Tas2r119 (taste receptor, type 2, member 119)

Advanced Search (OLGA)

Gene: Tas2r119 (taste receptor, type 2, member 119) Rattus norvegicus

Analyze

Symbol:

Tas2r119

Name:

taste receptor, type 2, member 119

RGD ID:

620733

Description:

Predicted to enable bitter taste receptor activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception of bitter taste. Predicted to be active in membrane. Orthologous to human TAS2R1 (taste 2 receptor member 1); INTERACTS WITH 17beta-estradiol; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

T2R1; T2R119; T2R19; Tas2r1; taste receptor type 2 member 1; taste receptor type 2 member 119; taste receptor type 2 member 19; taste receptor, type 2, member 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TAS2R1 (taste 2 receptor member 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Tas2r119 (taste receptor, type 2, member 119)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TAS2R1 (taste 2 receptor member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TAS2R1 (taste 2 receptor member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tas2r1 (taste 2 receptor member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TAS2R1 (taste 2 receptor member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TAS2R1 (taste 2 receptor member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TAS2R5 (taste 2 receptor member 5)	HGNC	Panther
Alliance orthologs ³
Homo sapiens (human):	TAS2R1 (taste 2 receptor member 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tas2r119 (taste receptor, type 2, member 119)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	84,948,489 - 84,949,496 (+)	NCBI		GRCr8
mRatBN7.2	2	83,237,595 - 83,238,602 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	83,237,595 - 83,238,602 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	90,282,796 - 90,283,803 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	88,404,394 - 88,405,401 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	83,460,672 - 83,461,679 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	85,305,225 - 85,306,232 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	85,305,225 - 85,306,232 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	104,977,928 - 104,978,935 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	84,651,696 - 84,652,703 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	84,596,657 - 84,597,665 (+)	NCBI
Celera	2	78,729,391 - 78,730,398 (+)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

CGP 52608 (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

dioxygen (EXP)

epoxiconazole (ISO)

lead diacetate (ISO)

methamphetamine (EXP)

PCB138 (ISO)

resveratrol (ISO)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of bitter taste (IBA,IEA,ISO)

G protein-coupled receptor signaling pathway (IEA)

Cellular Component

membrane (IBA,IEA)

Molecular Function

bitter taste receptor activity (IBA,IEA,ISO)

G protein-coupled receptor activity (IEA)

taste receptor activity (TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	A novel family of mammalian taste receptors.	Adler E, etal., Cell 2000 Mar 17;100(6):693-702.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10761935	PMID:11696554	PMID:11854532	PMID:12139982	PMID:12581520	PMID:20022913	PMID:22836012

Genomics

Comparative Map Data

Tas2r119
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	84,948,489 - 84,949,496 (+)	NCBI		GRCr8
mRatBN7.2	2	83,237,595 - 83,238,602 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	83,237,595 - 83,238,602 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	90,282,796 - 90,283,803 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	88,404,394 - 88,405,401 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	83,460,672 - 83,461,679 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	85,305,225 - 85,306,232 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	85,305,225 - 85,306,232 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	104,977,928 - 104,978,935 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	84,651,696 - 84,652,703 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	84,596,657 - 84,597,665 (+)	NCBI
Celera	2	78,729,391 - 78,730,398 (+)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

TAS2R1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	9,627,347 - 9,903,876 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	9,627,347 - 9,712,378 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	9,627,459 - 9,903,988 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	9,682,109 - 9,683,463 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	9,682,244 - 9,683,144	NCBI
Celera	5	9,669,459 - 9,670,813 (-)	NCBI		Celera
Cytogenetic Map	5	p15.31-p15.2	NCBI
HuRef	5	9,612,803 - 9,614,157 (-)	NCBI		HuRef
CHM1_1	5	9,629,068 - 9,630,422 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	9,567,134 - 9,843,682 (-)	NCBI		T2T-CHM13v2.0

Tas2r119
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	32,177,435 - 32,178,440 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	32,177,435 - 32,178,440 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	32,177,289 - 32,178,294 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	32,177,289 - 32,178,294 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	32,107,044 - 32,108,049 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	32,121,876 - 32,122,883 (+)	NCBI		MGSCv36	mm8
Celera	15	32,887,815 - 32,888,820 (+)	NCBI		Celera
Cytogenetic Map	15	B3.1	NCBI
cM Map	15	13.02	NCBI

TAS2R1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	9,862,403 - 10,138,887 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	8,016,011 - 8,292,479 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	9,933,595 - 9,936,622 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	9,755,400 - 9,756,741 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	9,755,530 - 9,756,429 (-)	Ensembl	panpan1.1		panPan2

TAS2R1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	4,537,632 - 4,538,525 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	4,537,632 - 4,538,525 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	9,048,387 - 9,049,280 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	4,447,778 - 4,448,671 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	4,447,778 - 4,448,671 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	4,499,015 - 4,499,908 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	4,479,611 - 4,480,504 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	4,701,177 - 4,702,070 (+)	NCBI		UU_Cfam_GSD_1.0

Tas2r1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	237,524,734 - 237,527,779 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936643	1,877,112 - 1,878,002 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TAS2R1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	72,720,854 - 72,721,753 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	72,720,057 - 72,724,116 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

TAS2R1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	9,174,015 - 9,175,629 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	9,174,289 - 9,175,185 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666064	19,389,773 - 19,391,471 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Tas2r119
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	27
Count of miRNA genes:	24
Interacting mature miRNAs:	27
Transcripts:	ENSRNOT00000015904
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	59846005	104846005	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	81018907	126018907	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	82345893	130923501	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
2293676	Bmd19	Bone mineral density QTL 19	10.7	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	43162366	111362592	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
2293682	Bmd24	Bone mineral density QTL 24	8.9	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	43162366	111362592	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	38573329	122609194	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	76539322	150540526	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	76539322	102785628	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	40067944	102785628	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
631208	Bw1	Body weight QTL1	5.09		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	2	43171017	83575226	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	59324377	103795077	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
7411551	Bw131	Body weight QTL 131	29.6	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	67942638	112942638	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	74786664	94359546	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	78665616	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
61371	Edpm1	Estrogen-dependent pituitary mass QTL 1	4	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	35134841	88029593	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	59324719	102755241	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	80270434	125270434	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	59324377	103795077	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	64366971	109366971	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

ectoderm	endocrine system	mesenchyme	mesoderm
1	1	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_023993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF227140	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473992	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015904 ⟹ ENSRNOP00000015904

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	83,237,595 - 83,238,602 (+)	Ensembl
Rnor_6.0 Ensembl	2	85,305,225 - 85,306,232 (+)	Ensembl

RefSeq Acc Id:

NM_023993 ⟹ NP_076483

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	84,948,489 - 84,949,496 (+)	NCBI
mRatBN7.2	2	83,237,595 - 83,238,602 (+)	NCBI
Rnor_6.0	2	85,305,225 - 85,306,232 (+)	NCBI
Rnor_5.0	2	104,977,928 - 104,978,935 (+)	NCBI
RGSC_v3.4	2	84,651,696 - 84,652,703 (+)	RGD
Celera	2	78,729,391 - 78,730,398 (+)	RGD

Sequence:

show sequence

ATGATGGAAGGGCATATACTCTTCTTCTTTTTGGTTGTGATGGTGCAGTTTGTCACTGGGGTCT
TGGCAAATGGCCTCATTGTGGTTGTCCATGCTATTGACTTGATCATGTGGAAGAAAATGGCCCC
GTTGGATCTGCTTCTATTTTGCCTGGCGACTTCTCGGATCATTCTGCAGTTATGTATATTGTTT
GCACAATTGTGTCTATTCTCTTTGGTGAGACACACTTTATTTGAGGACAATATTACCTTTGTCT
TCATCATAAATGAACTGAGTCTTTGGTTTGCTACATGGCTCGGTGTTTTCTACTGTGCCAAGAT
TGCTACCATTCCTCACCCACTCTTTCTGTGGCTGAAGATGAGGATATCCAGGTTGGTACCATGG
CTGATCCTGGGATCTGTGCTCTATGTAATTATTACTACTTTCATCCATAGCAGAGAGACTTCAG
CAATCCTTAAACCAATTTTTATAAGCCTTTTTCCTAAAAATGCAACTCAAGTCGGAACAGGGCA
TGCCACACTACTCTCAGTCCTGGTCCTTGGGCTCACACTGCCGTTGTTCATCTTTACTGTTGCT
GTTCTGCTCTTGATATACTCCCTGTGGAATTATAGCAGGCAGATGAGGACTATGGTAGGCACCA
GGGAGTATAGCGGACATGCTCACATCAGTGCAATGCTGTCCATTCTATCATTCCTCATCCTCTA
TCTCTCCCACTACATGGTGGCTGTTCTGATCTCTACTCAAGTCCTCTACCTTGGAAGCAGAACC
TTTGTATTCTGCTTACTGGTTATTGGTATGTACCCCTCAATACACTCGATTGTCTTAATTTTAG
GAAATCCTAAGCTGAAACGAAATGCAAAAATGTTCATTGTCCATTGTAAGTGTTGTCATTGTAC
AAGAGCTTGGGTCACCTCAAGGAGCCCAAGACTCAGTGACTTGCCAGTGCCTCCTACTCATCCC
TCAGCCAACAAGACATCCTGCTCAGAAGCCTGTATAATGCCATCCTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_076483	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF43913	(Get FASTA)	NCBI Sequence Viewer
	EDL82655	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015904.1
	ENSRNOP00055037496
	ENSRNOP00060035017
	ENSRNOP00065016999
GenBank Protein	Q9JKU1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_076483 ⟸ NM_023993

- UniProtKB:

Q9JKU1 (UniProtKB/Swiss-Prot), A6JN06 (UniProtKB/TrEMBL), F1LMS0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MMEGHILFFFLVVMVQFVTGVLANGLIVVVHAIDLIMWKKMAPLDLLLFCLATSRIILQLCILF
AQLCLFSLVRHTLFEDNITFVFIINELSLWFATWLGVFYCAKIATIPHPLFLWLKMRISRLVPW
LILGSVLYVIITTFIHSRETSAILKPIFISLFPKNATQVGTGHATLLSVLVLGLTLPLFIFTVA
VLLLIYSLWNYSRQMRTMVGTREYSGHAHISAMLSILSFLILYLSHYMVAVLISTQVLYLGSRT
FVFCLLVIGMYPSIHSIVLILGNPKLKRNAKMFIVHCKCCHCTRAWVTSRSPRLSDLPVPPTHP
SANKTSCSEACIMPS

hide sequence

Ensembl Acc Id:

ENSRNOP00000015904 ⟸ ENSRNOT00000015904

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JKU1-F1-model_v2	AlphaFold	Q9JKU1	1-335	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620733	AgrOrtholog
BioCyc Gene	G2FUF-53853	BioCyc
Ensembl Genes	ENSRNOG00000011963	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00055026520	UniProtKB/Swiss-Prot
	ENSRNOG00060024394	UniProtKB/Swiss-Prot
	ENSRNOG00065013333	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015904.3	UniProtKB/TrEMBL
	ENSRNOT00055045748	UniProtKB/Swiss-Prot
	ENSRNOT00060042230	UniProtKB/Swiss-Prot
	ENSRNOT00065021926	UniProtKB/Swiss-Prot
InterPro	T2R	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:78979	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	78979	ENTREZGENE
PANTHER	TASTE RECEPTOR TYPE 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TASTE RECEPTOR TYPE 2 MEMBER 1-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	TAS2R	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tas2r119	PhenoGen
RatGTEx	ENSRNOG00000011963	RatGTEx
	ENSRNOG00055026520	RatGTEx
	ENSRNOG00060024394	RatGTEx
	ENSRNOG00065013333	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6JN06	ENTREZGENE, UniProtKB/TrEMBL
	F1LMS0	ENTREZGENE, UniProtKB/TrEMBL
	Q9JKU1	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-25	Tas2r119	taste receptor, type 2, member 119	Tas2r1	taste receptor, type 2, member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Tas2r1	taste receptor, type 2, member 1	T2R1	taste receptor	Symbol and Name updated	1299863	APPROVED
2002-08-07	T2R1	taste receptor			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message