Advanced Search (OLGA)

Gene: Uchl3 (ubiquitin C-terminal hydrolase L3) Rattus norvegicus

Analyze

Symbol:

Uchl3 (Ensembl: Uchl3-ps1)

Name:

ubiquitin C-terminal hydrolase L3 (Ensembl:ubiquitin C-terminal hydrolase L3, pseudogene 1)

RGD ID:

1561196

Description:

Predicted to enable cysteine-type deubiquitinase activity and ubiquitin binding activity. Predicted to be involved in several processes, including cellular response to insulin stimulus; positive regulation of fat cell differentiation; and protein deubiquitination. Predicted to act upstream of or within adult walking behavior; eating behavior; and retina development in camera-type eye. Predicted to be located in cytosol and nucleoplasm. Predicted to be active in cytoplasm. Orthologous to human UCHL3 (ubiquitin C-terminal hydrolase L3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC498560; RGD1561196; similar to ubiqutin carboxyl-terminal hydrolase l3; ubiquitin carboxyl-terminal esterase L3; ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase); ubiquitin carboxyl-terminal hydrolase isozyme L3; ubiquitin thioesterase L3; UCH-L3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UCHL3 (ubiquitin C-terminal hydrolase L3)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Uchl3 (ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Uchl3 (ubiquitin C-terminal hydrolase L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UCHL3 (ubiquitin C-terminal hydrolase L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UCHL3 (ubiquitin C-terminal hydrolase L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Uchl3 (ubiquitin C-terminal hydrolase L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UCHL3 (ubiquitin C-terminal hydrolase L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UCHL3 (ubiquitin C-terminal hydrolase L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Uchl3 (ubiquitin C-terminal hydrolase L3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	UCHL3 (ubiquitin C-terminal hydrolase L3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Uchl3 (ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Uchl4 (ubiquitin carboxyl-terminal esterase L4)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	uchl3 (ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Uch	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YUH1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ubh-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ubh-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ubh-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	uchl3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Uchl3-ps1

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	84,888,847 - 84,942,095 (+)	NCBI		GRCr8
mRatBN7.2	15	78,485,304 - 78,527,355 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	161,856,958 - 161,857,835 (-)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	15	78,485,315 - 78,527,355 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	82,496,066 - 82,538,090 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	83,572,627 - 83,614,651 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	80,493,216 - 80,535,240 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	86,153,624 - 86,198,127 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	86,153,628 - 86,198,127 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	89,919,728 - 89,964,227 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	85,628,490 - 85,670,420 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	15	77,676,770 - 77,718,591 (+)	NCBI		Celera
Cytogenetic Map	15	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 13q14 deletion syndrome (ISO)

Deglutition Disorders (ISO)

Neoplasm Metastasis (ISO)

Nerve Degeneration (ISO)

neuroaxonal dystrophy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1H-pyrazole (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzatropine (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP)

cadmium dichloride (ISO)

cannabidiol (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP)

cobalt dichloride (ISO)

cocaine (EXP)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

Cuprizon (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

DDT (EXP)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

diuron (EXP)

dorsomorphin (ISO)

endosulfan (EXP)

ethanol (ISO)

fenthion (ISO)

folic acid (ISO)

fulvestrant (ISO)

gentamycin (EXP)

glucose (ISO)

graphite (EXP)

inulin (ISO)

ivermectin (ISO)

lead(0) (ISO)

lead(II) chloride (ISO)

Mesaconitine (EXP)

methapyrilene (EXP)

methidathion (ISO)

methylmercury chloride (ISO)

microcystin-LR (EXP)

N-nitrosodiethylamine (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

phlorizin (ISO)

pirinixic acid (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

sarin (ISO)

SB 431542 (ISO)

senecionine (ISO)

Senkirkine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

thalidomide (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

undecane (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult walking behavior (ISO)

cellular response to insulin stimulus (ISO)

eating behavior (ISO)

positive regulation of fat cell differentiation (ISO)

protein catabolic process (ISO)

protein deubiquitination (IBA,ISO)

retina development in camera-type eye (ISO)

ubiquitin-dependent protein catabolic process (IEA)

Cellular Component

cytoplasm (IBA,IEA)

cytosol (ISO)

nucleoplasm (ISO)

Molecular Function

cysteine-type deubiquitinase activity (IBA,IEA,ISO)

deubiquitinase activity (ISO)

peptidase activity (ISO)

protein binding (ISO)

ubiquitin binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Loss of Uch-L1 and Uch-L3 leads to neurodegeneration, posterior paralysis and dysphagia.	Kurihara LJ, etal., Hum Mol Genet 2001 Sep 1;10(18):1963-70.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9521656	PMID:15632090	PMID:19154770	PMID:19837878	PMID:21052544	PMID:21762696	PMID:23376485	PMID:26609154

Genomics

Comparative Map Data

Uchl3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	84,888,847 - 84,942,095 (+)	NCBI		GRCr8
mRatBN7.2	15	78,485,304 - 78,527,355 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	161,856,958 - 161,857,835 (-)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	15	78,485,315 - 78,527,355 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	82,496,066 - 82,538,090 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	83,572,627 - 83,614,651 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	80,493,216 - 80,535,240 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	86,153,624 - 86,198,127 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	86,153,628 - 86,198,127 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	89,919,728 - 89,964,227 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	85,628,490 - 85,670,420 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	15	77,676,770 - 77,718,591 (+)	NCBI		Celera
Cytogenetic Map	15	q21	NCBI

UCHL3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	75,549,502 - 75,606,020 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	75,549,483 - 75,606,020 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	76,123,638 - 76,180,156 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	75,021,928 - 75,078,070 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	13	75,021,927 - 75,078,067	NCBI
Celera	13	57,021,803 - 57,077,943 (+)	NCBI		Celera
Cytogenetic Map	13	q22.2	NCBI
HuRef	13	56,821,075 - 56,877,308 (+)	NCBI		HuRef
CHM1_1	13	76,091,356 - 76,147,870 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	13	74,773,163 - 74,829,671 (+)	NCBI		T2T-CHM13v2.0

Uchl3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	101,891,387 - 101,933,561 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	101,891,403 - 101,933,561 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	101,653,892 - 101,696,125 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	101,653,967 - 101,696,125 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	102,053,184 - 102,095,342 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	100,540,246 - 100,582,053 (+)	NCBI		MGSCv36	mm8
Celera	14	100,293,249 - 100,335,409 (+)	NCBI		Celera
Cytogenetic Map	14	E2.3	NCBI
cM Map	14	50.9	NCBI

Uchl3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955404	31,414,208 - 31,464,968 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955404	31,414,076 - 31,465,205 (-)	NCBI	ChiLan1.0	ChiLan1.0

UCHL3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	77,127,881 - 77,183,967 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	75,725,673 - 75,781,714 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	56,776,436 - 56,832,539 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	75,549,305 - 75,878,805 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	75,549,647 - 75,878,673 (+)	Ensembl	panpan1.1		panPan2

UCHL3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	29,348,962 - 29,397,944 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	22	29,348,706 - 29,407,965 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	22	29,151,524 - 29,258,782 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	22	29,625,506 - 29,732,716 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	22	29,684,385 - 29,736,169 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	22	29,276,538 - 29,383,650 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	22	29,320,217 - 29,427,245 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	22	29,388,463 - 29,495,905 (+)	NCBI		UU_Cfam_GSD_1.0

Uchl3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	130,107,193 - 130,163,980 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936511	5,522,965 - 5,581,334 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936511	5,524,425 - 5,581,156 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UCHL3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	47,828,421 - 47,887,629 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	47,829,037 - 47,885,800 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	52,436,220 - 52,477,054 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UCHL3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1 Ensembl	3	54,647,590 - 54,706,497 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666046	10,791,194 - 10,849,805 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Uchl3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624751	24,882,705 - 24,940,105 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624751	24,882,580 - 24,940,301 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Uchl3
125 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	8
Count of miRNA genes:	8
Interacting mature miRNAs:	8
Transcripts:	ENSRNOT00000028960
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549844	Bss7	Bone structure and strength QTL 7	6.4		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	15	75788062	101769107	Rat
2300326	Plaw1	Placental weight QTL 1	15	0.005	placenta mass (VT:0004257)	placenta wet weight (CMO:0002088)	15	68327165	100062518	Rat
70155	Gcs1	Gastric cancer susceptibility QTL1	3.8		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	15	76306099	101769107	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	28030665	82262678	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
631516	Gluco31	Glucose level QTL 31	7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	55596089	95018120	Rat
1331724	Bp223	Blood pressure QTL 223	3.53715		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	73690518	95018228	Rat
2317055	Aia10	Adjuvant induced arthritis QTL 10	3.41		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	15	75788062	101769107	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	28030665	82262678	Rat
731177	Uae26	Urinary albumin excretion QTL 26	2.4	0.025	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	15	67588667	101769107	Rat
1300144	Rf23	Renal function QTL 23	3.61		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	15	40631268	98288169	Rat
1576315	Schws6	Schwannoma susceptibility QTL 6		0.0069	nervous system integrity trait (VT:0010566)	post-insult time of death (CMO:0002005)	15	53806152	98806152	Rat
61477	Aia4	Adjuvant induced arthritis QTL 4	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	15	55596089	91365858	Rat
70182	BpQTLcluster12	Blood pressure QTL cluster 12	3.53		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	15	73690657	95018120	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	27885774	86257085	Rat
1581555	Eae19	Experimental allergic encephalomyelitis QTL 19	4.7		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	15	76306099	90088744	Rat
631655	Bp126	Blood pressure QTL 126	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	58156477	101769107	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
1598828	Glom14	Glomerulus QTL 14	2.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	15	34054139	79054139	Rat
1641889	Colcr6	Colorectal carcinoma resistance QTL 6	2.9	0.0126	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	15	73690518	99794247	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	28030665	82262678	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat

Markers in Region

Uchl4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RGSC_v3.4	3	163,941,308 - 163,942,074	UniSTS	RGSC3.4
Celera	3	161,050,303 - 161,051,069	UniSTS
Cytogenetic Map	3	q42	UniSTS
Cytogenetic Map	15	q21	UniSTS

BM390056

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	78,494,992 - 78,495,193 (-)	MAPPER	mRatBN7.2
mRatBN7.2	15	78,494,992 - 78,495,193 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	86,163,284 - 86,163,484	NCBI	Rnor6.0
Rnor_6.0	3	171,124,878 - 171,125,078	NCBI	Rnor6.0
Rnor_5.0	3	177,191,047 - 177,191,247	UniSTS	Rnor5.0
Rnor_5.0	15	89,929,384 - 89,929,584	UniSTS	Rnor5.0
RGSC_v3.4	15	85,638,146 - 85,638,346	UniSTS	RGSC3.4
Celera	15	77,686,426 - 77,686,626	UniSTS
RH 3.4 Map	15	503.1	UniSTS
Cytogenetic Map	15	q21	UniSTS
Cytogenetic Map	3	q42	UniSTS

PMC85452P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RGSC_v3.4	3	163,941,362 - 163,942,072	UniSTS	RGSC3.4
Celera	3	161,050,357 - 161,051,067	UniSTS
Cytogenetic Map	3	q42	UniSTS
Cytogenetic Map	15	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
18	15	64	198	141	139	84	46	84	12	330	149	164	69	110	55

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001110165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001428945	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001428946	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001428947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039093599	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274571	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274572	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274573	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274574	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274577	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274578	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274579	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274580	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274581	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274582	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274583	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB043959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012842 ⟹ ENSRNOP00000012842

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	78,485,315 - 78,527,349 (+)	Ensembl
Rnor_6.0 Ensembl	15	86,153,628 - 86,198,127 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000028960 ⟹ ENSRNOP00000029819

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	78,496,608 - 78,527,355 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104271 ⟹ ENSRNOP00000091247

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	78,485,336 - 78,527,355 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112431 ⟹ ENSRNOP00000092785

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	78,485,336 - 78,527,355 (+)	Ensembl

RefSeq Acc Id:

NM_001110165 ⟹ NP_001103635

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,900,078 - 84,942,095 (+)	NCBI
mRatBN7.2	15	78,485,336 - 78,527,355 (+)	NCBI
Rnor_6.0	15	86,153,628 - 86,198,127 (+)	NCBI
Rnor_5.0	15	89,919,728 - 89,964,227 (+)	NCBI
RGSC_v3.4	15	85,628,490 - 85,670,420 (+)	RGD
Celera	15	77,676,770 - 77,718,591 (+)	RGD

Sequence:

show sequence

AAGCAGCGGCGGTGGTGGTGGTGGTGGTGGTGGCGGCGGCGGCTGCTGTCAGAGCTGGAGCGCG
GCCGGCTGAGCAGTCATGGAGGGTCAGCGCTGGCTGCCGCTGGAGGCCAACCCTGAGGTCACCA
ACCAGTTTCTCAAGCAACTAGGCCTGCATCCTAACTGGCAGTTTGTGGACGTGTACGGGATGGA
GCCTGAACTTCTCAGCATGGTTCCGAGACCAGTGTGCGCCGTGTTACTCCTCTTCCCTATCACA
GAGAAGTATGAAGTCTTCAGAACAGAAGAGGAAGAGAAAATAAAATCCCAAGGACAAGATGTTA
CGTCATCAGTGTATTTTATGAAACAAACCATCAGCAACGCCTGTGGAACCATTGGACTAATCCA
CGCCATCGCGAACAACAAAGACAAGATGCACTTTGAATCAGGGTCAGCATTGAAAAAGTTCCTG
GAGGAGTCTGTAGCAATGAGCCCTGAAGAAAGAGCCAGACACCTGGAGAACTATGACGCTATTC
GAGTTACTCATGAAACCAGTGCACATGAAGGTCAGACTGAGGCACCAAGTATAGATGAAAAAGT
AGATCTTCATTTTATTGCGTTAGTTCATGTAGATGGGCATCTCTATGAATTAGATGGACGGAAA
CCGTTTCCAATTAACCATGGGAAAACTAGTGATGAGACATTGTTAGAGGATGCCATAGAAGTCT
GCAAGAAGTTCATGGAGCGCGACCCTGATGAGTTAAGATTTAATGCAATTGCTCTCTCAGCAGC
ATAGCATCTTGACAGAAACACCAAATACTGTATTATTTGCAACAAAAGTTAAATTTCTGATGCC
ATAACTAACTCAAAATTTTTAATATTTTCATTAACTTGACTAATTAAACTTTATGTGAATAAAC
TTTGACTTTACCTGTATT

hide sequence

RefSeq Acc Id:

XM_039093599 ⟹ XP_038949527

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,899,862 - 84,942,093 (+)	NCBI
mRatBN7.2	15	78,485,304 - 78,527,353 (+)	NCBI

RefSeq Acc Id:

XM_063274569 ⟹ XP_063130639

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,899,862 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274570 ⟹ XP_063130640

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,900,051 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274571 ⟹ XP_063130641

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,900,098 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274572 ⟹ XP_063130642

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,900,051 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274573 ⟹ XP_063130643

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,888,847 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274574 ⟹ XP_063130644

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,900,051 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274575 ⟹ XP_063130645

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,900,102 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274576 ⟹ XP_063130646

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,900,060 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274577 ⟹ XP_063130647

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,900,045 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274578 ⟹ XP_063130648

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,899,862 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274579 ⟹ XP_063130649

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,900,045 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274580 ⟹ XP_063130650

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,900,059 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274581 ⟹ XP_063130651

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,900,051 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274582 ⟹ XP_063130652

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,900,051 - 84,942,093 (+)	NCBI

RefSeq Acc Id:

XM_063274583 ⟹ XP_063130653

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	84,900,063 - 84,942,093 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001103635	(Get FASTA)	NCBI Sequence Viewer
	NP_001415874	(Get FASTA)	NCBI Sequence Viewer
	NP_001415875	(Get FASTA)	NCBI Sequence Viewer
	NP_001415876	(Get FASTA)	NCBI Sequence Viewer
	XP_038949527	(Get FASTA)	NCBI Sequence Viewer
	XP_063130639	(Get FASTA)	NCBI Sequence Viewer
	XP_063130640	(Get FASTA)	NCBI Sequence Viewer
	XP_063130641	(Get FASTA)	NCBI Sequence Viewer
	XP_063130642	(Get FASTA)	NCBI Sequence Viewer
	XP_063130643	(Get FASTA)	NCBI Sequence Viewer
	XP_063130644	(Get FASTA)	NCBI Sequence Viewer
	XP_063130645	(Get FASTA)	NCBI Sequence Viewer
	XP_063130646	(Get FASTA)	NCBI Sequence Viewer
	XP_063130647	(Get FASTA)	NCBI Sequence Viewer
	XP_063130648	(Get FASTA)	NCBI Sequence Viewer
	XP_063130649	(Get FASTA)	NCBI Sequence Viewer
	XP_063130650	(Get FASTA)	NCBI Sequence Viewer
	XP_063130651	(Get FASTA)	NCBI Sequence Viewer
	XP_063130652	(Get FASTA)	NCBI Sequence Viewer
	XP_063130653	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAB47136	(Get FASTA)	NCBI Sequence Viewer
	EDM02439	(Get FASTA)	NCBI Sequence Viewer
	EDM02440	(Get FASTA)	NCBI Sequence Viewer
	EDM02441	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012842.5
	ENSRNOP00000029819.5
	ENSRNOP00000091247.1
	ENSRNOP00000092785.1
	ENSRNOP00000095149.1
	ENSRNOP00055009983
	ENSRNOP00060020545
	ENSRNOP00065008141
GenBank Protein	Q91Y78	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001103635 ⟸ NM_001110165

- UniProtKB:

Q91Y78 (UniProtKB/Swiss-Prot), A0A8J8Y1V7 (UniProtKB/TrEMBL), A6KKZ2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEV
FRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSALKKFLEESVA
MSPEERARHLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPIN
HGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

hide sequence

Ensembl Acc Id:

ENSRNOP00000012842 ⟸ ENSRNOT00000012842

RefSeq Acc Id:	XP_038949527 ⟸ XM_039093599
- Peptide Label:	isoform X15
- UniProtKB:	A0A8I6AE48 (UniProtKB/TrEMBL), A0A8J8Y1V7 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000092785 ⟸ ENSRNOT00000112431

Ensembl Acc Id:

ENSRNOP00000029819 ⟸ ENSRNOT00000028960

Ensembl Acc Id:

ENSRNOP00000091247 ⟸ ENSRNOT00000104271

RefSeq Acc Id:	XP_063130643 ⟸ XM_063274573
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_063130639 ⟸ XM_063274569
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063130648 ⟸ XM_063274578
- Peptide Label:	isoform X10

RefSeq Acc Id:	XP_063130647 ⟸ XM_063274577
- Peptide Label:	isoform X9

RefSeq Acc Id:	XP_063130649 ⟸ XM_063274579
- Peptide Label:	isoform X11

RefSeq Acc Id:	XP_063130642 ⟸ XM_063274572
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063130644 ⟸ XM_063274574
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_063130640 ⟸ XM_063274570
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063130652 ⟸ XM_063274582
- Peptide Label:	isoform X14

RefSeq Acc Id:	XP_063130651 ⟸ XM_063274581
- Peptide Label:	isoform X13

RefSeq Acc Id:	XP_063130650 ⟸ XM_063274580
- Peptide Label:	isoform X12

RefSeq Acc Id:	XP_063130646 ⟸ XM_063274576
- Peptide Label:	isoform X8

RefSeq Acc Id:	XP_063130653 ⟸ XM_063274583
- Peptide Label:	isoform X16

RefSeq Acc Id:	XP_063130641 ⟸ XM_063274571
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063130645 ⟸ XM_063274575
- Peptide Label:	isoform X7

Protein Domains

UCH UCH catalytic

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q91Y78-F1-model_v2	AlphaFold	Q91Y78	1-230	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699863

Promoter ID:

EPDNEW_R10386

Type:

initiation region

Name:

Uchl3_1

Description:

ubiquitin C-terminal hydrolase L3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	86,153,626 - 86,153,686	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561196	AgrOrtholog
BioCyc Gene	G2FUF-12748	BioCyc
Ensembl Genes	ENSRNOG00000009530	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000065893	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00055007508	UniProtKB/Swiss-Prot
	ENSRNOG00060014959	UniProtKB/Swiss-Prot
	ENSRNOG00065007054	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000012842.7	UniProtKB/TrEMBL
	ENSRNOT00000028960.6	UniProtKB/TrEMBL
	ENSRNOT00000104271.1	UniProtKB/TrEMBL
	ENSRNOT00000112431.1	UniProtKB/TrEMBL
	ENSRNOT00000113306.1	UniProtKB/TrEMBL
	ENSRNOT00055012563	UniProtKB/Swiss-Prot
	ENSRNOT00060025720	UniProtKB/Swiss-Prot
	ENSRNOT00065011136	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.532.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Papain-like_cys_pep_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_C12_UCH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_C12_UCH_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:498560	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	498560	ENTREZGENE
PANTHER	PTHR10589	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UBIQUITIN CARBOXYL-TERMINAL HYDROLASE ISOZYME L3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Peptidase_C12	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Uchl3	PhenoGen
PRINTS	UBCTHYDRLASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	UCH_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UCH_DOMAIN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000009530	RatGTEx
	ENSRNOG00000065893	RatGTEx
	ENSRNOG00055007508	RatGTEx
	ENSRNOG00060014959	RatGTEx
	ENSRNOG00065007054	RatGTEx
Superfamily-SCOP	SSF54001	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6AE48	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GJY6_RAT	UniProtKB/TrEMBL
	A0A8J8Y1V7	ENTREZGENE, UniProtKB/TrEMBL
	A6HU77	ENTREZGENE, UniProtKB/TrEMBL
	A6KKZ2	ENTREZGENE, UniProtKB/TrEMBL
	D4ABI6_RAT	UniProtKB/TrEMBL
	Q91Y78	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	F1LM67	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-19	Uchl3	ubiquitin C-terminal hydrolase L3	Uchl3	ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-02	Uchl3	ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)	RGD1561196	similar to ubiqutin carboxyl-terminal hydrolase l3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1561196	similar to ubiqutin carboxyl-terminal hydrolase l3	RGD1561196_predicted	similar to ubiqutin carboxyl-terminal hydrolase l3 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1561196_predicted	similar to ubiqutin carboxyl-terminal hydrolase l3 (predicted)	LOC498560	similar to ubiqutin carboxyl-terminal hydrolase l3	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC498560	similar to ubiqutin carboxyl-terminal hydrolase l3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD