Ado (2-aminoethanethiol dioxygenase)

Advanced Search (OLGA)

Gene: Ado (2-aminoethanethiol dioxygenase) Rattus norvegicus

Analyze

Symbol:

Ado

Name:

2-aminoethanethiol dioxygenase

RGD ID:

1308233

Description:

Predicted to enable cysteamine dioxygenase activity and iron ion binding activity. Predicted to be involved in cellular response to hypoxia. Predicted to be located in mitochondrion. Orthologous to human ADO (2-aminoethanethiol dioxygenase); PARTICIPATES IN taurine and hypotaurine metabolic pathway; INTERACTS WITH 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

2-aminoethanethiol (cysteamine) dioxygenase; LOC309732; RGD1308233; similar to hypothetical protein FLJ14547

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	21,043,694 - 21,044,862 (+)	NCBI		GRCr8
mRatBN7.2	20	21,044,815 - 21,045,983 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	21,044,555 - 21,049,235 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	21,768,994 - 21,770,162 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	21,122,055 - 21,123,223 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	21,599,535 - 21,600,703 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	22,447,996 - 22,449,176 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	22,447,994 - 22,449,176 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	24,545,375 - 24,546,303 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	21,877,141 - 21,878,612 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	21,835,054 - 21,892,516 (+)	NCBI
Celera	20	22,406,218 - 22,407,386 (+)	NCBI		Celera
Cytogenetic Map	20	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Autosomal Dominant Intellectual Developmental Disorder 70 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

atrazine (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

deguelin (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

gentamycin (EXP)

indometacin (ISO)

methimazole (EXP)

nitrofen (EXP)

paracetamol (EXP)

phenobarbital (EXP)

picoxystrobin (ISO)

rotenone (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

temozolomide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to hypoxia (ISO)

Cellular Component

mitochondrion (ISO)

Molecular Function

cysteamine dioxygenase activity (ISO)

iron ion binding (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

taurine and hypotaurine metabolic pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
2.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18614015	PMID:34800366

Genomics

Comparative Map Data

Ado
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	21,043,694 - 21,044,862 (+)	NCBI		GRCr8
mRatBN7.2	20	21,044,815 - 21,045,983 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	21,044,555 - 21,049,235 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	21,768,994 - 21,770,162 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	21,122,055 - 21,123,223 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	21,599,535 - 21,600,703 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	22,447,996 - 22,449,176 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	22,447,994 - 22,449,176 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	24,545,375 - 24,546,303 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	21,877,141 - 21,878,612 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	21,835,054 - 21,892,516 (+)	NCBI
Celera	20	22,406,218 - 22,407,386 (+)	NCBI		Celera
Cytogenetic Map	20	p11	NCBI

ADO
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	62,804,720 - 62,808,479 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	62,804,720 - 62,808,479 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	64,564,480 - 64,568,239 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	64,234,522 - 64,238,245 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	64,234,651 - 64,238,244	NCBI
Celera	10	57,831,785 - 57,835,508 (+)	NCBI		Celera
Cytogenetic Map	10	q21.3	NCBI
HuRef	10	58,556,298 - 58,560,021 (+)	NCBI		HuRef
CHM1_1	10	64,846,508 - 64,850,231 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	63,662,863 - 63,666,622 (+)	NCBI		T2T-CHM13v2.0

Ado
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	67,380,341 - 67,384,785 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	67,380,341 - 67,384,898 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	67,544,511 - 67,548,955 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	67,544,511 - 67,549,068 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	67,007,259 - 67,011,703 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	66,940,488 - 66,944,299 (-)	NCBI		MGSCv36	mm8
Celera	10	68,635,994 - 68,640,438 (-)	NCBI		Celera
Cytogenetic Map	10	B5.1	NCBI
cM Map	10	34.96	NCBI

Ado
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955425	16,049,284 - 16,050,096 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955425	16,049,194 - 16,052,275 (+)	NCBI	ChiLan1.0	ChiLan1.0

ADO
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	74,987,624 - 74,994,534 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	74,996,097 - 74,999,868 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	59,312,788 - 59,316,554 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	61,641,371 - 61,644,848 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

ADO
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	14,698,582 - 14,702,635 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	14,698,616 - 14,699,428 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	14,915,996 - 14,920,120 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	14,962,585 - 14,966,710 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	14,962,691 - 14,963,503 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	14,945,248 - 14,949,371 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	15,070,279 - 15,074,404 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	15,425,875 - 15,430,000 (+)	NCBI		UU_Cfam_GSD_1.0

Ado
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	66,391,222 - 66,394,926 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936753	1,965,840 - 1,969,554 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADO
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	66,277,947 - 66,278,759 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	66,277,224 - 66,281,964 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	71,509,996 - 71,514,349 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADO
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	68,483,110 - 68,486,866 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	68,485,720 - 68,486,532 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	29,367,071 - 29,371,016 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ado
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624791	965,433 - 966,245 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624791	962,840 - 966,603 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ado
4 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	221
Count of miRNA genes:	156
Interacting mature miRNAs:	181
Transcripts:	ENSRNOT00000000791
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889610	Pancm3	Pancreatic morphology QTL 3	3.75	0.001	pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	20	17617832	47606836	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26123605	Rat
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8042410	29322208	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
2303626	Vencon10	Ventilatory control QTL 10		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	20	19190721	54435887	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
7411652	Foco24	Food consumption QTL 24		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	11757515	54435887	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
2317880	Alcrsp25	Alcohol response QTL 25	2.3		response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	17697550	54435887	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
9590092	Insglur9	Insulin/glucose ratio QTL 9	18.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	20	11757515	54435887	Rat

Markers in Region

RH138042

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	21,043,642 - 21,043,780 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	22,446,820 - 22,446,957	NCBI	Rnor6.0
Rnor_5.0	20	24,544,199 - 24,544,336	UniSTS	Rnor5.0
RGSC_v3.4	20	21,876,230 - 21,876,367	UniSTS	RGSC3.4
Celera	20	22,404,986 - 22,405,123	UniSTS
Cytogenetic Map	20	p11	UniSTS

RH139021

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	21,045,380 - 21,045,657 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	22,448,574 - 22,448,850	NCBI	Rnor6.0
Rnor_5.0	20	24,545,701 - 24,545,977	UniSTS	Rnor5.0
RGSC_v3.4	20	21,878,012 - 21,878,288	UniSTS	RGSC3.4
Celera	20	22,406,784 - 22,407,060	UniSTS
RH 3.4 Map	4	701.2	UniSTS
Cytogenetic Map	20	p11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107626	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000791

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	22,447,994 - 22,449,176 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097613 ⟹ ENSRNOP00000083299

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	21,044,555 - 21,049,235 (+)	Ensembl

RefSeq Acc Id:

NM_001107626 ⟹ NP_001101096

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	21,043,694 - 21,044,862 (+)	NCBI
mRatBN7.2	20	21,044,815 - 21,045,983 (+)	NCBI
Rnor_6.0	20	22,447,996 - 22,449,176 (+)	NCBI
Rnor_5.0	20	24,545,375 - 24,546,303 (+)	NCBI
RGSC_v3.4	20	21,877,141 - 21,878,612 (+)	RGD
Celera	20	22,406,218 - 22,407,386 (+)	NCBI

Sequence:

show sequence

CGGAGACCGCAAGGGGCGGCGCAGAGGCGGAACGGGCCGGCCGCGAGCCGCGCAGGAAGCGCCA
AGCATGCCCCGCGACAACATGGCCTCCCTGATCCAGCGCATCGCTCGCCAGGCTTGTCTCACCT
TCCGCGGCGGCTCGACGGGCTCCGAGGCGCCAGCACCCGGCTTCCCGGAGAACCTGAGCCAGCT
CAAGAGCCTGCTGACCCAGGTTCGCGCCGAAGACCTCAACATCGCACCGCGCAAGGCGCTGCCG
CAACCTCTGCCGCGGAACCTCCCGCCGGTCACTTACATGCACATCTACGAGACGGAGGGCTTCA
GCCTGGGCGTGTTCCTGCTCAAGAGCGGTACGTGCATCCCGCTGCACGACCACCCGGGCATGCA
CGGTATGCTCAAGGTGCTGTACGGCAAGGTCCGCATCAGCTGCATGGACAAGCTGGACACGGGG
GCCGTGCATCGGCGGCCGCCGCCTGAACAGCAGTTCGAGCCCCCGCTGCAACCTACGGAGAGGG
AGGCCGTGCGACTGGGCGTACTGCGCTCCCGGGCCGAGTACACCGAAGCCAGTGGTCCCTGCGT
ACTCACTCCACACCGGGACAACCTGCACCAGATTGATGCGGTGGACGGGCCAGCCGCCTTCCTG
GACATCCTGGCCCCACCCTACGACCCGGAGGACGGCCGGGACTGCCACTATTACCGTGTGATGG
AGCCCATCAAACCCAAGGAGGCTTCCGGCTCTGCCTGCGACCTTCCCCGAGAAGTATGGCTCCT
GGAGACCCCACAGGCCGACGACTTCTGGTGCGAGGGAGAGCCCTATCCAGGCCCCAAAGTCCTA
CCCTGAAGCTCCTGCCGCCCGGGAACTGTGGGCCCTCTCTACCTACCATAAGGGCTCTTCTCTC
TCTGTCCCCTCGCCTGGACGATGGATTTACTGAAATGACCAGCGCCACGTCTTGAGCAACCTTG
GGGAGCACGGCCCACTGGAGTATAGCCACCACCGGGCACGGTTATGGGGGCGGGTGGGCGGGAG
GCTAGGTTGATTCCTGGTTTTGTCACTGCCACCAAGGCTTTGATTTAAAGGAAAGGGGCAGGGA
CCCTAAAGCGCTTCCACCGTAAAGCCATAAGGAAAACAGTTTGGTTTTCATTCTCTACAAAATA
CACTAAGTGATTTTGAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101096	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL97324	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000083299.1

RefSeq Acc Id:

NP_001101096 ⟸ NM_001107626

- UniProtKB:

A0A8I5ZWY4 (UniProtKB/TrEMBL), A6JKV8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPRDNMASLIQRIARQACLTFRGGSTGSEAPAPGFPENLSQLKSLLTQVRAEDLNIAPRKALPQ
PLPRNLPPVTYMHIYETEGFSLGVFLLKSGTCIPLHDHPGMHGMLKVLYGKVRISCMDKLDTGA
VHRRPPPEQQFEPPLQPTEREAVRLGVLRSRAEYTEASGPCVLTPHRDNLHQIDAVDGPAAFLD
ILAPPYDPEDGRDCHYYRVMEPIKPKEASGSACDLPREVWLLETPQADDFWCEGEPYPGPKVLP

hide sequence

Ensembl Acc Id:

ENSRNOP00000083299 ⟸ ENSRNOT00000097613

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308233	AgrOrtholog
BioCyc Gene	G2FUF-3871	BioCyc
BioCyc Pathway	PWY-7850 [taurine biosynthesis II]	BioCyc
BioCyc Pathway Image	PWY-7850	BioCyc
Ensembl Genes	ENSRNOG00000000639	Ensembl
	ENSRNOG00000070733	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000097613.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.10	UniProtKB/TrEMBL
InterPro	PCO/ADO	UniProtKB/TrEMBL
	RmlC-like_jellyroll	UniProtKB/TrEMBL
	RmlC_Cupin_sf	UniProtKB/TrEMBL
KEGG Report	rno:309732	UniProtKB/TrEMBL
NCBI Gene	309732	ENTREZGENE
PANTHER	2-AMINOETHANETHIOL DIOXYGENASE	UniProtKB/TrEMBL
	PTHR22966	UniProtKB/TrEMBL
Pfam	PCO_ADO	UniProtKB/TrEMBL
PhenoGen	Ado	PhenoGen
RatGTEx	ENSRNOG00000000639	RatGTEx
	ENSRNOG00000070733	RatGTEx
Superfamily-SCOP	SSF51182	UniProtKB/TrEMBL
UniProt	A0A8I5ZWY4	ENTREZGENE, UniProtKB/TrEMBL
	A6JKV8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-08	Ado	2-aminoethanethiol dioxygenase	Ado	2-aminoethanethiol (cysteamine) dioxygenase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-26	Ado	2-aminoethanethiol (cysteamine) dioxygenase	RGD1308233_predicted	similar to hypothetical protein FLJ14547 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1308233_predicted	similar to hypothetical protein FLJ14547 (predicted)	LOC309732_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC309732_predicted	similar to hypothetical protein FLJ14547 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways