Agmat (agmatinase) - Rat Genome Database

Name: Agmat
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Agmat (agmatinase) Rattus norvegicus

Analyze

Symbol:

Agmat

Name:

agmatinase

RGD ID:

1308424

Description:

Predicted to enable hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines. Predicted to be involved in putrescine biosynthetic process from arginine, using agmatinase. Predicted to be located in mitochondrion. Orthologous to human AGMAT (agmatinase (putative)); PARTICIPATES IN arginine and proline metabolic pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

agmatinase, mitochondrial; agmatine ureohydrolase (agmatinase); arginase, mitochondrial; AUH; guanidino acid hydrolase, mitochondrial; guanidinobutyrase, mitochondrial; guanidinopropionase, mitochondrial; LOC102548844; LOC298607; uncharacterized LOC102548844

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AGMAT (agmatinase (putative))	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Agmat (agmatinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Agmat (agmatinase (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AGMAT (agmatinase (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AGMAT (agmatinase (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Agmat (agmatinase (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AGMAT (agmatinase (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AGMAT (agmatinase (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Agmat (agmatinase (putative))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TAB2 (TGF-beta activated kinase 1 (MAP3K7) binding protein 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	AGMAT (agmatinase (putative))	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Agmat (agmatinase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	agmat (agmatine ureohydrolase (agmatinase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	agmat	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	159,326,680 - 159,357,300 (+)	NCBI		GRCr8
mRatBN7.2	5	154,043,665 - 154,074,278 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	154,060,151 - 154,074,276 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	156,745,200 - 156,759,284 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	158,518,486 - 158,532,576 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	158,507,648 - 158,521,740 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	160,306,754 - 160,321,951 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	160,306,727 - 160,321,066 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	164,019,284 - 164,033,407 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	160,646,314 - 160,660,437 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	160,656,515 - 160,670,614 (+)	NCBI
Celera	5	152,413,017 - 152,427,142 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 1p36 deletion syndrome (ISO)

Hereditary Pancreatitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

buspirone (EXP)

buta-1,3-diene (ISO)

chromium(6+) (ISO)

cobalt dichloride (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dioxygen (ISO)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (EXP)

fenfluramine (ISO)

folpet (ISO)

furan (EXP)

gentamycin (EXP)

glafenine (EXP)

methamphetamine (EXP)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodiethylamine (ISO)

nickel sulfate (ISO)

paracetamol (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (ISO)

quercetin (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

trichloroethene (EXP)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

putrescine biosynthetic process from arginine, using agmatinase (IBA)

urea cycle (IEA)

Cellular Component

mitochondrion (IEA)

Molecular Function

agmatinase activity (IBA)

arginase activity (ISO,ISS)

guanidinobutyrase activity (ISO,ISS)

guanidinopropionase activity (ISO,ISS)

metal ion binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

arginine and proline metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:17291445	PMID:20563878	PMID:22160263	PMID:23376485	PMID:36849038

Genomics

Comparative Map Data

Agmat
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	159,326,680 - 159,357,300 (+)	NCBI		GRCr8
mRatBN7.2	5	154,043,665 - 154,074,278 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	154,060,151 - 154,074,276 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	156,745,200 - 156,759,284 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	158,518,486 - 158,532,576 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	158,507,648 - 158,521,740 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	160,306,754 - 160,321,951 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	160,306,727 - 160,321,066 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	164,019,284 - 164,033,407 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	160,646,314 - 160,660,437 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	160,656,515 - 160,670,614 (+)	NCBI
Celera	5	152,413,017 - 152,427,142 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

AGMAT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	15,571,699 - 15,585,051 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	15,571,699 - 15,585,051 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	15,898,194 - 15,911,546 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	15,771,739 - 15,784,192 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	15,644,457 - 15,656,911	NCBI
Celera	1	14,382,018 - 14,394,470 (-)	NCBI		Celera
Cytogenetic Map	1	p36.21	NCBI
HuRef	1	14,417,633 - 14,431,067 (-)	NCBI		HuRef
CHM1_1	1	15,696,867 - 15,710,276 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	15,016,395 - 15,029,763 (-)	NCBI		T2T-CHM13v2.0

Agmat
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	141,473,986 - 141,486,574 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	141,473,983 - 141,486,574 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	141,746,675 - 141,759,263 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	141,746,672 - 141,759,263 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	141,302,590 - 141,315,178 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	141,018,751 - 141,031,339 (+)	NCBI		MGSCv36	mm8
Celera	4	143,570,879 - 143,584,214 (+)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	74.75	NCBI

Agmat
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955527	2,563,194 - 2,572,283 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955527	2,563,705 - 2,572,421 (+)	NCBI	ChiLan1.0	ChiLan1.0

AGMAT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	211,334,719 - 211,348,138 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	210,583,175 - 210,596,607 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	14,711,891 - 14,723,546 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	15,704,983 - 15,717,428 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	15,704,989 - 15,717,428 (-)	Ensembl	panpan1.1		panPan2

AGMAT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	81,980,959 - 81,990,377 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	81,981,376 - 81,989,916 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	78,518,550 - 78,527,487 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	82,630,376 - 82,639,406 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	82,630,021 - 82,639,219 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	79,382,696 - 79,391,644 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	80,401,119 - 80,410,133 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	81,466,554 - 81,475,514 (+)	NCBI		UU_Cfam_GSD_1.0

Agmat
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	37,417,396 - 37,427,642 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	3,238,447 - 3,252,272 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	3,242,185 - 3,252,231 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AGMAT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	74,773,324 - 74,784,457 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	74,773,359 - 74,784,486 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	69,199,980 - 69,211,320 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AGMAT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	116,710,261 - 116,721,997 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	116,710,578 - 116,722,125 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	20,250,544 - 20,262,209 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Agmat
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	1,843,227 - 1,853,350 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	1,839,667 - 1,853,344 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Agmat
183 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	116
Count of miRNA genes:	100
Interacting mature miRNAs:	110
Transcripts:	ENSRNOT00000016648
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
1354631	Swd2	Spike wave discharge measurement QTL 2	3.64	0.0002	brain electrophysiology trait (VT:0010557)	brain total spike-and-wave discharge duration (CMO:0001740)	5	151113452	164465185	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	151113452	166875058	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298090	Bp155	Blood pressure QTL 155	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	151006154	161165494	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat

Markers in Region

RH130343

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	5	1057.3	UniSTS
Cytogenetic Map	5	q36	UniSTS

BF398785

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	154,070,643 - 154,070,862 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	160,317,444 - 160,317,662	NCBI	Rnor6.0
Rnor_5.0	5	164,029,777 - 164,029,995	UniSTS	Rnor5.0
RGSC_v3.4	5	160,656,807 - 160,657,025	UniSTS	RGSC3.4
Celera	5	152,423,512 - 152,423,730	UniSTS
RH 3.4 Map	5	1056.1	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	47	103	91	90	59	25	59	6	216	95	83	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001048185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764233	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109690	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091231	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC105628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016648 ⟹ ENSRNOP00000016646

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	154,060,151 - 154,074,276 (+)	Ensembl
Rnor_6.0 Ensembl	5	160,306,727 - 160,321,066 (+)	Ensembl

RefSeq Acc Id:

NM_001048185 ⟹ NP_001041650

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	159,343,175 - 159,357,300 (+)	NCBI
mRatBN7.2	5	154,060,151 - 154,074,276 (+)	NCBI
Rnor_6.0	5	160,306,951 - 160,321,074 (+)	NCBI
Rnor_5.0	5	164,019,284 - 164,033,407 (+)	NCBI
RGSC_v3.4	5	160,646,314 - 160,660,437 (+)	RGD
Celera	5	152,413,017 - 152,427,142 (+)	RGD

Sequence:

show sequence

CCTCAATAGGCGGCATGCTGCAGCTGCTGAAGTCCAGCTGGGTCCGGAGTGCGGGGTCTGGGGT
GGTCACGTGGCGTGCCTCTGCGGGGCTCTTCTGTCCTGGGACCCGCCAGGCTTCAGATACCTCA
GATACCCTACATCACCCGTCCCCTAGCTCTGAGTCACAGGTACAGCCGGTACGCGTCTGTTCCA
TGATGCACTTGCCCCTGCAGTCCTCCCCCGAGGGGCTGGATGCTGCTTTCGTCGGTGTGCCTCT
GGATACCGGAACTTCCAACCGGCCCGGGGCAAGATTTGGACCCCGTCGCATCCGGGAGGAGTCA
CTGATGCTGGGGACTGTCAATCCCAGCACGGGAGCCCTCCCCTTCCAGTCCCTCAGGGTTGCAG
ACCTAGGCAATGTGAACGTCAATCTCTACAACCTTCAGGACAGCTGCCGGCTAATCCGAGAGGC
CTATCAGAACATCCTAGCAACTGGCTGCATTCCTCTGACCTTGGGTGGAGACCATACCATCACA
TATCCCATACTGCAAGCCGTGGCAAAAGAGCATGGCCCTGTGGGTTTAGTGCATGTGGGTGCCC
ACAGCAACACCTCGGACAAACCTCTGGAGGACAAGGTCTACCATCGGACACCTTTCCGCCGAAG
TGTGGATGAGGGACTGCTGGACAGCAAGCGAGTGGTACAGATAGGTATCCGGGGCTCCTCCAGG
ACCCTGGATCCCTACAGATACAGTCGGAGCCAGGGCTTCCGTGTGGTCCTGGCTGAAGACTGTT
GGATGAAGTCACTGGTCCCCCTGATGGCAGAGATCAGGCAGCAGATGGGGGGTGTGCCTCTTTA
CATCAGCTTTGCCATAGATGCCTTGGATCCTGCCTATGCCCCAGGGACAGGGACACCAGAAATT
GCTGGGCTCACCCCTAGTCAGGCTCTGGAGATCATCCGGGGCTGTCAAGGCCTGAATGTGGTGG
GCTGTGACCTTGTGGAAGTTTCCCCGCCGTATGATCTCTCTGGAAACACAGCCCTCCTCGCGGC
TAACCTACTGTTTGAGATGCTGTGTGCTCTCCCCAAGGTGACAACTGTCTGAGTCAGTGTTCCT
GAAGTTGAAACAGACTGGGTCATGATGAAGCCTCAAGGCCCTGTGAACGAACTGTGGCTAGGAT
CAAAGAACCCCTCCTGTGAGGTGTCACCACAAACAAGGGCAATTCAGAGCATTACCCCGAACAG
CTCGAACAGCTCGTGTCTCTTTCCTTCCTAACATTAAAACATTTATTTAATTTTAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039109689 ⟹ XP_038965617

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	159,341,008 - 159,354,538 (+)	NCBI
mRatBN7.2	5	154,060,145 - 154,071,498 (+)	NCBI

RefSeq Acc Id:

XM_039109690 ⟹ XP_038965618

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	159,326,680 - 159,357,300 (+)	NCBI
mRatBN7.2	5	154,043,665 - 154,074,278 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001041650	(Get FASTA)	NCBI Sequence Viewer
	XP_038965617	(Get FASTA)	NCBI Sequence Viewer
	XP_038965618	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91231	(Get FASTA)	NCBI Sequence Viewer
	AAI05629	(Get FASTA)	NCBI Sequence Viewer
	EDL81008	(Get FASTA)	NCBI Sequence Viewer
	EDL81009	(Get FASTA)	NCBI Sequence Viewer
	EDL81010	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016646.3
GenBank Protein	Q0D2L3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001041650 ⟸ NM_001048185
- Peptide Label:	precursor
- UniProtKB:	Q5BK25 (UniProtKB/Swiss-Prot), Q0D2L3 (UniProtKB/Swiss-Prot), A6ITV7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLQLLKSSWVRSAGSGVVTWRASAGLFCPGTRQASDTSDTLHHPSPSSESQVQPVRVCSMMHLP LQSSPEGLDAAFVGVPLDTGTSNRPGARFGPRRIREESLMLGTVNPSTGALPFQSLRVADLGNV NVNLYNLQDSCRLIREAYQNILATGCIPLTLGGDHTITYPILQAVAKEHGPVGLVHVGAHSNTS DKPLEDKVYHRTPFRRSVDEGLLDSKRVVQIGIRGSSRTLDPYRYSRSQGFRVVLAEDCWMKSL VPLMAEIRQQMGGVPLYISFAIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLV EVSPPYDLSGNTALLAANLLFEMLCALPKVTTV hide sequence

Ensembl Acc Id:

ENSRNOP00000016646 ⟸ ENSRNOT00000016648

RefSeq Acc Id:	XP_038965618 ⟸ XM_039109690
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038965617 ⟸ XM_039109689
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q0D2L3-F1-model_v2	AlphaFold	Q0D2L3	1-353	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694232

Promoter ID:

EPDNEW_R4757

Type:

initiation region

Name:

Agmat_1

Description:

agmatinase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	160,306,932 - 160,306,992	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308424	AgrOrtholog
BioCyc Gene	G2FUF-39333	BioCyc
BioCyc Pathway	PWY-40 [putrescine biosynthesis I]	BioCyc
BioCyc Pathway Image	PWY-40	BioCyc
Ensembl Genes	ENSRNOG00000012315	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000016648.6	UniProtKB/Swiss-Prot
Gene3D-CATH	Ureohydrolase domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7322415	IMAGE-MGC_LOAD
	IMAGE:7322772	IMAGE-MGC_LOAD
InterPro	Agmatinase-rel	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ureohydrolase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ureohydrolase_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:298607	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:108981	IMAGE-MGC_LOAD
	MGC:125053	IMAGE-MGC_LOAD
NCBI Gene	298607	ENTREZGENE
PANTHER	AGMATINASE, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ARGINASE/AGMATINASE	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
Pfam	Arginase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Agmat	PhenoGen
PIRSF	Arginase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	ARGINASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ARGINASE_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012315	RatGTEx
Superfamily-SCOP	Arginase/deacetylase	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6ITV7	ENTREZGENE, UniProtKB/TrEMBL
	A6ITV8_RAT	UniProtKB/TrEMBL
	A6ITV9_RAT	UniProtKB/TrEMBL
	Q0D2L3	ENTREZGENE
	Q5BK25	ENTREZGENE
	SPEB_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q5BK25	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Agmat	agmatinase	LOC102548844	uncharacterized LOC102548844	Data merged from RGD:7705579	737654	PROVISIONAL
2015-11-11	Agmat	agmatinase	Agmat	agmatine ureohydrolase (agmatinase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-12-18	LOC102548844	uncharacterized LOC102548844			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-12-06	Agmat	agmatine ureohydrolase (agmatinase)	Agmat_predicted	agmatine ureohydrolase (agmatinase) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Agmat_predicted	agmatine ureohydrolase (agmatinase) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

BioCyc Pathways