Advanced Search (OLGA)

Gene: Plscr5 (phospholipid scramblase family, member 5) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Plscr5

Name:

phospholipid scramblase family, member 5

RGD ID:

1564500

Description:

Predicted to enable phospholipid scramblase activity. Predicted to be involved in plasma membrane phospholipid scrambling. Predicted to be active in plasma membrane. Orthologous to human PLSCR5 (phospholipid scramblase family member 5); INTERACTS WITH 6-propyl-2-thiouracil; bisphenol A; Cuprizon.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC501036; phospholipid scramblase family member 5; RGD1564500; similar to phospholipid scramblase 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PLSCR5 (phospholipid scramblase family member 5)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Plscr5 (phospholipid scramblase family, member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Plscr5 (phospholipid scramblase family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PLSCR5 (phospholipid scramblase family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PLSCR5 (phospholipid scramblase family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Plscr5 (phospholipid scramblase family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PLSCR5 (phospholipid scramblase family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PLSCR5 (phospholipid scramblase family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Plscr5 (phospholipid scramblase family member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PLSCR5 (phospholipid scramblase family member 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Plscr5 (phospholipid scramblase family, member 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-71m22.1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	si:ch211-71m22.5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	si:ch73-206p6.1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	AIM25	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	scramb2	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	scrm-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	scrm-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	scrm-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	scrm-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	101,597,207 - 101,618,571 (+)	NCBI		GRCr8
mRatBN7.2	8	92,717,479 - 92,738,843 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	92,722,600 - 92,738,299 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	98,400,883 - 98,416,577 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	96,600,134 - 96,615,828 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	94,432,845 - 94,448,560 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	99,558,279 - 99,579,791 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	99,568,958 - 99,579,255 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	99,042,074 - 99,063,372 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	97,143,459 - 97,159,158 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	92,241,712 - 92,257,400 (+)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plscr5	Rat	(+)-catechin	multiple interactions	ISO	PLSCR5 (Homo sapiens)	6480464	[Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of PLSCR5 mRNA	CTD	PMID:24763279
Plscr5	Rat	1,2-dichloroethane	decreases expression	ISO	Plscr5 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of PLSCR5 mRNA	CTD	PMID:28960355
Plscr5	Rat	6-propyl-2-thiouracil	affects expression	EXP		6480464	Propylthiouracil affects the expression of PLSCR5 mRNA	CTD	PMID:24780913
Plscr5	Rat	aflatoxin B1	decreases methylation	ISO	PLSCR5 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of PLSCR5 gene	CTD	PMID:27153756
Plscr5	Rat	benzo[a]pyrene	decreases methylation	ISO	PLSCR5 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of PLSCR5 5' UTR	CTD	PMID:27901495
Plscr5	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PLSCR5 mRNA	CTD	PMID:25181051 more ...
Plscr5	Rat	CGP 52608	multiple interactions	ISO	PLSCR5 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to PLSCR5 gene]	CTD	PMID:28238834
Plscr5	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of PLSCR5 mRNA	CTD	PMID:27523638
Plscr5	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of PLSCR5 mRNA	CTD	PMID:26577399
Plscr5	Rat	titanium dioxide	increases expression	ISO	Plscr5 (Mus musculus)	6480464	titanium dioxide results in increased expression of PLSCR5 mRNA	CTD	PMID:35295148
Plscr5	Rat	triclosan	decreases expression	ISO	PLSCR5 (Homo sapiens)	6480464	Triclosan results in decreased expression of PLSCR5 mRNA	CTD	PMID:30510588

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plscr5	Rat	plasma membrane phospholipid scrambling	involved_in	IBA	MGI:893575 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Plscr5	Rat	plasma membrane phospholipid scrambling	involved_in	IEA	InterPro:IPR005552	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plscr5	Rat	plasma membrane	is_active_in	IBA	MGI:893575 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Plscr5	Rat	phospholipid scramblase activity	enables	IEA	InterPro:IPR005552	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Plscr5	Rat	phospholipid scramblase activity	enables	IBA	PANTHER:PTN000582979 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Plscr5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	101,597,207 - 101,618,571 (+)	NCBI		GRCr8
mRatBN7.2	8	92,717,479 - 92,738,843 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	92,722,600 - 92,738,299 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	98,400,883 - 98,416,577 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	96,600,134 - 96,615,828 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	94,432,845 - 94,448,560 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	99,558,279 - 99,579,791 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	99,568,958 - 99,579,255 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	99,042,074 - 99,063,372 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	97,143,459 - 97,159,158 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	92,241,712 - 92,257,400 (+)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

PLSCR5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	146,576,555 - 146,605,346 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	146,576,555 - 146,605,346 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	146,294,342 - 146,323,133 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	147,786,315 - 147,806,693 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	144,720,660 - 144,741,039 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI
HuRef	3	143,680,464 - 143,700,842 (-)	NCBI		HuRef
CHM1_1	3	146,266,683 - 146,287,061 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	149,331,731 - 149,360,509 (-)	NCBI		T2T-CHM13v2.0

Plscr5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	92,068,569 - 92,094,589 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	92,074,989 - 92,091,825 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	92,186,516 - 92,212,536 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	92,192,936 - 92,209,772 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	92,087,774 - 92,104,536 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	92,087,774 - 92,104,536 (+)	NCBI		MGSCv36	mm8
Celera	9	91,780,517 - 91,797,373 (+)	NCBI		Celera
Cytogenetic Map	9	E3.3	NCBI
cM Map	9	48.33	NCBI

Plscr5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955474	10,855,888 - 10,904,450 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955474	10,855,958 - 10,903,801 (+)	NCBI	ChiLan1.0	ChiLan1.0

PLSCR5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	144,461,879 - 144,490,694 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	144,466,610 - 144,495,425 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	143,593,413 - 143,628,126 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	151,176,200 - 151,210,799 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	151,176,253 - 151,212,156 (-)	Ensembl	panpan1.1		panPan2

PLSCR5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	41,709,662 - 41,739,638 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	41,681,017 - 41,733,150 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	41,574,886 - 41,604,840 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	42,327,939 - 42,357,931 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	42,331,540 - 42,357,955 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	41,915,765 - 41,945,917 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	41,990,888 - 42,021,009 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	42,234,122 - 42,264,264 (-)	NCBI		UU_Cfam_GSD_1.0

Plscr5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	81,019,261 - 81,046,315 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936519	8,694,575 - 8,712,077 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936519	8,688,210 - 8,712,104 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PLSCR5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	86,928,254 - 86,949,019 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	86,920,326 - 86,954,257 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	94,560,866 - 94,587,178 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PLSCR5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	44,096,245 - 44,134,975 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	44,106,757 - 44,121,238 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	16,985,249 - 17,012,992 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Plscr5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	23,549,667 - 23,565,050 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	23,551,467 - 23,565,050 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Plscr5
138 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	11
Count of miRNA genes:	8
Interacting mature miRNAs:	11
Transcripts:	ENSRNOT00000073400
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
8693654	Alc32	Alcohol consumption QTL 32	2	0.755	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	8	88612425	107550209	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	89265192	114019816	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	82460758	122812818	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
4	3	85	12	15	5	13	5	29	17	84	3	19	10


RefSeq Transcripts	NM_001191999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595843	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595844	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073400 ⟹ ENSRNOP00000066419

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	92,722,600 - 92,738,299 (+)	Ensembl
Rnor_6.0 Ensembl	8	99,568,958 - 99,579,255 (+)	Ensembl

RefSeq Acc Id:

NM_001191999 ⟹ NP_001178928

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	101,597,207 - 101,618,571 (+)	NCBI
mRatBN7.2	8	92,717,479 - 92,738,843 (+)	NCBI
Rnor_6.0	8	99,563,556 - 99,579,255 (+)	NCBI
Rnor_5.0	8	99,042,074 - 99,063,372 (+)	NCBI
Celera	8	92,241,712 - 92,257,400 (+)	NCBI

Sequence:

show sequence

ATGGCTTCTAAAGATTCCCAGAACCAAAAGCCTAGAAGTCTGCCTGGTTTTCTTCCTCGAGCTACAAACCCAGATCAAAACTCTCAAGAGGCTTCTTCCAATCCCGGGAAACAAACAAGGCAGCAGCC
CCATGTCTCTCAGCCAAGCAGTTTCCTGCCAACAGCCATTCTCCCTCCTGGTCTAGAGTATCTAAGCCAGCTGGACCTGATAATCATCCATCAGCAGGTAGAACTTCTTGGGATGATACTCGGCACTG
AGACCTCCAACAAATATGAGATCAAAAACAGCTCGGGACAAAGAATTTACTTTGCAGTGGAAGAAAGCATCTGTTTTAATCGTAATGTGTGCTCCACGCTGCGAGCCTGCACCCTGAGGATCACAGAC
AACTCGGGTCGAGAGGTGATTACAGTGAACAGGCCCCTAAGGTGTAACAGCTGCTGGTGCCCTTGCTACCTACAAGAGCTAGAAATCCAAGCCCCCCCTGGGACTATAGTTGGTTTTGTTGCACAGAA
GTGGGACCCCTTTCAGCCCAAATTCACAATCCAAAATGCAAACAAAGAAGATATTTTGAAAATCGTTGGTCCTTGTACAACCTGTGGCTGCTTTGGCGATGTGGACTTTGAGGTGAAAACTGTTGATG
AAAAGGTTACAATTGGGAAGATCTCCAAGTACTGGTCGGGATTTGTCAACGACGTGTTCACAAATGCTGACAACTTTGGGATCCATGTTCCTGAAGATCTCGATGTGACACTCAAAGCAGCCATGATT
GGTGCTTGCTTTCTCTTTGATTTTATGTTCTTTGAACATTCGCTTGCTGGATTATAA

hide sequence


Protein RefSeqs	NP_001178928	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL77540	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000066419
	ENSRNOP00000066419.3

RefSeq Acc Id:

NP_001178928 ⟸ NM_001191999

- UniProtKB:

M0RA77 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASKDSQNQKPRSLPGFLPRATNPDQNSQEASSNPGKQTRQQPHVSQPSSFLPTAILPPGLEYLSQLDLIIIHQQVELLGMILGTETSNKYEIKNSSGQRIYFAVEESICFNRNVCSTLRACTLRITD
NSGREVITVNRPLRCNSCWCPCYLQELEIQAPPGTIVGFVAQKWDPFQPKFTIQNANKEDILKIVGPCTTCGCFGDVDFEVKTVDEKVTIGKISKYWSGFVNDVFTNADNFGIHVPEDLDVTLKAAMI
GACFLFDFMFFEHSLAGL

hide sequence

Ensembl Acc Id:

ENSRNOP00000066419 ⟸ ENSRNOT00000073400

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0RA77-F1-model_v2	AlphaFold	M0RA77	1-275	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-29559	BioCyc
Ensembl Genes	ENSRNOG00000047917	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000073400	ENTREZGENE
	ENSRNOT00000073400.3	UniProtKB/TrEMBL
InterPro	Scramblase	UniProtKB/TrEMBL
	Tubby_C-like	UniProtKB/TrEMBL
KEGG Report	rno:501036	UniProtKB/TrEMBL
NCBI Gene	501036	ENTREZGENE
PANTHER	PHOSPHOLIPID SCRAMBLASE FAMILY MEMBER 5	UniProtKB/TrEMBL
	PTHR23248	UniProtKB/TrEMBL
Pfam	Scramblase	UniProtKB/TrEMBL
PhenoGen	Plscr5	PhenoGen
RatGTEx	ENSRNOG00000047917	RatGTEx
Superfamily-SCOP	Tubby_C	UniProtKB/TrEMBL
UniProt	M0RA77	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2010-05-05	Plscr5	phospholipid scramblase family, member 5	RGD1564500	similar to phospholipid scramblase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1564500	similar to phospholipid scramblase 1	RGD1564500_predicted	similar to phospholipid scramblase 1 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1564500_predicted	similar to phospholipid scramblase 1 (predicted)	LOC501036	similar to phospholipid scramblase 1	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC501036	similar to phospholipid scramblase 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message