Advanced Search (OLGA)

Gene: Gpr87 (G protein-coupled receptor 87) Rattus norvegicus

Analyze

Symbol:

Gpr87

Name:

G protein-coupled receptor 87

RGD ID:

1307852

Description:

Predicted to enable G protein-coupled purinergic nucleotide receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to be located in plasma membrane. Orthologous to human GPR87 (G protein-coupled receptor 87); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

G-protein coupled receptor 87; LOC310443

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GPR87 (G protein-coupled receptor 87)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Gpr87 (G protein-coupled receptor 87)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gpr87 (G protein-coupled receptor 87)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GPR87 (G protein-coupled receptor 87)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GPR87 (G protein-coupled receptor 87)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gpr87 (G protein-coupled receptor 87)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GPR87 (G protein-coupled receptor 87)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GPR87 (G protein-coupled receptor 87)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gpr87 (G protein-coupled receptor 87)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NXNL1 (nucleoredoxin like 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GPR87 (G protein-coupled receptor 87)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gpr87 (G protein-coupled receptor 87)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gpr87	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	145,589,630 - 145,608,094 (-)	NCBI		GRCr8
mRatBN7.2	2	143,439,741 - 143,440,901 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	143,439,735 - 143,458,190 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	150,078,112 - 150,079,272 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	148,191,373 - 148,192,533 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	142,823,787 - 142,824,947 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	149,398,949 - 149,418,041 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	149,398,949 - 149,417,212 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	168,817,067 - 168,823,020 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	148,568,437 - 148,569,597 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	148,518,480 - 148,524,111 (-)	NCBI
Celera	2	137,864,294 - 137,865,454 (-)	NCBI		Celera
Cytogenetic Map	2	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

glycogen storage disease XV (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dichloroethane (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-tert-butylhydroquinone (ISO)

5-fluorouracil (ISO)

actinomycin D (ISO)

adefovir pivoxil (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

arsenous acid (ISO)

bazedoxifene (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

camptothecin (ISO)

carbamazepine (ISO)

chloroacetaldehyde (ISO)

cidofovir anhydrous (ISO)

cisplatin (ISO)

clodronic acid (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

decabromodiphenyl ether (EXP)

diarsenic trioxide (ISO)

dichloroacetic acid (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

ethyl methanesulfonate (ISO)

formaldehyde (ISO)

fructose (ISO)

glucose (ISO)

ifosfamide (ISO)

mercury dibromide (ISO)

methyl methanesulfonate (ISO)

N-Nitrosopyrrolidine (ISO)

Nutlin-3 (ISO)

O-methyleugenol (ISO)

paracetamol (ISO)

phenylmercury acetate (ISO)

potassium bromate (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

propanal (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

testosterone (EXP)

trametinib (ISO)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G protein-coupled purinergic nucleotide receptor signaling pathway (IEA)

G protein-coupled receptor signaling pathway (IBA)

Cellular Component

plasma membrane (IEA)

Molecular Function

G protein-coupled purinergic nucleotide receptor activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Gpr87
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	145,589,630 - 145,608,094 (-)	NCBI		GRCr8
mRatBN7.2	2	143,439,741 - 143,440,901 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	143,439,735 - 143,458,190 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	150,078,112 - 150,079,272 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	148,191,373 - 148,192,533 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	142,823,787 - 142,824,947 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	149,398,949 - 149,418,041 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	149,398,949 - 149,417,212 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	168,817,067 - 168,823,020 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	148,568,437 - 148,569,597 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	148,518,480 - 148,524,111 (-)	NCBI
Celera	2	137,864,294 - 137,865,454 (-)	NCBI		Celera
Cytogenetic Map	2	q26	NCBI

GPR87
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	151,294,086 - 151,316,820 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	151,294,086 - 151,316,820 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	151,011,874 - 151,034,608 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	152,494,587 - 152,517,326 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	152,494,594 - 152,517,334	NCBI
Celera	3	149,424,590 - 149,447,354 (-)	NCBI		Celera
Cytogenetic Map	3	q25.1	NCBI
HuRef	3	148,385,074 - 148,407,837 (-)	NCBI		HuRef
CHM1_1	3	150,974,988 - 150,997,753 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	154,045,086 - 154,067,827 (-)	NCBI		T2T-CHM13v2.0

Gpr87
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	59,086,325 - 59,102,583 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	59,086,344 - 59,102,525 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	59,178,904 - 59,195,163 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	59,178,923 - 59,195,104 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	58,982,845 - 58,984,007 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	59,266,852 - 59,268,014 (-)	NCBI		MGSCv36	mm8
Celera	3	58,866,100 - 58,867,262 (-)	NCBI		Celera
Cytogenetic Map	3	D	NCBI
cM Map	3	29.0	NCBI

Gpr87
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955448	2,403,128 - 2,424,944 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955448	2,403,188 - 2,424,209 (-)	NCBI	ChiLan1.0	ChiLan1.0

GPR87
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	149,192,600 - 149,221,680 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	149,197,271 - 149,226,414 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	148,321,524 - 148,344,850 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	155,891,753 - 155,914,428 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	155,891,753 - 155,914,428 (-)	Ensembl	panpan1.1		panPan2

GPR87
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	45,866,259 - 45,888,361 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	45,866,335 - 45,888,250 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	45,731,150 - 45,753,156 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	46,493,549 - 46,515,207 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	46,493,625 - 46,515,127 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	46,082,390 - 46,104,027 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	46,134,620 - 46,156,291 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	46,411,780 - 46,433,421 (-)	NCBI		UU_Cfam_GSD_1.0

Gpr87
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	90,205,702 - 90,225,210 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936758	1,542,590 - 1,562,203 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936758	1,542,570 - 1,562,180 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GPR87
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	91,474,339 - 91,526,793 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	91,474,356 - 91,498,748 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	99,747,623 - 99,771,960 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GPR87
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	39,381,491 - 39,406,097 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	39,398,651 - 39,404,737 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	12,199,433 - 12,222,282 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gpr87
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	28,735,118 - 28,754,830 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	28,735,040 - 28,759,250 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	20
Count of miRNA genes:	20
Interacting mature miRNAs:	20
Transcripts:	ENSRNOT00000018573
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	102803808	147803808	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
6907363	Bp357	Blood pressure QTL 357	4.1	0.002	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	129540907	174540907	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1358360	Sradr2	Stress Responsive Adrenal Weight QTL 2	10.24		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	2	129164097	152195315	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	127447387	143657569	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
1549828	Bp258	Blood pressure QTL 258		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	142323368	150650069	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	76539322	150540526	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
12879844	Kidm62	Kidney mass QTL 62		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	142323368	146786035	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
12879841	Cm87	Cardiac mass QTL 87		0.026	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	142323368	146786035	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
12879842	Cm88	Cardiac mass QTL 88		0.042	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	142323368	146786035	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
12879843	Am3	Aortic mass QTL 3		0.016	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	142323368	146786035	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1582257	Gluco21	Glucose level QTL 21	3.1	0.0035	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	118111229	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1359035	Bp276	Blood pressure QTL 276			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	143657569	Rat
8662836	Vetf8	Vascular elastic tissue fragility QTL 8	0.66		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	104559726	149559726	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
5135226	Leukc2	Leukocyte quantity QTL 2			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	2	118111229	149559726	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	78665616	143657569	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
7488933	Bp368	Blood pressure QTL 368		0.004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	142323368	147803808	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
738007	Anxrr7	Anxiety related response QTL 7	4.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	118189491	163189491	Rat
9685068	Swd7	Spike wave discharge measurement QTL 7	3.2	0.01	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge rate (CMO:0001739)	2	141656606	147588984	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
1581552	Pur12	Proteinuria QTL 12	5.19	0.0009	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	2	112103657	148076632	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1354594	Despr10	Despair related QTL 10		2e-06	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	2	114654253	159654253	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat

Markers in Region

BB242349

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	143,439,855 - 143,439,979 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	149,399,064 - 149,399,187	NCBI	Rnor6.0
Rnor_5.0	2	168,817,182 - 168,817,305	UniSTS	Rnor5.0
RGSC_v3.4	2	148,568,552 - 148,568,675	UniSTS	RGSC3.4
Celera	2	137,864,409 - 137,864,532	UniSTS
Cytogenetic Map	2	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
2	5	12	38	39	37	10	24	10	6	83	52	18	14	23	27

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107677	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006232401	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590860	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128510	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018573 ⟹ ENSRNOP00000018573

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	143,439,735 - 143,458,190 (-)	Ensembl
Rnor_6.0 Ensembl	2	149,398,949 - 149,417,212 (-)	Ensembl

RefSeq Acc Id:

NM_001107677 ⟹ NP_001101147

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	145,589,630 - 145,590,790 (-)	NCBI
mRatBN7.2	2	143,439,741 - 143,440,901 (-)	NCBI
Rnor_6.0	2	149,398,949 - 149,400,109 (-)	NCBI
Rnor_5.0	2	168,817,067 - 168,823,020 (-)	NCBI
RGSC_v3.4	2	148,568,437 - 148,569,597 (-)	RGD
Celera	2	137,864,294 - 137,865,454 (-)	RGD

Sequence:

show sequence

GTGGCTGTTCTGACATGAATGTCTCTCCTTTTTCAGGTAATGAATTATACAGCCAAGCAAGTCA
CACTGCAAACAGCACGATCGAGGGACATGGGAAGAACTCCACCCATCACAACGAGTTTGACACC
ATCATCCTGCCGGTGCTTTACCTAGTTATATTTGTGGCAAGCATCCTGCTGAACGGTCTGGCTG
TGTGGATCTTCTTCCACATTCGGAATAAAACCAGCTTCATATTTTATCTCAAAAATATAGTAGT
AGCTGACCTCATAATGACCCTGACATTCCCGTTCCGAATAGTCCGTGACGCAGGATTCGGACCT
TGGTACTTTGAGTTTATCCTCTGCAGATACACCTCGGTTTTGTTCTATGCAAACATGTATACAT
CCATTGTGTTTCTTGGGCTGATCAGTGTTGATCGCTATCTGAAGGTGGTAAAGCCTTTTGGTGA
CTCTCGCATGTATAGCATAACCTTCACCAAAGTCTTATCGATTTGTGTCTGGGTGATCATGGCT
GTTCTGTCCTTGCCAAACATCATACTGACTAACGGTCAACCAACTAAGGAAAACATTCATGACT
GCATGAAGCTTAAAAGTCCGTTGGGAGCCAAGTGGGATATGGCTGTCACCTACGTGGACAGCTG
TCTGTTTGTCGCTGTGCTGGTGATTCTGATTGGATGCTACATAGCCATCTCCAGATACATCCAC
AAATCCAGCAGGCAATTCATAAGTCAATCGAGCCGGAAGCGGAAGCATAACCAGAGCATCCGCG
TGGTCGTGGCTGTGTTTTTTACCTGCTTCCTCCCGTATCACTTGTGCAGAATCCCCTTCACTTT
CAGTCACTTAGACAGGCTCCTAGATGACTCAGCACACAAAATTCTCCACTACTGCAAGGAAATG
ACACTTTTCTTGTCTGCGTGCAACGTGTGCCTGGATCCGATAATTTATTTTTTCATGTGTAAGT
CATTTTCAAGAAGGTTATTCAAGAAATCAAACATAAGAACCAGGAGTGAAAGCATCAGGTCGCT
GCAAAGCGTCCGAAGATCAGAAGTGCGTATCTACTATGACTACACCGATGTGTAGGGACTAGAG
GCCAGAGGGCCTTTTCCTGTTGGAATCAGTATATAAAAGTGTAAATAAATGTCTCTTTGTATTA
TTCTGGCTG

hide sequence

RefSeq Acc Id:

XM_063281787 ⟹ XP_063137857

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	145,589,639 - 145,608,094 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101147	(Get FASTA)	NCBI Sequence Viewer
	XP_063137857	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM14850	(Get FASTA)	NCBI Sequence Viewer
	EDM14851	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018573.6

RefSeq Acc Id:

NP_001101147 ⟸ NM_001107677

- UniProtKB:

A6JVK2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNVSPFSGNELYSQASHTANSTIEGHGKNSTHHNEFDTIILPVLYLVIFVASILLNGLAVWIFF
HIRNKTSFIFYLKNIVVADLIMTLTFPFRIVRDAGFGPWYFEFILCRYTSVLFYANMYTSIVFL
GLISVDRYLKVVKPFGDSRMYSITFTKVLSICVWVIMAVLSLPNIILTNGQPTKENIHDCMKLK
SPLGAKWDMAVTYVDSCLFVAVLVILIGCYIAISRYIHKSSRQFISQSSRKRKHNQSIRVVVAV
FFTCFLPYHLCRIPFTFSHLDRLLDDSAHKILHYCKEMTLFLSACNVCLDPIIYFFMCKSFSRR
LFKKSNIRTRSESIRSLQSVRRSEVRIYYDYTDV

hide sequence

Ensembl Acc Id:

ENSRNOP00000018573 ⟸ ENSRNOT00000018573

RefSeq Acc Id:	XP_063137857 ⟸ XM_063281787
- Peptide Label:	isoform X1
- UniProtKB:	A6JVK1 (UniProtKB/TrEMBL), F1LXU3 (UniProtKB/TrEMBL)

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LXU3-F1-model_v2	AlphaFold	F1LXU3	1-358	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307852	AgrOrtholog
BioCyc Gene	G2FUF-52987	BioCyc
Ensembl Genes	ENSRNOG00000013894	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000018573.8	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	P2Y13_purnocptor	UniProtKB/TrEMBL
KEGG Report	rno:310443	UniProtKB/TrEMBL
NCBI Gene	310443	ENTREZGENE
PANTHER	G-PROTEIN COUPLED RECEPTOR 87	UniProtKB/TrEMBL
	P2Y PURINOCEPTOR-RELATED G-PROTEIN COUPLED RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/TrEMBL
PhenoGen	Gpr87	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	P2Y13PRNCPTR	UniProtKB/TrEMBL
	P2YPURNOCPTR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013894	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A6JVK1	ENTREZGENE, UniProtKB/TrEMBL
	A6JVK2	ENTREZGENE, UniProtKB/TrEMBL
	F1LXU3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Gpr87	G protein-coupled receptor 87	Gpr87_predicted	G protein-coupled receptor 87 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Gpr87_predicted	G protein-coupled receptor 87 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar