B protein affects the susceptibility to Norepinephrine CTD PMID:9788975 S100b Rat (S)-nicotine decreases expression ISO S100b (Mus musculus) 6480464 Nicotine results in decreased expression of S100B mRNA CTD PMID:21955143 S100b Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1 more ... CTD PMID:27840820 S100b Rat 1,2-dimethylhydrazine increases expression ISO S100b (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of S100B mRNA CTD PMID:22206623 S100b Rat 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of S100B mRNA CTD PMID:27840820 S100b Rat 1-chloro-2,4-dinitrobenzene decreases expression ISO S100B (Homo sapiens) 6480464 Dinitrochlorobenzene results in decreased expression of S100B mRNA CTD PMID:17374397 S100b Rat 17beta-estradiol increases expression ISO S100b (Mus musculus) 6480464 Estradiol results in increased expression of S100B mRNA CTD PMID:19484750 S100b Rat 2,2,2-tetramine multiple interactions ISO S100B (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate inhibits the reaction [Trientine inhibits the reaction [S100B protein results in increased expression of AGER protein]] more ... CTD PMID:23541064 S100b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO S100B (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of S100B mRNA CTD PMID:17101203 S100b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of S100B mRNA CTD PMID:34747641 S100b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of S100B mRNA CTD PMID:26232522 and PMID:33387578 S100b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO S100b (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of S100B mRNA CTD PMID:24680724 S100b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of S100B mRNA CTD PMID:22808131 and PMID:32109520 S100b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO S100B (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of S100B mRNA CTD PMID:21296121 S100b Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO S100b (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to S100B promoter] CTD PMID:19654925 S100b Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 S100b Rat 2-palmitoylglycerol decreases expression ISO S100B (Homo sapiens) 6480464 2-palmitoylglycerol results in decreased expression of S100B mRNA CTD PMID:37199045 S100b Rat 3',5'-cyclic AMP multiple interactions ISO S100B (Homo sapiens) 6480464 [BDNF protein co-treated with GDNF protein co-treated with Cyclic AMP co-treated with TGFB3 protein co-treated with Ascorbic Acid] results in increased expression of S100B mRNA and [BDNF protein co-treated with GDNF protein co-treated with Cyclic AMP co-treated with TGFB3 protein co-treated with Ascorbic Acid] results in increased expression of S100B protein CTD PMID:33713149 S100b Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO S100b (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of S100B mRNA CTD PMID:25172293 S100b Rat 3,4-dihydroxybenzaldehyde multiple interactions ISO S100B (Homo sapiens) 6480464 protocatechualdehyde inhibits the reaction [S100B protein results in increased expression of AGER mRNA] more ... CTD PMID:17597607 S100b Rat 3,7-dihydropurine-6-thione increases expression EXP 6480464 Mercaptopurine results in increased expression of S100B mRNA CTD PMID:23358152 S100b Rat 3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid multiple interactions EXP 6480464 MK-886 inhibits the reaction [pirinixic acid affects the expression of S100B protein] CTD PMID:16863991 S100b Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO S100B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of S100B mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of S100B mRNA CTD PMID:28628672 S100b Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression ISO S100B (Homo sapiens) 6480464 Oxazolone results in decreased expression of S100B mRNA CTD PMID:17374397 S100b Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of S100B mRNA CTD PMID:24780913 S100b Rat 9-cis-retinoic acid increases expression ISO S100B (Homo sapiens) 6480464 Alitretinoin results in increased expression of S100B mRNA CTD PMID:36805303 S100b Rat aconitine increases expression ISO S100b (Mus musculus) 6480464 Aconitine results in increased expression of S100B protein CTD PMID:28193520 S100b Rat aconitine multiple interactions ISO S100b (Mus musculus) 6480464 ABCB1A gene mutant form promotes the reaction [Aconitine results in increased expression of S100B protein] CTD PMID:28193520 S100b Rat aldehydo-D-glucose multiple interactions ISO S100b (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of S100B mRNA CTD PMID:37567420 S100b Rat all-trans-retinoic acid decreases expression ISO S100B (Homo sapiens) 6480464 Tretinoin results in decreased expression of S100B protein CTD PMID:36805303 and PMID:38070836 S100b Rat all-trans-retinoic acid multiple interactions ISO S100B (Homo sapiens) 6480464 anatoxin a inhibits the reaction [Tretinoin results in decreased expression of S100B protein] and Tretinoin results in increased expression of and results in increased secretion of S100B protein CTD PMID:24451020 and PMID:38070836 S100b Rat all-trans-retinoic acid increases expression ISO S100B (Homo sapiens) 6480464 Tretinoin results in increased expression of S100B mRNA CTD PMID:33167477 and PMID:36805303 S100b Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of S100B mRNA CTD PMID:35163327 S100b Rat aluminium atom increases expression EXP 6480464 Aluminum results in increased expression of S100B protein CTD PMID:16545059 S100b Rat aluminium atom multiple interactions EXP 6480464 Vitamin E inhibits the reaction [Aluminum results in increased expression of S100B protein] CTD PMID:16545059 S100b Rat aluminium(0) increases expression EXP 6480464 Aluminum results in increased expression of S100B protein CTD PMID:16545059 S100b Rat aluminium(0) multiple interactions EXP 6480464 Vitamin E inhibits the reaction [Aluminum results in increased expression of S100B protein] CTD PMID:16545059 S100b Rat aminoguanidine multiple interactions EXP 6480464 pimagedine inhibits the reaction [Streptozocin results in decreased expression of S100B protein] and pimagedine inhibits the reaction [Streptozocin results in increased expression of S100B protein] CTD PMID:19494442 S100b Rat ammonia multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Ammonia results in increased secretion of S100B protein] more ... CTD PMID:23284918 and PMID:23880158 S100b Rat ammonia increases secretion EXP 6480464 Ammonia results in increased secretion of S100B protein CTD PMID:23284918 and PMID:23880158 S100b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of S100B mRNA CTD PMID:16483693 S100b Rat ammonium chloride decreases expression EXP 6480464 Ammonium Chloride results in decreased expression of S100B protein CTD PMID:16483693 S100b Rat Anatoxin a multiple interactions ISO S100B (Homo sapiens) 6480464 anatoxin a inhibits the reaction [Tretinoin results in decreased expression of S100B protein] CTD PMID:38070836 S100b Rat arsenous acid increases expression ISO S100B (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of S100B mRNA CTD PMID:20458559 S100b Rat astemizole decreases expression EXP 6480464 Astemizole results in decreased expression of S100B mRNA CTD PMID:20221588 S100b Rat azithromycin increases expression ISO S100b (Mus musculus) 6480464 Azithromycin results in increased expression of S100B mRNA CTD PMID:37995777 S100b Rat benzo[a]pyrene affects methylation ISO S100B (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of S100B promoter CTD PMID:27901495 S100b Rat benzo[a]pyrene increases methylation ISO S100B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of S100B 5' UTR CTD PMID:27901495 S100b Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of S100B mRNA CTD PMID:16648578 S100b Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of S100B mRNA CTD PMID:25181051 S100b Rat bisphenol A decreases expression ISO S100b (Mus musculus) 6480464 bisphenol A results in decreased expression of S100B mRNA CTD PMID:30245210 S100b Rat bisphenol A multiple interactions ISO S100B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of S100B mRNA CTD PMID:28628672 S100b Rat bisphenol F multiple interactions ISO S100B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of S100B mRNA CTD PMID:28628672 S100b Rat buspirone decreases response to substance ISO S100b (Mus musculus) 6480464 S100B results in decreased susceptibility to Buspirone CTD PMID:12888777 S100b Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of S100B mRNA CTD PMID:19167457 S100b Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of S100B promoter CTD PMID:22457795 S100b Rat calcitriol increases expression ISO S100B (Homo sapiens) 6480464 Calcitriol results in increased expression of S100B mRNA CTD PMID:26485663 S100b Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of S100B protein CTD PMID:17635592 S100b Rat carbofuran increases expression EXP 6480464 Carbofuran results in increased expression of S100B mRNA and Carbofuran results in increased expression of S100B protein CTD PMID:28982980 and PMID:30471306 S100b Rat carbon nanotube decreases expression ISO S100b (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of S100B mRNA CTD PMID:25554681 S100b Rat CGP 52608 multiple interactions ISO S100B (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to S100B gene] CTD PMID:28238834 S100b Rat choline multiple interactions ISO S100b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Dietary Fats co-treated with cyanoginosin LR] results in increased expression of S100B protein and NLRP3 protein affects the reaction [[Methionine deficiency co-treated with Choline deficiency co-treated with Dietary Fats co-treated with cyanoginosin LR] results in increased expression of S100B protein] CTD PMID:34416350 S100b Rat chrysin multiple interactions ISO S100b (Mus musculus) 6480464 chrysin inhibits the reaction [Oxidopamine results in increased expression of S100B protein] CTD PMID:29054324 S100b Rat cobalt atom multiple interactions ISO S100B (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in decreased expression of S100B mRNA CTD PMID:18078969 S100b Rat cocaine multiple interactions EXP 6480464 ipsapirone inhibits the reaction [Cocaine affects the expression of S100B protein] CTD PMID:8041492 S100b Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of S100B protein CTD PMID:8041492 S100b Rat corticosterone multiple interactions EXP 6480464 [Ethanol co-treated with Corticosterone] results in increased expression of and affects the localization of S100B protein and Corticosterone results in increased expression of and affects the localization of S100B protein CTD PMID:38259729 S100b Rat Cuprizon increases expression ISO S100b (Mus musculus) 6480464 Cuprizone results in increased expression of S100B protein CTD PMID:30468814 S100b Rat cycloheximide decreases expression EXP 6480464 Cycloheximide results in decreased expression of S100B mRNA CTD PMID:19146868 S100b Rat D-glucose multiple interactions ISO S100b (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of S100B mRNA CTD PMID:37567420 S100b Rat dexamethasone multiple interactions ISO S100B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of S100B mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of S100B mRNA CTD PMID:28628672 S100b Rat diarsenic trioxide increases expression ISO S100B (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of S100B mRNA CTD PMID:20458559 S100b Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of S100B mRNA CTD PMID:22546817 S100b Rat dibenziodolium multiple interactions ISO S100B (Homo sapiens) 6480464 diphenyleneiodonium inhibits the reaction [S100B protein results in increased expression of CYBB mRNA] CTD PMID:17327432 S100b Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of S100B mRNA CTD PMID:21266533 S100b Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of S100B mRNA CTD PMID:36653537 S100b Rat dimethoate increases expression EXP 6480464 Dimethoate results in increased expression of S100B mRNA and Dimethoate results in increased expression of S100B protein CTD PMID:21941777 S100b Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of S100B mRNA CTD PMID:25152437 S100b Rat dorsomorphin multiple interactions ISO S100B (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 S100b Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of S100B mRNA CTD PMID:29391264 S100b Rat entinostat increases expression ISO S100B (Homo sapiens) 6480464 entinostat results in increased expression of S100B mRNA CTD PMID:27188386 S100b Rat ethanol increases expression ISO S100b (Mus musculus) 6480464 Ethanol results in increased expression of S100B mRNA CTD PMID:21955143 and PMID:30319688 S100b Rat ethanol increases expression EXP 597538460 ethanol increases expression of S100b mRNA in frontal cortex neurons RGD S100b Rat ethanol multiple interactions EXP 6480464 [Ethanol co-treated with Corticosterone] results in increased expression of and affects the localization of S100B protein and Ethanol results in increased expression of and affects the localization of S100B protein CTD PMID:38259729 S100b Rat ethanol affects expression ISO S100b (Mus musculus) 6480464 Ethanol affects the expression of S100B mRNA CTD PMID:30319688 S100b Rat fluoxetine increases response to substance ISO S100b (Mus musculus) 6480464 S100B protein results in increased susceptibility to Fluoxetine CTD PMID:22113448 S100b Rat fluoxetine increases expression EXP 6480464 Fluoxetine results in increased expression of S100B protein CTD PMID:12960766 S100b Rat fluoxetine increases expression ISO S100b (Mus musculus) 6480464 Fluoxetine results in increased expression of S100B mRNA and Fluoxetine results in increased expression of S100B protein CTD PMID:12960766 and PMID:20857517 S100b Rat folic acid decreases expression ISO S100b (Mus musculus) 6480464 Folic Acid results in decreased expression of S100B mRNA CTD PMID:25006883 S100b Rat fructose multiple interactions ISO S100b (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of S100B mRNA CTD PMID:37567420 S100b Rat furosemide multiple interactions EXP 6480464 [Furosemide results in decreased activity of SLC12A2 protein] affects the reaction [Thioctic Acid inhibits the reaction [Ammonia results in increased secretion of S100B protein]] and [Furosemide results in decreased activity of SLC12A2 protein] inhibits the reaction [Ammonia results in increased secretion of S100B protein] CTD PMID:23880158 S100b Rat glucose multiple interactions ISO S100b (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of S100B mRNA CTD PMID:37567420 S100b Rat glyphosate affects expression EXP 6480464 Glyphosate affects the expression of S100B protein CTD PMID:28627408 S100b Rat glyphosate decreases expression ISO S100b (Mus musculus) 6480464 Glyphosate results in decreased expression of S100B mRNA CTD PMID:33348142 S100b Rat heparin affects expression EXP 6480464 Heparin affects the expression of S100B protein CTD PMID:12186470 S100b Rat hydrogen peroxide decreases secretion EXP 6480464 Hydrogen Peroxide results in decreased secretion of S100B protein CTD PMID:18835240 S100b Rat hydroquinone multiple interactions ISO S100B (Homo sapiens) 6480464 hydroquinone results in increased expression of and results in increased secretion of S100B protein CTD PMID:24451020 S100b Rat indometacin multiple interactions ISO S100B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of S100B mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of S100B mRNA CTD PMID:28628672 S100b Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of S100B mRNA CTD PMID:20080153 S100b Rat L-ascorbic acid increases expression EXP 6480464 Ascorbic Acid results in increased expression of S100B mRNA CTD PMID:15372504 S100b Rat L-ascorbic acid multiple interactions ISO S100B (Homo sapiens) 6480464 [BDNF protein co-treated with GDNF protein co-treated with Cyclic AMP co-treated with TGFB3 protein co-treated with Ascorbic Acid] results in increased expression of S100B mRNA and [BDNF protein co-treated with GDNF protein co-treated with Cyclic AMP co-treated with TGFB3 protein co-treated with Ascorbic Acid] results in increased expression of S100B protein CTD PMID:33713149 S100b Rat L-methionine multiple interactions ISO S100b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Dietary Fats co-treated with cyanoginosin LR] results in increased expression of S100B protein and NLRP3 protein affects the reaction [[Methionine deficiency co-treated with Choline deficiency co-treated with Dietary Fats co-treated with cyanoginosin LR] results in increased expression of S100B protein] CTD PMID:34416350 S100b Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of S100B protein CTD PMID:17047031 S100b Rat lipoic acid multiple interactions EXP 6480464 [Furosemide results in decreased activity of SLC12A2 protein] affects the reaction [Thioctic Acid inhibits the reaction [Ammonia results in increased secretion of S100B protein]] and Thioctic Acid inhibits the reaction [Ammonia results in increased secretion of S100B protein] CTD PMID:23880158 S100b Rat manganese(II) chloride increases expression ISO S100b (Mus musculus) 6480464 manganese chloride results in increased expression of S100B mRNA and manganese chloride results in increased expression of S100B protein CTD PMID:15295902 S100b Rat mercaptopurine increases expression EXP 6480464 Mercaptopurine results in increased expression of S100B mRNA CTD PMID:23358152 S100b Rat mercury atom increases secretion ISO S100B (Homo sapiens) 6480464 Mercury results in increased secretion of S100B mRNA CTD PMID:30076900 S100b Rat mercury(0) increases secretion ISO S100B (Homo sapiens) 6480464 Mercury results in increased secretion of S100B mRNA CTD PMID:30076900 S100b Rat Mesaconitine multiple interactions ISO S100b (Mus musculus) 6480464 [ABCB1A protein affects the susceptibility to mesaconitine] which affects the expression of S100B protein CTD PMID:33171190 S100b Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of S100B protein CTD PMID:21783483 S100b Rat microcystin-LR multiple interactions ISO S100b (Mus musculus) 6480464 [cyanoginosin LR co-treated with LCN2 protein] results in increased secretion of S100B protein more ... CTD PMID:34416350 S100b Rat monascin multiple interactions ISO S100B (Homo sapiens) 6480464 monascin inhibits the reaction [S100B protein results in decreased expression of GCLM mRNA] more ... CTD PMID:23331247 S100b Rat morphine decreases expression ISO S100b (Mus musculus) 6480464 Morphine results in decreased expression of S100B mRNA CTD PMID:21955143 S100b Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions EXP 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Ammonia results in increased secretion of S100B protein] CTD PMID:23284918 S100b Rat nickel sulfate decreases expression ISO S100B (Homo sapiens) 6480464 nickel sulfate results in decreased expression of S100B mRNA CTD PMID:17374397 S100b Rat nicotine decreases expression ISO S100b (Mus musculus) 6480464 Nicotine results in decreased expression of S100B mRNA CTD PMID:21955143 S100b Rat nitric oxide multiple interactions ISO S100b (Mus musculus) 6480464 [S100B protein results in increased expression of NOS2 protein] which results in increased abundance of Nitric Oxide and PARP1 gene mutant form inhibits the reaction [S100B protein results in increased secretion of Nitric Oxide] CTD PMID:16376947 and PMID:27444121 S100b Rat nitric oxide increases secretion ISO S100b (Mus musculus) 6480464 S100B protein results in increased secretion of Nitric Oxide CTD PMID:27444121 S100b Rat nitric oxide multiple interactions EXP 6480464 [S100B protein results in increased expression of NOS2 protein] which results in increased abundance of Nitric Oxide CTD PMID:16376947 S100b Rat nitroprusside multiple interactions EXP 6480464 resveratrol inhibits the reaction [Nitroprusside results in increased secretion of S100B protein] CTD PMID:23284918 S100b Rat nitroprusside increases secretion EXP 6480464 Nitroprusside results in increased secretion of S100B protein CTD PMID:23284918 S100b Rat ouabain increases expression EXP 6480464 Ouabain results in increased expression of S100B protein CTD PMID:15581912 S100b Rat oxidopamine multiple interactions ISO S100b (Mus musculus) 6480464 chrysin inhibits the reaction [Oxidopamine results in increased expression of S100B protein] CTD PMID:29054324 S100b Rat oxidopamine increases expression ISO S100b (Mus musculus) 6480464 Oxidopamine results in increased expression of S100B protein CTD PMID:29054324 S100b Rat panobinostat multiple interactions ISO S100B (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of S100B mRNA CTD PMID:27188386 S100b Rat panobinostat increases expression ISO S100B (Homo sapiens) 6480464 panobinostat results in increased expression of S100B mRNA CTD PMID:26272509 S100b Rat paracetamol decreases expression ISO S100B (Homo sapiens) 6480464 Acetaminophen results in decreased expression of S100B mRNA CTD PMID:26690555 S100b Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of S100B mRNA CTD PMID:16854511 S100b Rat paraquat affects expression ISO S100B (Homo sapiens) 6480464 Paraquat affects the expression of S100B mRNA CTD PMID:29454966 S100b Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of S100B protein CTD PMID:24521700 S100b Rat paraquat increases expression ISO S100B (Homo sapiens) 6480464 Paraquat results in increased expression of S100B mRNA and Paraquat results in increased expression of S100B protein CTD PMID:25314302 and PMID:30698896 S100b Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:21673325 S100b Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of S100B protein CTD PMID:20937303 S100b Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of S100B mRNA CTD PMID:35163327 S100b Rat perfluorooctanoic acid increases expression ISO S100B (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of S100B mRNA CTD PMID:33569802 S100b Rat phenethyl caffeate multiple interactions EXP 6480464 NGFR protein affects the susceptibility to [caffeic acid phenethyl ester results in increased expression of S100B protein] CTD PMID:20836997 S100b Rat phenethyl caffeate increases expression EXP 6480464 caffeic acid phenethyl ester results in increased expression of S100B protein CTD PMID:20836997 S100b Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of S100B mRNA CTD PMID:15652358 S100b Rat phenylephrine multiple interactions EXP 6480464 S100A6 protein inhibits the reaction [Phenylephrine results in increased expression of S100B mRNA] more ... CTD PMID:15652358 S100b Rat phorbol 13-acetate 12-myristate multiple interactions ISO S100B (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate inhibits the reaction [Trientine inhibits the reaction [S100B protein results in increased expression of AGER protein]] and Tetradecanoylphorbol Acetate inhibits the reaction [Trientine inhibits the reaction [S100B protein results in increased expression of BACE1 protein]] CTD PMID:23541064 S100b Rat pirinixic acid multiple interactions EXP 6480464 MK-886 inhibits the reaction [pirinixic acid affects the expression of S100B protein] CTD PMID:16863991 S100b Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of S100B protein CTD PMID:16863991 S100b Rat purine-6-thiol increases expression EXP 6480464 Mercaptopurine results in increased expression of S100B mRNA CTD PMID:23358152 S100b Rat quercetin multiple interactions ISO S100B (Homo sapiens) 6480464 Quercetin inhibits the reaction [S100B protein results in increased abundance of Reactive Oxygen Species] more ... CTD PMID:17103373 S100b Rat reactive oxygen species multiple interactions ISO S100B (Homo sapiens) 6480464 Catechin inhibits the reaction [S100B protein results in increased abundance of Reactive Oxygen Species] and Quercetin inhibits the reaction [S100B protein results in increased abundance of Reactive Oxygen Species] CTD PMID:17103373 S100b Rat reactive oxygen species increases abundance EXP 6480464 S100B protein results in increased abundance of Reactive Oxygen Species CTD PMID:16376947 S100b Rat reactive oxygen species increases abundance ISO S100b (Mus musculus) 6480464 S100B protein results in increased abundance of Reactive Oxygen Species CTD PMID:16376947 S100b Rat reactive oxygen species increases abundance ISO S100B (Homo sapiens) 6480464 S100B protein results in increased abundance of Reactive Oxygen Species CTD PMID:17103373 S100b Rat resveratrol increases secretion EXP 6480464 resveratrol results in increased secretion of S100B protein CTD PMID:17554623 S100b Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of S100B protein CTD PMID:16904623 S100b Rat resveratrol multiple interactions EXP 6480464 Resveratrol inhibits the reaction [Ammonia results in increased secretion of S100B protein] and Resveratrol inhibits the reaction [Nitroprusside results in increased secretion of S100B protein] CTD PMID:23284918 S100b Rat risperidone increases secretion EXP 6480464 Risperidone results in increased secretion of S100B protein CTD PMID:18421423 S100b Rat sarin increases expression EXP 6480464 Sarin results in increased expression of S100B mRNA CTD PMID:16733813 S100b Rat SB 203580 multiple interactions ISO S100b (Mus musculus) 6480464 SB 203580 inhibits the reaction [S100B protein results in increased expression of NOS2 mRNA] and SB 203580 inhibits the reaction [S100B protein results in increased expression of NOS2 protein] CTD PMID:16376947 S100b Rat SB 431542 multiple interactions ISO S100B (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 S100b Rat sodium arsenite increases expression ISO S100b (Mus musculus) 6480464 sodium arsenite results in increased expression of S100B mRNA CTD PMID:37682722 S100b Rat sodium dodecyl sulfate multiple interactions ISO S100B (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of and results in increased secretion of S100B protein CTD PMID:24451020 S100b Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of S100B mRNA CTD PMID:19281266 S100b Rat streptozocin multiple interactions EXP 6480464 pimagedine inhibits the reaction [Streptozocin results in decreased expression of S100B protein] and pimagedine inhibits the reaction [Streptozocin results in increased expression of S100B protein] CTD PMID:19494442 S100b Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of S100B protein CTD PMID:19494442 and PMID:20953641 S100b Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of S100B protein CTD PMID:19494442 S100b Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of S100B mRNA CTD PMID:34792689 S100b Rat thioacetamide multiple interactions EXP 6480464 FPS-ZM1 inhibits the reaction [S100B protein promotes the reaction [Thioacetamide results in increased expression of and results in increased secretion of VEGFA protein]] more ... CTD PMID:34792689 S100b Rat titanium dioxide decreases expression ISO S100b (Mus musculus) 6480464 titanium dioxide results in decreased expression of S100B mRNA CTD PMID:23557971 S100b Rat titanium dioxide affects expression ISO S100b (Mus musculus) 6480464 titanium dioxide affects the expression of S100B mRNA CTD PMID:17656681 S100b Rat trichostatin A increases expression ISO S100B (Homo sapiens) 6480464 trichostatin A results in increased expression of S100B mRNA CTD PMID:24935251 and PMID:26272509 S100b Rat trichostatin A multiple interactions ISO S100B (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of S100B mRNA CTD PMID:27188386 S100b Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of S100B mRNA CTD PMID:33078273 S100b Rat triptonide increases expression ISO S100b (Mus musculus) 6480464 triptonide results in increased expression of S100B mRNA CTD PMID:33045310 S100b Rat Tungsten carbide multiple interactions ISO S100B (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in decreased expression of S100B mRNA CTD PMID:18078969 S100b Rat valproic acid affects expression ISO S100b (Mus musculus) 6480464 Valproic Acid affects the expression of S100B mRNA CTD PMID:17292431 S100b Rat valproic acid decreases expression ISO S100b (Mus musculus) 6480464 Valproic Acid results in decreased expression of S100B mRNA CTD PMID:29261810 S100b Rat valproic acid increases expression ISO S100B (Homo sapiens) 6480464 Valproic Acid results in increased expression of S100B mRNA CTD PMID:23179753 more ... S100b Rat valproic acid multiple interactions ISO S100B (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of S100B mRNA CTD PMID:27188386 S100b Rat valproic acid decreases methylation ISO S100B (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of S100B gene CTD PMID:29154799 S100b Rat valproic acid affects expression ISO S100B (Homo sapiens) 6480464 Valproic Acid affects the expression of S100B mRNA CTD PMID:25979313 S100b Rat veliparib multiple interactions ISO S100b (Mus musculus) 6480464 veliparib inhibits the reaction [S100B protein results in increased expression of IL1B mRNA] and veliparib inhibits the reaction [S100B protein results in increased expression of NOS2 mRNA] CTD PMID:27444121 S100b Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of S100B mRNA CTD PMID:23034163 S100b Rat vitamin E multiple interactions EXP 6480464 Vitamin E inhibits the reaction [Aluminum results in increased expression of S100B protein] CTD PMID:16545059 S100b Rat vorinostat increases expression ISO S100B (Homo sapiens) 6480464 vorinostat results in increased expression of S100B mRNA CTD PMID:27188386 S100b Rat vorinostat multiple interactions ISO S100B (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of S100B mRNA CTD PMID:27188386
(+)-catechin (ISO) (+)-pilocarpine (EXP) (R)-lipoic acid (EXP) (R)-noradrenaline (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (EXP,ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (ISO) 2,2,2-tetramine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-palmitoylglycerol (ISO) 3',5'-cyclic AMP (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-dihydroxybenzaldehyde (ISO) 3,7-dihydropurine-6-thione (EXP) 3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 6-propyl-2-thiouracil (EXP) 9-cis-retinoic acid (ISO) aconitine (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) aluminium atom (EXP) aluminium(0) (EXP) aminoguanidine (EXP) ammonia (EXP) ammonium chloride (EXP) Anatoxin a (ISO) arsenous acid (ISO) astemizole (EXP) azithromycin (ISO) benzo[a]pyrene (ISO) bexarotene (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) buspirone (ISO) C60 fullerene (EXP) cadmium dichloride (EXP) calcitriol (ISO) capsaicin (EXP) carbofuran (EXP) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) chrysin (ISO) cobalt atom (ISO) cocaine (EXP) corticosterone (EXP) Cuprizon (ISO) cycloheximide (EXP) D-glucose (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (EXP) dibenziodolium (ISO) dibutyl phthalate (EXP) diethylstilbestrol (EXP) dimethoate (EXP) diuron (EXP) dorsomorphin (ISO) endosulfan (EXP) entinostat (ISO) ethanol (EXP,ISO) fluoxetine (EXP,ISO) folic acid (ISO) fructose (ISO) furosemide (EXP) glucose (ISO) glyphosate (EXP,ISO) heparin (EXP) hydrogen peroxide (EXP) hydroquinone (ISO) indometacin (ISO) ketamine (EXP) L-ascorbic acid (EXP,ISO) L-methionine (ISO) lead diacetate (EXP) lipoic acid (EXP) manganese(II) chloride (ISO) mercaptopurine (EXP) mercury atom (ISO) mercury(0) (ISO) Mesaconitine (ISO) methylmercury chloride (EXP) microcystin-LR (ISO) monascin (ISO) morphine (ISO) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP) nickel sulfate (ISO) nicotine (ISO) nitric oxide (EXP,ISO) nitroprusside (EXP) ouabain (EXP) oxidopamine (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (EXP,ISO) PCB138 (EXP) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (EXP,ISO) phenethyl caffeate (EXP) phenylephrine (EXP) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (EXP) purine-6-thiol (EXP) quercetin (ISO) reactive oxygen species (EXP,ISO) resveratrol (EXP) risperidone (EXP) sarin (EXP) SB 203580 (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) Soman (EXP) streptozocin (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (EXP) triptonide (ISO) Tungsten carbide (ISO) valproic acid (ISO) veliparib (ISO) vinclozolin (EXP) vitamin E (EXP) vorinostat (ISO)
Biological Process
adaptive thermogenesis (IEA,ISO,ISS) astrocyte differentiation (IEP) cell adhesion (IEA) cellular response to hypoxia (IEP) learning or memory (IEA,ISO,ISS) long-term synaptic potentiation (IEP) memory (IEA,ISO) negative regulation of skeletal muscle cell differentiation (IMP) neuron projection extension (IEA,ISO) positive regulation of apoptotic process (IMP) positive regulation of canonical NF-kappaB signal transduction (IBA,IEA,ISO) positive regulation of cell population proliferation (IBA,IMP) positive regulation of myelination (IMP) positive regulation of neuron differentiation (IEA,ISO) positive regulation of synaptic transmission (IMP) regulation of cell shape (IMP) regulation of neuronal synaptic plasticity (IEA,ISO) response to anesthetic (IEP) response to ethanol (IEP) response to glucocorticoid (IEP) response to methylmercury (IEP) sympathetic neuron projection extension (IEA,ISO,ISS)
Cellular Component
ciliary basal body (IEA,ISO) cilium (IEA,ISO) cytoplasm (IBA,IEA,ISO,ISS) cytosol (IEA,ISO) extracellular region (IEA,ISO) extracellular space (IBA,IDA) intracellular membrane-bounded organelle (IEA,ISO) microtubule cytoskeleton (IEA,ISO) neuronal cell body (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IBA,IEA,ISO) perinuclear region of cytoplasm (IEA,ISO) ruffle (IEA,ISO)
Molecular Function
calcium ion binding (IBA,IDA,IEA,ISO) calcium-dependent protein binding (IBA,IEA,ISO) identical protein binding (IEA,IPI,ISO) metal ion binding (IEA) protein binding (IPI,ISO) protein homodimerization activity (IEA,ISO) RAGE receptor binding (IBA,IEA,IPI,ISO) S100 protein binding (IBA,IEA,ISO) signaling receptor binding (IPI) tau protein binding (ISS) zinc ion binding (IDA,IEA,ISO,ISS)
1.
S100B expression in and effects on microglia.
Adami C, etal., Glia. 2001 Feb;33(2):131-42.
2.
Effect of endurance exercise training on the expression of GFAP, S100B, and NSE in the striatum of chronic/progressive mouse model of Parkinson's disease.
Al-Jarrah MD and Jamous M, NeuroRehabilitation. 2011;28(4):359-63.
3.
Intermittent hypoxia during sleep induces reactive gliosis and limited neuronal death in rats: implications for sleep apnea.
Aviles-Reyes RX, etal., J Neurochem. 2010 Feb;112(4):854-69. Epub 2009 Dec 10.
4.
Melatonin reduces glial reactivity in the hippocampus, cortex, and cerebellum of streptozotocin-induced diabetic rats.
Baydas G, etal., Free Radic Biol Med. 2003 Oct 1;35(7):797-804.
5.
Systemic markers of inflammation are independently associated with S100B concentration: results of an observational study in subjects with acute ischaemic stroke.
Beer C, etal., J Neuroinflammation. 2010 Oct 29;7:71.
6.
Trajectory analysis of serum biomarker concentrations facilitates outcome prediction after pediatric traumatic and hypoxemic brain injury.
Berger RP, etal., Dev Neurosci. 2010;32(5-6):396-405. Epub 2010 Sep 18.
7.
Neurobiochemical markers of brain damage in cerebrospinal fluid of acute ischemic stroke patients.
Brouns R, etal., Clin Chem. 2010 Mar;56(3):451-8. Epub 2009 Dec 3.
8.
S100B Protein Regulates Astrocyte Shape and Migration via Interaction with Src Kinase: IMPLICATIONS FOR ASTROCYTE DEVELOPMENT, ACTIVATION, AND TUMOR GROWTH.
Brozzi F, etal., J Biol Chem. 2009 Mar 27;284(13):8797-811. Epub 2009 Jan 15.
9.
A single course of antenatal betamethasone reduces neurotrophic factor S100B concentration in the hippocampus and serum in the neonatal rat.
Bruschettini M, etal., Brain Res Dev Brain Res. 2005 Oct 6;159(2):113-8.
10.
Association of increased S100B, S100A6 and S100P in serum levels with acute coronary syndrome and also with the severity of myocardial infarction in cardiac tissue of rat models with ischemia-reperfusion injury.
Cai XY, etal., Atherosclerosis. 2011 Aug;217(2):536-42. Epub 2011 May 27.
11.
Pulpar tooth injury induces plastic changes in S100B positive astroglial cells in the trigeminal subnucleus caudalis.
Canzobre MC and Rios H, Neurosci Lett. 2010 Feb 5;470(1):71-5. Epub 2009 Dec 30.
12.
Peripheral administration of human adrenomedullin and its binding protein attenuates stroke-induced apoptosis and brain injury in rats.
Chaung WW, etal., Mol Med. 2011;17(9-10):1075-83. doi: 10.2119/molmed.2010.00104. Epub 2011 Jun 17.
13.
Serum levels of S100B and NSE proteins in Alzheimer's disease patients.
Chaves ML, etal., J Neuroinflammation. 2010 Jan 27;7:6.
14.
The role of cerebrospinal fluid 14-3-3 and other proteins in the diagnosis of sporadic Creutzfeldt-Jakob disease in the UK: a 10-year review.
Chohan G, etal., J Neurol Neurosurg Psychiatry. 2010 Nov;81(11):1243-8. Epub 2010 Sep 20.
15.
Insulin reduces cerebral ischemia/reperfusion injury in the hippocampus of diabetic rats: a role for glycogen synthase kinase-3beta.
Collino M, etal., Diabetes. 2009 Jan;58(1):235-42. Epub 2008 Oct 7.
16.
Genetically-determined hyperfunction of the S100B/RAGE axis is a risk factor for aspergillosis in stem cell transplant recipients.
Cunha C, etal., PLoS One. 2011;6(11):e27962. doi: 10.1371/journal.pone.0027962. Epub 2011 Nov 17.
17.
Methylmercury increases S100B content in rat cerebrospinal fluid.
Farina M, etal., Environ Toxicol Pharmacol. 2005 Feb;19(2):249-53.
18.
Usefulness of serum S100B as a marker for the acute phase of aquaporin-4 autoimmune syndrome.
Fujii C, etal., Neurosci Lett. 2011 Apr 20;494(1):86-8. Epub 2011 Mar 1.
19.
SOX10 transactivates S100B to suppress Schwann cell proliferation and to promote myelination.
Fujiwara S, etal., PLoS One. 2014 Dec 23;9(12):e115400. doi: 10.1371/journal.pone.0115400. eCollection 2014.
20.
Astrocytes are an early target in osmotic demyelination syndrome.
Gankam Kengne F, etal., J Am Soc Nephrol. 2011 Oct;22(10):1834-45. Epub 2011 Sep 1.
21.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
22.
Increased S100B in cerebrospinal fluid of infants with bacterial meningitis: relationship to brain damage and routine cerebrospinal fluid findings.
Gazzolo D, etal., Clin Chem. 2004 May;50(5):941-4.
23.
Urinary S100B protein measurements: A tool for the early identification of hypoxic-ischemic encephalopathy in asphyxiated full-term infants.
Gazzolo D, etal., Crit Care Med. 2004 Jan;32(1):131-6.
24.
Brain damage following severe acute normovolemic hemodilution in combination with controlled hypotension in rats.
Ge YL, etal., Acta Anaesthesiol Scand. 2007 Nov;51(10):1331-7.
25.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
26.
High glutamate decreases S100B secretion stimulated by serum deprivation in astrocytes.
Goncalves D, etal., Neuroreport 2002 Aug 27;13(12):1533-5.
27.
Increased serum S-100B and neuron specific enolase - Potential markers of early nervous system involvement in essential hypertension.
Gonzalez-Quevedo A, etal., Clin Biochem. 2011 Feb;44(2-3):154-9. Epub 2010 Dec 1.
28.
Septic encephalopathy: relationship to serum and cerebrospinal fluid levels of adhesion molecules, lipid peroxides and S-100B protein.
Hamed SA, etal., Neuropediatrics. 2009 Apr;40(2):66-72. Epub 2009 Oct 6.
29.
Cannabinoid CB1 receptor stimulation affords neuroprotection in MPTP-induced neurotoxicity by attenuating S100B up-regulation in vitro.
Iuvone T, etal., J Mol Med (Berl). 2007 Dec;85(12):1379-92. Epub 2007 Jul 17.
30.
S100B and brain natriuretic peptide predict functional neurological outcome after intracerebral haemorrhage.
James ML, etal., Biomarkers. 2009 Sep;14(6):388-94.
31.
Early reaction of astroglial cells in rat hippocampus to streptozotocin-induced diabetes.
Lebed YV, etal., Neurosci Lett. 2008 Oct 24;444(2):181-5. Epub 2008 Aug 8.
32.
Elevated serum S100B levels in acute spinal fracture without head injury.
Lee SJ, etal., Emerg Med J. 2010 Mar;27(3):209-12.
33.
Oral Uncaria rhynchophylla (UR) reduces kainic acid-induced epileptic seizures and neuronal death accompanied by attenuating glial cell proliferation and S100B proteins in rats.
Lin YW and Hsieh CL, J Ethnopharmacol. 2011 May 17;135(2):313-20. Epub 2011 Mar 21.
34.
SNPs and haplotypes in the S100B gene reveal association with schizophrenia.
Liu J, etal., Biochem Biophys Res Commun. 2005 Mar 4;328(1):335-41. doi: 10.1016/j.bbrc.2004.12.175.
35.
Novel interaction of the dopamine D2 receptor and the Ca2+ binding protein S100B: role in D2 receptor function.
Liu Y, etal., Mol Pharmacol. 2008 Aug;74(2):371-8. Epub 2008 Apr 29.
36.
Increased cerebrospinal fluid levels of S100B protein in rat model of mania induced by ouabain.
Machado-Vieira R, etal., Life Sci. 2004 Dec 31;76(7):805-11.
37.
Increased S100B serum levels in dilated cardiomyopathy patients.
Mazzini GS, etal., J Card Fail. 2007 Dec;13(10):850-4.
38.
The zinc- and calcium-binding S100B interacts and co-localizes with IQGAP1 during dynamic rearrangement of cell membranes.
Mbele GO, etal., J Biol Chem 2002 Dec 20;277(51):49998-50007.
39.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
40.
Overexpression of human S100B exacerbates cerebral amyloidosis and gliosis in the Tg2576 mouse model of Alzheimer's disease.
Mori T, etal., Glia. 2010 Feb;58(3):300-14.
41.
Effects of antibodies against protein S100b on synaptic transmission and long-term potentiation in CA-1 hippocampal neurons in rats.
Motin VG, etal., Bull Exp Biol Med. 2002 Feb;133(2):110-3.
42.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
43.
Vitamin D and calcium co-therapy mitigates pre-established cadmium nephropathy by regulating renal calcium homeostatic molecules and improving anti-oxidative and anti-inflammatory activities in rat.
Obaid AA, etal., J Trace Elem Med Biol. 2023 May 24;79:127221. doi: 10.1016/j.jtemb.2023.127221.
44.
Downregulation of an astrocyte-derived inflammatory protein, S100B, reduces vascular inflammatory responses in brains persistently infected with Borna disease virus.
Ohtaki N, etal., J Virol. 2007 Jun;81(11):5940-8. Epub 2007 Mar 21.
45.
Biochemical brain markers and purinergic parameters in rat CSF after seizure induced by pentylenetetrazol.
Oses JP, etal., Brain Res Bull. 2004 Sep 30;64(3):237-42.
46.
Circulating S100B is increased after bilateral femur fracture without brain injury in the rat.
Pelinka LE, etal., Br J Anaesth. 2003 Oct;91(4):595-7.
47.
Markers for different glial cell responses in multiple sclerosis: clinical and pathological correlations.
Petzold A, etal., Brain. 2002 Jul;125(Pt 7):1462-73.
48.
Neuronal and glial cerebrospinal fluid protein biomarkers are elevated after West Nile virus infection.
Petzold A, etal., Muscle Nerve. 2010 Jan;41(1):42-9.
49.
Regulation of S100B gene in rat hippocampal CA1 area during long term potentiation.
Pustylnyak VO, etal., Brain Res. 2011 Jun 7;1394:33-9. Epub 2011 Apr 20.
50.
Increased serum S100B levels in chronic schizophrenic patients on long-term clozapine or typical antipsychotics.
Qi LY, etal., Neurosci Lett. 2009 Sep 22;462(2):113-7. Epub 2009 Jun 17.
51.
GOA pipeline
RGD automated data pipeline
52.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
53.
Treadmill training restores spatial cognitive deficits and neurochemical alterations in the hippocampus of rats submitted to an intracerebroventricular administration of streptozotocin.
Rodrigues L, etal., J Neural Transm. 2010 Nov;117(11):1295-305. Epub 2010 Oct 16.
54.
PSAPP mice exhibit regionally selective reductions in gliosis and plaque deposition in response to S100B ablation.
Roltsch E, etal., J Neuroinflammation. 2010 Nov 16;7:78.
55.
RAGE-TXNIP axis is required for S100B-promoted Schwann cell migration, fibronectin expression and cytokine secretion.
Sbai O, etal., J Cell Sci. 2010 Dec 15;123(Pt 24):4332-9. Epub 2010 Nov 23.
56.
Calcium, troponin, calmodulin, S100 proteins: from myocardial basics to new therapeutic strategies.
Schaub MC and Heizmann CW, Biochem Biophys Res Commun. 2008 Apr 25;369(1):247-64. Epub 2007 Oct 25.
57.
Antisense inhibition of glial S100 beta production results in alterations in cell morphology, cytoskeletal organization, and cell proliferation.
Selinfreund RH, etal., J Cell Biol. 1990 Nov;111(5 Pt 1):2021-8.
58.
The danger signal S100B integrates pathogen- and danger-sensing pathways to restrain inflammation.
Sorci G, etal., PLoS Pathog. 2011 Mar;7(3):e1001315. Epub 2011 Mar 10.
59.
Neurofilaments in blood and CSF for diagnosis and prediction of onset in Creutzfeldt-Jakob disease.
Steinacker P, etal., Sci Rep. 2016 Dec 8;6:38737. doi: 10.1038/srep38737.
60.
Serum S100B is a useful surrogate marker for long-term outcomes in photochemically-induced thrombotic stroke rat models.
Tanaka Y, etal., Life Sci. 2007 Aug 2;81(8):657-63. Epub 2007 Jul 21.
61.
Developmental changes in S100B content in brain tissue, cerebrospinal fluid, and astrocyte cultures of rats.
Tramontina F, etal., Cell Mol Neurobiol 2002 Jun;22(3):373-8.
62.
Regulation of the S100B gene by alpha 1-adrenergic stimulation in cardiac myocytes.
Tsoporis JN, etal., Am J Physiol Heart Circ Physiol 2003 Jan;284(1):H193-203.
63.
S100B interaction with the receptor for advanced glycation end products (RAGE): a novel receptor-mediated mechanism for myocyte apoptosis postinfarction.
Tsoporis JN, etal., Circ Res. 2010 Jan 8;106(1):93-101. Epub 2009 Nov 12.
64.
S100B protein in myoblasts modulates myogenic differentiation via NF-kappaB-dependent inhibition of MyoD expression.
Tubaro C, etal., J Cell Physiol. 2010 Apr;223(1):270-82.
65.
Increased receptor for advanced glycation end product expression in the human alcoholic prefrontal cortex is linked to adolescent drinking.
Vetreno RP, etal., Neurobiol Dis. 2013 Nov;59:52-62. doi: 10.1016/j.nbd.2013.07.002. Epub 2013 Jul 15.
66.
Object-based analysis of astroglial reaction and astrocyte subtype morphology after ischemic brain injury.
Wagner DC, etal., Acta Neurobiol Exp (Wars). 2013;73(1):79-87.
67.
Neuroprotective effects of caffeic acid phenethyl ester against sevoflurane‑induced neuronal degeneration in the hippocampus of neonatal rats involve MAPK and PI3K/Akt signaling pathways.
Wang LY, etal., Mol Med Rep. 2016 Oct;14(4):3403-12. doi: 10.3892/mmr.2016.5586. Epub 2016 Aug 4.
68.
Combined prediction of miR-210 and miR-374a for severity and prognosis of hypoxic-ischemic encephalopathy.
Wang Z, etal., Brain Behav. 2017 Dec 30;8(1):e00835. doi: 10.1002/brb3.835. eCollection 2018 Jan.
69.
Location of the Zn(2+)-binding site on S100B as determined by NMR spectroscopy and site-directed mutagenesis.
Wilder PT, etal., Biochemistry. 2003 Nov 25;42(46):13410-21. doi: 10.1021/bi035334q.
70.
Solution structure of zinc- and calcium-bound rat S100B as determined by nuclear magnetic resonance spectroscopy.
Wilder PT, etal., Biochemistry. 2005 Apr 19;44(15):5690-702.
71.
Refinement of the solution structure and dynamic properties of Ca(2+)-bound rat S100B.
Wright NT, etal., J Biomol NMR. 2008 Dec;42(4):279-86. Epub 2008 Oct 24.
72.
Expression of S100 protein family members in the pathogenesis of bladder tumors.
Yao R, etal., Anticancer Res. 2007 Sep-Oct;27(5A):3051-8.
73.
Brain-derived neurotrophic factor (BDNF) infusion restored astrocytic plasticity in the hippocampus of a rat model of depression.
Ye Y, etal., Neurosci Lett. 2011 Sep 26;503(1):15-9. Epub 2011 Aug 6.
74.
Elevated S100B and neuron specific enolase levels in patients with migraine-without aura: evidence for neurodegeneration?
Yilmaz N, etal., Cell Mol Neurobiol. 2011 May;31(4):579-85. Epub 2011 Feb 4.
75.
Risk variants in the S100B gene, associated with elevated S100B levels, are also associated with visuospatial disability of schizophrenia.
Zhai J, etal., Behav Brain Res. 2011 Mar 1;217(2):363-8. Epub 2010 Nov 9.
76.
Serum concentrations of NSE and S100B in spinocerebellar ataxia type 3/Machado-Joseph disease.
Zhou J, etal., Zhong Nan Da Xue Xue Bao Yi Xue Ban. 2011 Jun;36(6):504-10.
77.
The usefulness of S100B, NSE, GFAP, NF-H, secretagogin and Hsp70 as a predictive biomarker of outcome in children with traumatic brain injury.
Zurek J and Fedora M, Acta Neurochir (Wien). 2011 Oct 7.
S100b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 12,372,345 - 12,381,159 (-) NCBI GRCr8 mRatBN7.2 20 12,372,866 - 12,381,619 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 12,372,881 - 12,394,743 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 13,071,830 - 13,080,530 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 12,432,755 - 12,441,455 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 12,904,538 - 12,913,238 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 13,130,633 - 13,142,856 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 13,130,636 - 13,142,856 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 15,287,745 - 15,296,485 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 12,791,440 - 12,824,508 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 12,791,666 - 12,824,735 (-) NCBI Celera 20 13,867,276 - 13,875,895 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
S100B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 21 46,598,604 - 46,605,082 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 21 46,598,604 - 46,605,208 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 21 48,018,517 - 48,024,995 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 21 46,842,959 - 46,849,463 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 21 46,842,958 - 46,849,424 NCBI Celera 21 33,131,698 - 33,138,202 (-) NCBI Celera Cytogenetic Map 21 q22.3 NCBI HuRef 21 33,398,429 - 33,404,960 (-) NCBI HuRef CHM1_1 21 47,579,370 - 47,585,892 (-) NCBI CHM1_1 T2T-CHM13v2.0 21 44,984,829 - 44,991,348 (-) NCBI T2T-CHM13v2.0
S100b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 76,089,670 - 76,097,153 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 76,089,687 - 76,096,993 (+) Ensembl GRCm39 Ensembl GRCm38 10 76,253,836 - 76,261,319 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 76,253,853 - 76,261,159 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 75,716,581 - 75,724,064 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 75,697,569 - 75,703,813 (+) NCBI MGSCv36 mm8 Celera 10 77,297,763 - 77,305,246 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 38.76 NCBI
S100b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955407 42,972,584 - 42,980,510 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955407 42,972,584 - 42,980,510 (-) NCBI ChiLan1.0 ChiLan1.0
S100B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 22 42,780,225 - 42,786,453 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 21 37,589,861 - 37,596,083 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 21 33,063,845 - 33,070,073 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 21 46,197,750 - 46,203,953 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 21 46,197,750 - 46,203,953 (-) Ensembl panpan1.1 panPan2
S100B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 31 39,783,990 - 39,788,289 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 31 39,784,506 - 39,788,183 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 31 39,014,186 - 39,018,506 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 31 39,427,666 - 39,431,986 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 31 39,288,949 - 39,293,268 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 31 39,249,760 - 39,254,080 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 31 39,768,041 - 39,772,361 (-) NCBI UU_Cfam_GSD_1.0
S100B No map positions available.
S100B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 90,188,820 - 90,194,986 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 90,188,639 - 90,195,023 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 18,611,924 - 18,618,244 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
S100b
.
Predicted Target Of
Count of predictions: 102 Count of miRNA genes: 86 Interacting mature miRNAs: 92 Transcripts: ENSRNOT00000001743 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
4889870 Pur30 Proteinuria QTL 30 19 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 8042410 29322208 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 4889857 Pur27 Proteinuria QTL 27 12.2 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 4606607 17617956 Rat 70154 Insul2 Insulin level QTL 2 3.75 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 6691706 17489458 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 1581577 Pur15 Proteinuria QTL 15 4.38 0.0002 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 20 8042410 17617956 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590092 Insglur9 Insulin/glucose ratio QTL 9 18.38 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 20 11757515 54435887 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 1558640 Prcs2 Prostate cancer susceptibility QTL 2 3.3 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 20 4606607 17617956 Rat 631265 Iresp1 Immunoglobin response QTL1 8.3 blood anti-double stranded DNA antibody amount (VT:0004762) serum anti-DNA antibody level (CMO:0001533) 20 9039719 13461775 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 7411652 Foco24 Food consumption QTL 24 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 11757515 54435887 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
D20Wox6
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 12,374,046 - 12,374,191 (+) MAPPER mRatBN7.2 Rnor_6.0 20 13,131,801 - 13,131,945 NCBI Rnor6.0 Rnor_5.0 20 15,288,913 - 15,289,057 UniSTS Rnor5.0 RGSC_v3.4 20 12,792,605 - 12,792,749 UniSTS RGSC3.4 Celera 20 13,868,441 - 13,868,585 UniSTS Cytogenetic Map 20 p12 UniSTS
RH94706
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 12,373,324 - 12,373,504 (+) MAPPER mRatBN7.2 Rnor_6.0 20 13,131,079 - 13,131,258 NCBI Rnor6.0 Rnor_5.0 20 15,288,191 - 15,288,370 UniSTS Rnor5.0 RGSC_v3.4 20 12,791,883 - 12,792,062 UniSTS RGSC3.4 Celera 20 13,867,719 - 13,867,898 UniSTS Cytogenetic Map 20 p12 UniSTS
AA945753
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 12,420,339 - 12,420,435 (+) MAPPER mRatBN7.2 Rnor_6.0 20 13,212,310 - 13,212,405 NCBI Rnor6.0 Rnor_5.0 20 15,366,644 - 15,366,739 UniSTS Rnor5.0 RGSC_v3.4 20 12,816,715 - 12,816,810 UniSTS RGSC3.4 Celera 20 13,914,039 - 13,914,134 UniSTS Cytogenetic Map 20 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
45
107
89
88
57
25
57
6
212
93
87
45
57
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001743 ⟹ ENSRNOP00000001743
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 12,372,881 - 12,381,781 (-) Ensembl Rnor_6.0 Ensembl 20 13,130,636 - 13,142,856 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096333 ⟹ ENSRNOP00000085085
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 12,373,163 - 12,394,743 (-) Ensembl
RefSeq Acc Id:
NM_013191 ⟹ NP_037323
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 12,372,348 - 12,381,081 (-) NCBI mRatBN7.2 20 12,372,882 - 12,381,619 (-) NCBI Rnor_6.0 20 13,130,636 - 13,142,856 (-) NCBI Rnor_5.0 20 15,287,745 - 15,296,485 (-) NCBI RGSC_v3.4 20 12,791,440 - 12,824,508 (-) RGD Celera 20 13,867,276 - 13,875,895 (-) RGD
Sequence:
AAGTCCACACCCAGTCCTCTCTGGAGGAAGAAAAGGGAGCTTCTCTGTCTACCCTCCTAGTCCTTGGACACCGAAGCCAGAGAGGACTCCGGCGGCAAAAGGTGACCAGGAGCCTCCGGGATGTCTGA
hide sequence
RefSeq Acc Id:
XM_008772868 ⟹ XP_008771090
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 12,372,345 - 12,381,159 (-) NCBI mRatBN7.2 20 12,372,866 - 12,381,538 (-) NCBI Rnor_6.0 20 13,130,633 - 13,137,526 (-) NCBI
Sequence:
ATTTATGGGAGGTACTTCAGGTATCTGGAAAAGACGAGCAAACTGAGGAACCAGAGGGTCAACAAAGGCCAAAAACCTTCCTTTCTCTTGCTGAGATCGTTCATAAAAAATCCTCCGGGATGTCTGAG
hide sequence
RefSeq Acc Id:
XM_017601568 ⟹ XP_017457057
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 12,372,345 - 12,381,108 (-) NCBI mRatBN7.2 20 12,372,866 - 12,381,473 (-) NCBI Rnor_6.0 20 13,130,633 - 13,142,854 (-) NCBI
Sequence:
GTCCACACCCAGTCCTCTCTGGAGGAAGAAAAAGGAGCTTCTCTGTCTACCCTCCTAGTCCTCGGACACCGAAGCCAGAGAGGACTCCGGCGGCAAAAGGTGACCAGGAGGTGAGAAAGAGTCACTGG
hide sequence
RefSeq Acc Id:
XM_063278986 ⟹ XP_063135056
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 12,372,345 - 12,381,010 (-) NCBI
RefSeq Acc Id:
NP_037323 ⟸ NM_013191
- UniProtKB:
P04631 (UniProtKB/Swiss-Prot), A6JKD9 (UniProtKB/TrEMBL)
- Sequence:
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
hide sequence
RefSeq Acc Id:
XP_008771090 ⟸ XM_008772868
- Peptide Label:
isoform X1
- UniProtKB:
P04631 (UniProtKB/Swiss-Prot), A6JKD9 (UniProtKB/TrEMBL)
- Sequence:
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
hide sequence
RefSeq Acc Id:
XP_017457057 ⟸ XM_017601568
- Peptide Label:
isoform X1
- UniProtKB:
P04631 (UniProtKB/Swiss-Prot), A6JKD9 (UniProtKB/TrEMBL)
- Sequence:
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
hide sequence
Ensembl Acc Id:
ENSRNOP00000001743 ⟸ ENSRNOT00000001743
Ensembl Acc Id:
ENSRNOP00000085085 ⟸ ENSRNOT00000096333
RefSeq Acc Id:
XP_063135056 ⟸ XM_063278986
- Peptide Label:
isoform X1
- UniProtKB:
P04631 (UniProtKB/Swiss-Prot), A6JKD9 (UniProtKB/TrEMBL)
RGD ID: 13701520 Promoter ID: EPDNEW_R12044 Type: multiple initiation site Name: S100b_1 Description: S100 calcium binding protein B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 13,142,798 - 13,142,858 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-18
S100b
S100 calcium binding protein B
S100b
S100 protein, beta polypeptide, neural
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-18
S100b
S100 protein, beta polypeptide, neural
S100b
S100 protein, beta polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
S100b
S100 calcium-binding protein, beta (neural)
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_cellular_localization
colocalizes to membrane ruffles with GTPase activating protein IQGAP
727451
gene_expression
expressed in the brain astrocytes and mRNA was detected in the rat heart after coronary artery ligation
628549
gene_process
inhibits postinfarct myocardial hypertrophic response
628549
gene_protein
20 kDa calcium binding homodimer
628549
gene_regulation
activation of the promoter is mediated through the PKC signalling pathway
628549
