Nubp1 (NUBP iron-sulfur cluster assembly factor 1)

Gene: Nubp1 (NUBP iron-sulfur cluster assembly factor 1) Rattus norvegicus

Analyze

Symbol:

Nubp1

Name:

NUBP iron-sulfur cluster assembly factor 1 (Ensembl:nucleotide binding protein 1)

RGD ID:

1310514

Description:

Predicted to enable iron-sulfur cluster binding activity. Predicted to be involved in intracellular iron ion homeostasis; iron-sulfur cluster assembly; and regulation of cell growth. Predicted to act upstream of or within centrosome localization; negative regulation of centrosome duplication; and protein localization to cell cortex. Predicted to be located in plasma membrane. Predicted to be active in cytosol. Orthologous to human NUBP1 (NUBP iron-sulfur cluster assembly factor 1, cytosolic); PARTICIPATES IN cytosolic iron-sulfur cluster protein assembly pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cytosolic Fe-S cluster assembly factor NUBP1; LOC287042; MGC108970; NBP 1; nucleotide binding protein 1; nucleotide binding protein 1 (MinD homolog, E. coli); nucleotide-binding protein 1

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

NCBI Annotation Information:

Annotation category: suggests misassembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	5,766,157 - 5,777,648 (-)	NCBI		GRCr8
mRatBN7.2	10	5,259,328 - 5,270,848 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	10	9,955,670 - 9,967,161 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	9,476,783 - 9,488,274 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	5,115,152 - 5,126,642 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	5,333,378 - 5,343,949 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	5,333,378 - 5,344,121 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	4,155,446 - 4,166,017 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	5,206,634 - 5,217,205 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	5,206,633 - 5,217,205 (-)	NCBI
Celera	10	4,276,872 - 4,287,443 (-)	NCBI		Celera
Cytogenetic Map	10	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth disease type 1C (ISO)

genetic disease (ISO)

Landau-Kleffner syndrome (ISO)

MHC class II deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chromium(6+) (ISO)

copper atom (ISO)

copper(0) (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

disulfiram (ISO)

FR900359 (ISO)

gentamycin (EXP)

ivermectin (ISO)

lead(0) (ISO)

methimazole (EXP)

nickel atom (ISO)

ozone (ISO)

paracetamol (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

propiconazole (EXP)

pyrogallol (ISO)

resveratrol (ISO)

SB 431542 (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

tetrachloromethane (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell projection organization (IEA)

centrosome localization (ISO)

intracellular iron ion homeostasis (ISO)

iron-sulfur cluster assembly (IBA,ISO,ISS)

negative regulation of centrosome duplication (ISO)

protein localization to cell cortex (ISO)

regulation of cell growth (ISO)

Cellular Component

centriole (IEA)

cilium (IEA)

cytosol (IBA,ISO,ISS)

nucleus (IEA)

plasma membrane (ISO)

Molecular Function

4 iron, 4 sulfur cluster binding (IEA)

ATP binding (IEA)

ATP hydrolysis activity (IEA)

ATP-dependent FeS chaperone activity (IEA)

iron-sulfur cluster binding (IBA,ISO,ISS)

metal ion binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cytosolic iron-sulfur cluster protein assembly pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Iron-sulfur cluster biogenesis in mammalian cells: New insights into the molecular mechanisms of cluster delivery.	Maio N and Rouault TA, Biochim Biophys Acta. 2015 Jun;1853(6):1493-512. doi: 10.1016/j.bbamcr.2014.09.009. Epub 2014 Sep 19.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Biogenesis of cytosolic and nuclear iron-sulfur proteins and their role in genome stability.	Paul VD and Lill R, Biochim Biophys Acta. 2015 Jun;1853(6):1528-39. doi: 10.1016/j.bbamcr.2014.12.018. Epub 2015 Jan 10.
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:16638812	PMID:18573874	PMID:23028652	PMID:23376485

Genomics

Comparative Map Data

Nubp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	5,766,157 - 5,777,648 (-)	NCBI		GRCr8
mRatBN7.2	10	5,259,328 - 5,270,848 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	10	9,955,670 - 9,967,161 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	9,476,783 - 9,488,274 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	5,115,152 - 5,126,642 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	5,333,378 - 5,343,949 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	5,333,378 - 5,344,121 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	4,155,446 - 4,166,017 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	5,206,634 - 5,217,205 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	5,206,633 - 5,217,205 (-)	NCBI
Celera	10	4,276,872 - 4,287,443 (-)	NCBI		Celera
Cytogenetic Map	10	q11	NCBI

NUBP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	10,743,842 - 10,769,351 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	10,743,786 - 10,769,351 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	10,837,699 - 10,863,208 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	10,745,199 - 10,770,709 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	10,745,217 - 10,770,709	NCBI
Celera	16	11,007,059 - 11,032,475 (+)	NCBI		Celera
Cytogenetic Map	16	p13.13	NCBI
HuRef	16	10,756,412 - 10,781,588 (+)	NCBI		HuRef
CHM1_1	16	10,837,712 - 10,863,204 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	10,779,762 - 10,805,269 (+)	NCBI		T2T-CHM13v2.0

Nubp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	10,229,802 - 10,242,317 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	10,229,812 - 10,242,292 (+)	Ensembl		GRCm39 Ensembl
GRCm38	16	10,411,884 - 10,424,453 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	10,411,948 - 10,424,428 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	10,412,031 - 10,424,521 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	10,325,553 - 10,337,109 (+)	NCBI		MGSCv36	mm8
Celera	16	11,045,448 - 11,057,938 (+)	NCBI		Celera
Cytogenetic Map	16	A1	NCBI
cM Map	16	5.61	NCBI

Nubp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	7,717,422 - 7,732,496 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955442	7,717,422 - 7,732,496 (-)	NCBI	ChiLan1.0	ChiLan1.0

NUBP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	11,236,566 - 11,315,874 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	15,012,495 - 15,091,492 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	9,681,800 - 9,708,673 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	10,906,347 - 10,931,799 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	10,906,719 - 10,931,800 (+)	Ensembl	panpan1.1		panPan2

NUBP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	31,900,540 - 31,922,087 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	31,896,596 - 31,921,989 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	33,282,660 - 33,304,486 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	32,082,705 - 32,104,573 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	32,081,940 - 32,104,479 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	31,896,734 - 31,918,569 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	31,770,561 - 31,792,362 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	32,194,799 - 32,216,643 (-)	NCBI		UU_Cfam_GSD_1.0

Nubp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	111,126,784 - 111,140,480 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936530	8,971,380 - 8,986,033 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936530	8,970,963 - 8,985,925 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NUBP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	32,311,779 - 32,340,034 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	32,311,774 - 32,340,120 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	33,045,133 - 33,072,061 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NUBP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	10,224,965 - 10,248,328 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	10,225,173 - 10,249,047 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	19,923,874 - 19,947,229 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nubp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624824	8,024,575 - 8,040,364 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624824	8,024,459 - 8,040,353 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nubp1
141 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	53
Count of miRNA genes:	42
Interacting mature miRNAs:	52
Transcripts:	ENSRNOT00000003479
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	1	24158324	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
1549898	Neuinf3	Neuroinflammation QTL 3	26.4		nervous system integrity trait (VT:0010566)	MHC Class II RT1A-positive spinal cord ventral horn area to total spinal cord ventral horn area ratio (CMO:0001980)	10	3406320	5387112	Rat
1576304	Schws7	Schwannoma susceptibility QTL 7		0.0115	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	4765527	19816042	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	17245662	Rat
737820	Alc9	Alcohol consumption QTL 9	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	19233348	Rat

Markers in Region

RH144077

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	5,262,977 - 5,263,093 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	5,336,109 - 5,336,225	NCBI	Rnor6.0
Rnor_5.0	10	4,158,177 - 4,158,293	UniSTS	Rnor5.0
RGSC_v3.4	10	5,209,365 - 5,209,481	UniSTS	RGSC3.4
Celera	10	4,279,603 - 4,279,719	UniSTS
Cytogenetic Map	10	q11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	35	57	41	19	41	1	4	74	35	41	11	1
Low		8					7	7					7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC103514	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088221	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ136567	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ144533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214074	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218444	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220638	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222868	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228860	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229330	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000003479 ⟹ ENSRNOP00000003479

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	10	5,333,378 - 5,344,121 (-)	Ensembl

RefSeq Acc Id:

NM_001009619 ⟹ NP_001009619

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	5,766,157 - 5,777,648 (-)	NCBI
mRatBN7.2	10	5,259,328 - 5,270,848 (-)	NCBI
Rnor_6.0	10	5,333,378 - 5,343,949 (-)	NCBI
Rnor_5.0	10	4,155,446 - 4,166,017 (-)	NCBI
RGSC_v3.4	10	5,206,634 - 5,217,205 (-)	RGD
Celera	10	4,276,872 - 4,287,443 (-)	RGD

Sequence:

show sequence

GCGCAGCCCGGGCAAGAGCTGCAGCATGGAGGGGGCGCCCCACGGCTGCCCCGGGGCCGATAGC
GCCCAGGCGGGCCGAGGAGCTTCTTGCCAGGGATGCCCCAACCAGAAGTTGTGCGCATCCGGAG
CCGGCGCCGCACCGGACCCGGCTGTGGAGGAAATCAGAGAGAAGATGAAGACGGTGAGACACAG
GATCTTGGTGCTGTCTGGGAAAGGCGGCGTTGGGAAAAGCACATTCAGTGCCCACCTCGCCCAC
GGCCTGGCAGAGGATGGAGACACACAGGTTGCTCTTCTGGACATCGACATCTGTGGGCCATCGA
TCCCCAAGATCATGGGCTTAGAAGGAGAGCAGGTTCACCAGAGTGGCTCCGGCTGGTCTCCAGT
GTATGTGGAGGACAACCTGGGGGTGATGTCTGTGGGCTTCCTGCTCAGCAGCCCGGATGATGCT
GTCATCTGGAGGGGACCAAAGAAAAACGGTATGATCAAGCAGTTCCTCCGAGACGTAGACTGGG
GAGACGTGGACTACCTCGTCATAGACACCCCACCCGGCACGTCCGATGAGCACCTCTCGGTGGT
CCAGTATCTGGCTGCCGCACACATTGATGGGGCGGTGATCCTCACCACCCCTCAGGAGGTGGCC
CTCCAGGATGTTCGGAAAGAGATCAGTTTCTGTCACAAGGTGAAGCTGCCCATCATTGGTGTGG
TAGAGAACATGAGTGGTTTCATCTGCCCCAAGTGCAAGAGAGAGTCTCAGATCTTCCCTCCCAC
CACTGGGGGTGCAGAGGCCATGTGCCAGGCCCTGAAGATCCCTCTTCTGGGCAAAGTGCCGCTG
GATCCACACATAGGCAAGAGCTGTGACAAAGGCCAGTCTTTTTTTGTTGAAGCCCCAGATTCAC
CAGCCACAGCAGCCTACAAAAGTATAATTCAGAGGATCCGAGAGTTTTGTAATTCTCGTCAGTC
ACATGATGAGAACCTCATCAGCCCCTGAAGTGGGACAGAGCCAAGTGCCACCTCCTAACCACAG
CGCCAGCGGGTCACGTGTCCAGCCACACCTGGTCAGCAGGAGACAGGTGGTGCCACAGCCACCA
GATGCTGACAGGATTTGAAGTCACTTATTAAGACTCTATAATCACCTATCTGCATATTTCCTTA
AGATCAAAGGTACAGGCACTCTGCATCCAGGTGCCATTCATCAGAAAATAAAAATGTCTCCTTG
AACCTGAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009619	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88221	(Get FASTA)	NCBI Sequence Viewer
	EDL96223	(Get FASTA)	NCBI Sequence Viewer
	EDL96224	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00055024577
	ENSRNOP00060017494
	ENSRNOP00065002839
GenBank Protein	Q5I0L4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009619 ⟸ NM_001009619

- UniProtKB:

Q5I0L4 (UniProtKB/Swiss-Prot), A6K4K2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEGAPHGCPGADSAQAGRGASCQGCPNQKLCASGAGAAPDPAVEEIREKMKTVRHRILVLSGKG
GVGKSTFSAHLAHGLAEDGDTQVALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGV
MSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGDVDYLVIDTPPGTSDEHLSVVQYLAAAHI
DGAVILTTPQEVALQDVRKEISFCHKVKLPIIGVVENMSGFICPKCKRESQIFPPTTGGAEAMC
QALKIPLLGKVPLDPHIGKSCDKGQSFFVEAPDSPATAAYKSIIQRIREFCNSRQSHDENLISP

hide sequence

RefSeq Acc Id:

ENSRNOP00000003479 ⟸ ENSRNOT00000003479

Protein Domains

AAA+ ATPase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5I0L4-F1-model_v2	AlphaFold	Q5I0L4	1-320	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696945

Promoter ID:

EPDNEW_R7470

Type:

multiple initiation site

Name:

Nubp1_1

Description:

nucleotide binding protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	5,343,962 - 5,344,022	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310514	AgrOrtholog
BioCyc Gene	G2FUF-26131	BioCyc
Ensembl Genes	ENSRNOG00000002574	Ensembl
	ENSRNOG00055018023	UniProtKB/Swiss-Prot
	ENSRNOG00060012974	UniProtKB/Swiss-Prot
	ENSRNOG00065002864	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00055030530	UniProtKB/Swiss-Prot
	ENSRNOT00060022079	UniProtKB/Swiss-Prot
	ENSRNOT00065003985	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7321552	IMAGE-MGC_LOAD
InterPro	AAA+_ATPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Mrp/NBP35_ATP-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Mrp_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NUBP1/Nbp35	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	YlxH/NBP35	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:287042	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:108970	IMAGE-MGC_LOAD
NCBI Gene	287042	ENTREZGENE
PANTHER	CYTOSOLIC FE-S CLUSTER ASSEMBLY FACTOR NUBP1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NUCLEOTIDE-BINDING PROTEIN NBP35 YEAST -RELATED	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
Pfam	ParA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nubp1	PhenoGen
PROSITE	MRP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000002574	RatGTEx
	ENSRNOG00055018023	RatGTEx
	ENSRNOG00060012974	RatGTEx
	ENSRNOG00065002864	RatGTEx
SMART	AAA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	P-loop containing nucleoside triphosphate hydrolases	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6K4K1_RAT	UniProtKB/TrEMBL
	A6K4K2	ENTREZGENE, UniProtKB/TrEMBL
	NUBP1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-03-09	Nubp1	NUBP iron-sulfur cluster assembly factor 1	Nubp1	NUBP iron-sulfur cluster assembly factor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2021-12-23	Nubp1	NUBP iron-sulfur cluster assembly factor 1	Nubp1	nucleotide binding protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Nubp1	nucleotide binding protein 1	Nubp1_predicted	nucleotide binding protein 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Nubp1_predicted	nucleotide binding protein 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations