Ccdc89 (coiled-coil domain containing 89)

Advanced Search (OLGA)

Gene: Ccdc89 (coiled-coil domain containing 89) Rattus norvegicus

Analyze

Symbol:

Ccdc89 (Ensembl: LOC100911776)

Name:

coiled-coil domain containing 89 (Ensembl:coiled-coil domain-containing protein 89-like)

RGD ID:

1305335

Description:

Predicted to be located in cytoplasm and nucleus. Orthologous to human CCDC89 (coiled-coil domain containing 89); INTERACTS WITH 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Bc8 orange-interacting protein; coiled-coil domain-containing protein 89; LOC293107; MGC189379; RGD1305335; similar to hypothetical protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CCDC89 (coiled-coil domain containing 89)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ccdc89 (coiled-coil domain containing 89)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ccdc89 (coiled-coil domain containing 89)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CCDC89 (coiled-coil domain containing 89)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCDC89 (coiled-coil domain containing 89)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ccdc89 (coiled-coil domain containing 89)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCDC89 (coiled-coil domain containing 89)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CCDC89 (coiled-coil domain containing 89)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ccdc89 (coiled-coil domain containing 89)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Ccdc89 (coiled-coil domain containing 89)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CCDC89 (coiled-coil domain containing 89)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:172182	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ccdc89	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	153,798,786 - 153,800,048 (+)	NCBI		GRCr8
mRatBN7.2	1	144,386,252 - 144,387,514 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	144,386,158 - 144,389,850 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	152,309,080 - 152,310,342 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	159,487,316 - 159,488,578 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	152,361,235 - 152,362,497 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	154,606,461 - 154,607,723 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	154,606,490 - 154,607,602 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	160,870,436 - 160,871,698 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	147,091,688 - 147,092,950 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	147,169,971 - 147,171,333 (+)	NCBI
Celera	1	142,606,685 - 142,607,947 (+)	NCBI		Celera
Cytogenetic Map	1	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

exudative vitreoretinopathy 1 (ISO)

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3-chloropropane-1,2-diol (EXP)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

CGP 52608 (ISO)

chloroprene (ISO)

dioxygen (ISO)

iron dichloride (ISO)

ozone (ISO)

potassium dichromate (ISO)

rotenone (ISO)

sotorasib (ISO)

temozolomide (ISO)

testosterone (EXP)

trametinib (ISO)

trichloroethene (EXP)

triptonide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

cytoplasm (IEA)

nucleus (IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932

Genomics

Comparative Map Data

Ccdc89
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	153,798,786 - 153,800,048 (+)	NCBI		GRCr8
mRatBN7.2	1	144,386,252 - 144,387,514 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	144,386,158 - 144,389,850 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	152,309,080 - 152,310,342 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	159,487,316 - 159,488,578 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	152,361,235 - 152,362,497 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	154,606,461 - 154,607,723 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	154,606,490 - 154,607,602 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	160,870,436 - 160,871,698 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	147,091,688 - 147,092,950 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	147,169,971 - 147,171,333 (+)	NCBI
Celera	1	142,606,685 - 142,607,947 (+)	NCBI		Celera
Cytogenetic Map	1	q32	NCBI

CCDC89
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	85,683,848 - 85,686,195 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	85,683,848 - 85,686,195 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	85,394,891 - 85,397,238 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	85,072,541 - 85,074,968 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	11	82,704,196 - 82,706,623 (-)	NCBI		Celera
Cytogenetic Map	11	q14.1	NCBI
HuRef	11	81,692,190 - 81,694,617 (-)	NCBI		HuRef
CHM1_1	11	85,279,700 - 85,282,127 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	85,620,532 - 85,622,879 (-)	NCBI		T2T-CHM13v2.0

Ccdc89
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	90,075,520 - 90,077,872 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	90,075,785 - 90,077,877 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	90,426,312 - 90,428,664 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	90,426,577 - 90,428,669 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	97,574,822 - 97,577,174 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	90,301,504 - 90,303,856 (+)	NCBI		MGSCv36	mm8
Celera	7	87,753,586 - 87,755,938 (+)	NCBI		Celera
Cytogenetic Map	7	E1	NCBI
cM Map	7	50.58	NCBI

Ccdc89
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955414	7,198,795 - 7,199,913 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955414	7,197,533 - 7,200,234 (+)	NCBI	ChiLan1.0	ChiLan1.0

CCDC89
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	86,606,062 - 86,614,080 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	87,657,137 - 87,659,883 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	80,740,357 - 80,741,833 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	84,348,915 - 84,350,391 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	84,349,126 - 84,350,250 (-)	Ensembl	panpan1.1		panPan2

CCDC89
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	13,760,634 - 13,763,602 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	13,760,958 - 13,762,070 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	13,627,506 - 13,630,106 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	13,941,507 - 13,944,107 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	21	13,941,601 - 13,943,772 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	21	13,730,192 - 13,732,790 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	13,802,459 - 13,805,059 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	13,855,218 - 13,857,816 (+)	NCBI		UU_Cfam_GSD_1.0

Ccdc89
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	71,969,295 - 71,971,183 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936498	13,569,564 - 13,571,035 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936498	13,569,401 - 13,570,751 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCDC89
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	19,603,230 - 19,609,004 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	19,606,282 - 19,611,544 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	21,877,776 - 21,879,868 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCDC89
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	76,927,354 - 76,929,973 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	76,927,842 - 76,928,966 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666043	48,793,196 - 48,794,984 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccdc89
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624845	4,243,806 - 4,245,722 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ccdc89
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	204
Count of miRNA genes:	80
Interacting mature miRNAs:	83
Transcripts:	ENSRNOT00000024095, ENSRNOT00000074282
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	121767634	166767634	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
9590300	Scort16	Serum corticosterone level QTL 16	4.39	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	103111621	148111621	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383668	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	115585465	172949803	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	117917486	196963478	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
2317833	Alcrsp19	Alcohol response QTL 19	12.4	0.001	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	131763437	159756369	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	136745990	163747690	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1641897	Alcrsp1	Alcohol response QTL 1			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
9685799	Bp375	Blood pressure QTL 375			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121833674	166833674	Rat
9685802	Bp376	Blood pressure QTL 376			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	126540680	171540680	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat
61370	Mcs3	Mammary carcinoma susceptibility QTL 3	2.15		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	102268556	147268556	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	106047847	151047847	Rat
634315	Niddm45	Non-insulin dependent diabetes mellitus QTL 45	7.16		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	144267916	172949660	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
61379	Bp44	Blood pressure QTL 44	19.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144267916	174133260	Rat
2303591	Gluco41	Glucose level QTL 41	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	102168504	147168504	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
2313060	Bss71	Bone structure and strength QTL 71	2.6	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	1	118944747	163944747	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
724550	Thym3	Thymus enlargement QTL 3	7.82	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
71118	Thym1	Thymus enlargement QTL 1	10.17	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	136830018	181830018	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	168883176	Rat
8694370	Bw154	Body weight QTL 154	8.91	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	1	103111621	148111621	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
1354623	Rf46	Renal function QTL 46	3.8		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	1	102813953	151162766	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	123556856	196963478	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

reproductive system
1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001134833	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC167063	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074282 ⟹ ENSRNOP00000064997

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	144,386,158 - 144,389,850 (+)	Ensembl

RefSeq Acc Id:

NM_001134833 ⟹ NP_001128305

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	153,798,786 - 153,800,048 (+)	NCBI
mRatBN7.2	1	144,386,252 - 144,387,514 (+)	NCBI
Rnor_6.0	1	154,606,461 - 154,607,723 (+)	NCBI
Rnor_5.0	1	160,870,436 - 160,871,698 (+)	NCBI
RGSC_v3.4	1	147,091,688 - 147,092,950 (+)	RGD
Celera	1	142,606,685 - 142,607,947 (+)	RGD

Sequence:

show sequence

ACTAAAGTCATTTCTTCTGCAGAGCGTCTATGCCGCAGAAGGAGAAGACGCTTAGGATGGATAC
CCCACCCCCCGACGAGATCCTAGGAAGACAAAACGAAAACCTGGAAAACGAGGATGACGAATTG
GGGTTTAAGGAAATGGACGGTCTGAGAGAAGCTTTGGCCAACCTTAGGGGACTGTCCGAGGAGG
AGAAGGGCGAGAAGGCAATGCTCCGCTCCCGCATCCAAGAGCAATCCCAGCTCATCTGCATCTT
GAAACGCAGATCCGACGAGGCCCTGGAACGCTGCCAGATCCTAGAACTGCTCAACTCGGAGCTG
GAGGAGAAGAGGATGCAGGAGATGGAGAAGATGAAGGTCCAGAATGAGCAGGTCCAAAAGCTGG
AGAGTCGCTTTATGACCCTAGCAGCCAACCACGAGCTGATGATCCGCTTCAAAGATGAGCACAA
GAGTGAAAACATCAAGCTGAAGGAGGAGAATGAGAAGCTGAGGCAGGAGAATAACAGCCTCTTC
AGCCAGGCTCTGAAAGACCAGGAGAACAAGGTACTGCAGCTCACTGCACACAACAAGGCTCTGG
TGGAGGAACTGGAGGTCTTGAAACAGAGATGCGCTCACGAAGCCGGTCAGGCTCGGGCCCGAGA
GGAGGAGCTGCTGGCTCTGCAGAACCAGCAGGCCTGTGAGCATGCCAAGGAGACTGAGCAGCTG
CGCAGCCAGCTGCAGAGCATCAAGCAACAACACCGGCAGGCCACGGAACAGATGGGGAAGGACC
AAGAAGCGAATATCAACATGAACCAGGAGCTGCAGGCCAGGCTGCACACTGTCATGCGTGAGAA
AGAGGAGCTGCTGCAGCTGTCCATGGAGAGGGGCAAGGTGCTTCAGAACAAACAGGCTGAGATC
CGCCAGCTTGAGGAGAAATTGGAGACAGCAGCCATGGCCAAGAAGCATGCGCTAGAACGCTTTG
AGCAAGAGGCAGTGGCGGTTGATAGCAACTTGAGAGTTCGCGAGCTCCAGCGCAAGGTAGATGG
GATCCAGAAAGCTTACGATGATCTGCGTCTCCAATCAGAAGCCTTCAAAAAGCACAGCCTGGAT
CTTTTAAGCAAAGAGAGAGAACTTAATGCCAAACTCCGCCATCTCTTTCCATAAGAGAAATTGT
GCTTCCTGTTGTCTCCAGTTAATACTTCAAGTATATGTGCCTTAGATTTATGGCAAAAACAAAG
AAAATTCATTTACTATACTTTTAAGTACAAAAAACACTTTACTATGAAAAAAAAAAAAAAAAAA
AAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001128305	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI67063	(Get FASTA)	NCBI Sequence Viewer
	B2RZ86	(Get FASTA)	NCBI Sequence Viewer
	EDM18545	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064997.1
	ENSRNOP00055027647
	ENSRNOP00060033475
	ENSRNOP00065042507

RefSeq Acc Id:

NP_001128305 ⟸ NM_001134833

- UniProtKB:

B2RZ86 (UniProtKB/Swiss-Prot), A6I635 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPQKEKTLRMDTPPPDEILGRQNENLENEDDELGFKEMDGLREALANLRGLSEEEKGEKAMLRS
RIQEQSQLICILKRRSDEALERCQILELLNSELEEKRMQEMEKMKVQNEQVQKLESRFMTLAAN
HELMIRFKDEHKSENIKLKEENEKLRQENNSLFSQALKDQENKVLQLTAHNKALVEELEVLKQR
CAHEAGQARAREEELLALQNQQACEHAKETEQLRSQLQSIKQQHRQATEQMGKDQEANINMNQE
LQARLHTVMREKEELLQLSMERGKVLQNKQAEIRQLEEKLETAAMAKKHALERFEQEAVAVDSN
LRVRELQRKVDGIQKAYDDLRLQSEAFKKHSLDLLSKERELNAKLRHLFP

hide sequence

Ensembl Acc Id:

ENSRNOP00000064997 ⟸ ENSRNOT00000074282

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RZ86-F1-model_v2	AlphaFold	B2RZ86	1-370	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690188

Promoter ID:

EPDNEW_R713

Type:

single initiation site

Name:

LOC100911776_1

Description:

coiled-coil domain-containing protein 89-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	154,606,437 - 154,606,497	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305335	AgrOrtholog
BioCyc Gene	G2FUF-58529	BioCyc
Ensembl Genes	ENSRNOG00000022766	Ensembl
	ENSRNOG00000048071	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055019937	UniProtKB/Swiss-Prot
	ENSRNOG00060023407	UniProtKB/Swiss-Prot
	ENSRNOG00065029895	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000074282.3	UniProtKB/Swiss-Prot
	ENSRNOT00055034037	UniProtKB/Swiss-Prot
	ENSRNOT00060040508	UniProtKB/Swiss-Prot
	ENSRNOT00065051628	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7453194	IMAGE-MGC_LOAD
InterPro	CCDC89-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:293107	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:189379	IMAGE-MGC_LOAD
NCBI Gene	293107	ENTREZGENE
PANTHER	COILED-COIL DOMAIN-CONTAINING PROTEIN 89	UniProtKB/Swiss-Prot
	COILED-COIL DOMAIN-CONTAINING PROTEIN 89	UniProtKB/TrEMBL
	COILED-COIL DOMAIN-CONTAINING PROTEIN 89	UniProtKB/TrEMBL
	PTHR34768	UniProtKB/Swiss-Prot
PhenoGen	Ccdc89	PhenoGen
RatGTEx	ENSRNOG00000022766	RatGTEx
	ENSRNOG00000048071	RatGTEx
	ENSRNOG00055019937	RatGTEx
	ENSRNOG00060023407	RatGTEx
	ENSRNOG00065029895	RatGTEx
UniProt	A6I635	ENTREZGENE, UniProtKB/TrEMBL
	B2RZ86	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Ccdc89	coiled-coil domain containing 89	RGD1305335_predicted	similar to hypothetical protein (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1305335_predicted	similar to hypothetical protein (predicted)	LOC293107_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC293107_predicted	similar to hypothetical protein (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar