Symbol:
Bzw1
Name:
basic leucine zipper and W2 domains 1
RGD ID:
735129
Description:
Predicted to be involved in regulation of translational initiation. Predicted to be active in cytoplasm. Orthologous to human BZW1 (basic leucine zipper and W2 domains 1); INTERACTS WITH 17beta-estradiol; 2,6-dinitrotoluene; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
basic leucine zipper and W2 domain-containing protein 1; eIF5-mimic protein 2; MGC73015
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 67,424,860 - 67,438,656 (+) NCBI GRCr8 mRatBN7.2 9 59,930,672 - 59,944,468 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 59,930,744 - 59,944,430 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 68,423,960 - 68,435,936 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 73,539,889 - 73,551,866 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 71,857,964 - 71,869,940 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 65,279,675 - 65,293,471 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 65,279,675 - 65,291,651 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 65,086,973 - 65,100,762 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 57,053,423 - 57,065,699 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 57,200,404 - 57,212,681 (+) NCBI Celera 9 57,373,337 - 57,385,338 (+) NCBI Celera Cytogenetic Map 9 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bzw1 Rat 1,2-dimethylhydrazine multiple interactions ISO Bzw1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of BZW1 mRNA CTD PMID:22206623 Bzw1 Rat 1,2-dimethylhydrazine affects expression ISO Bzw1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of BZW1 mRNA CTD PMID:22206623 Bzw1 Rat 17alpha-ethynylestradiol affects expression ISO Bzw1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of BZW1 mRNA CTD PMID:17555576 Bzw1 Rat 17alpha-ethynylestradiol multiple interactions ISO Bzw1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BZW1 mRNA CTD PMID:17942748 Bzw1 Rat 17alpha-ethynylestradiol increases expression ISO Bzw1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of BZW1 mRNA CTD PMID:17942748 Bzw1 Rat 17beta-estradiol affects expression ISO BZW1 (Homo sapiens) 6480464 Estradiol affects the expression of BZW1 mRNA CTD PMID:22574217 Bzw1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of BZW1 mRNA CTD PMID:26496021 Bzw1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO BZW1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Bzw1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Bzw1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BZW1 mRNA CTD PMID:17942748 Bzw1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO BZW1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of BZW1 mRNA CTD PMID:22574217 Bzw1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Bzw1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BZW1 mRNA CTD PMID:21570461 Bzw1 Rat 2,4,6-tribromophenol decreases expression ISO BZW1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Bzw1 Rat 2,6-dimethoxyphenol multiple interactions ISO BZW1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Bzw1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of BZW1 mRNA CTD PMID:21346803 Bzw1 Rat 2-acetamidofluorene increases expression ISO Bzw1 (Mus musculus) 6480464 2-Acetylaminofluorene results in increased expression of BZW1 mRNA CTD PMID:17317680 Bzw1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO BZW1 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of BZW1 protein CTD PMID:31675489 Bzw1 Rat 4,4'-diaminodiphenylmethane increases expression ISO Bzw1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of BZW1 mRNA CTD PMID:18648102 Bzw1 Rat 4,4'-sulfonyldiphenol increases expression ISO Bzw1 (Mus musculus) 6480464 bisphenol S results in increased expression of BZW1 mRNA CTD PMID:31881267 and PMID:39298647 Bzw1 Rat 4,4'-sulfonyldiphenol increases expression ISO BZW1 (Homo sapiens) 6480464 bisphenol S results in increased expression of BZW1 protein CTD PMID:34186270 Bzw1 Rat 4-hydroxynon-2-enal increases expression ISO Bzw1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of BZW1 mRNA CTD PMID:19191707 Bzw1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of BZW1 mRNA CTD PMID:30047161 Bzw1 Rat acetylsalicylic acid increases expression ISO BZW1 (Homo sapiens) 6480464 Aspirin results in increased expression of BZW1 mRNA CTD PMID:15928584 Bzw1 Rat acrolein multiple interactions ISO BZW1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of BZW1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of BZW1 mRNA CTD PMID:32699268 Bzw1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of BZW1 mRNA CTD PMID:28959563 Bzw1 Rat aflatoxin B1 increases expression ISO Bzw1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of BZW1 mRNA CTD PMID:19770486 Bzw1 Rat all-trans-retinoic acid decreases expression ISO Bzw1 (Mus musculus) 6480464 Tretinoin results in decreased expression of BZW1 mRNA CTD PMID:16169686 Bzw1 Rat alpha-pinene multiple interactions ISO BZW1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of BZW1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of BZW1 mRNA CTD PMID:32699268 Bzw1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of BZW1 mRNA CTD PMID:30047161 Bzw1 Rat antirheumatic drug decreases expression ISO BZW1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of BZW1 mRNA CTD PMID:24449571 Bzw1 Rat arsenous acid increases expression ISO BZW1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of BZW1 mRNA CTD PMID:22521957 Bzw1 Rat benzo[a]pyrene increases expression ISO Bzw1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of BZW1 mRNA CTD PMID:22228805 Bzw1 Rat beta-lapachone increases expression ISO BZW1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of BZW1 mRNA CTD PMID:38218311 Bzw1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Bzw1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of BZW1 mRNA CTD PMID:39150890 Bzw1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Bzw1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of BZW1 mRNA CTD PMID:33754040 Bzw1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of BZW1 mRNA CTD PMID:26496021 Bzw1 Rat bisphenol A increases expression ISO BZW1 (Homo sapiens) 6480464 bisphenol A results in increased expression of BZW1 protein CTD PMID:34186270 Bzw1 Rat bisphenol A decreases expression ISO BZW1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of BZW1 mRNA and bisphenol A results in decreased expression of BZW1 protein CTD PMID:29275510 more ... Bzw1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BZW1 mRNA CTD PMID:25181051 Bzw1 Rat bisphenol AF increases expression ISO BZW1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of BZW1 protein CTD PMID:34186270 Bzw1 Rat Bisphenol B increases expression ISO BZW1 (Homo sapiens) 6480464 bisphenol B results in increased expression of BZW1 protein CTD PMID:34186270 Bzw1 Rat Butylbenzyl phthalate multiple interactions ISO Bzw1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of BZW1 mRNA CTD PMID:39150890 Bzw1 Rat cadmium atom multiple interactions ISO BZW1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of BZW1 mRNA CTD PMID:35301059 Bzw1 Rat cadmium dichloride multiple interactions ISO BZW1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of BZW1 mRNA CTD PMID:35301059 Bzw1 Rat carbon nanotube increases expression ISO Bzw1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Bzw1 Rat CGP 52608 multiple interactions ISO BZW1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BZW1 gene] CTD PMID:28238834 Bzw1 Rat choline multiple interactions ISO Bzw1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of BZW1 gene CTD PMID:20938992 Bzw1 Rat chromium(6+) affects expression ISO Bzw1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of BZW1 mRNA CTD PMID:28472532 Bzw1 Rat clozapine increases expression ISO BZW1 (Homo sapiens) 6480464 Clozapine results in increased expression of BZW1 protein CTD PMID:34122009 Bzw1 Rat copper(II) sulfate increases expression ISO BZW1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of BZW1 mRNA CTD PMID:19549813 Bzw1 Rat decabromodiphenyl ether decreases expression ISO BZW1 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of BZW1 protein CTD PMID:31675489 Bzw1 Rat deguelin decreases expression ISO BZW1 (Homo sapiens) 6480464 deguelin results in decreased expression of BZW1 mRNA CTD PMID:33512557 Bzw1 Rat diarsenic trioxide increases expression ISO BZW1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of BZW1 mRNA CTD PMID:22521957 Bzw1 Rat diazinon increases methylation ISO BZW1 (Homo sapiens) 6480464 Diazinon results in increased methylation of BZW1 gene CTD PMID:22964155 Bzw1 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of BZW1 mRNA CTD PMID:22546817 Bzw1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of BZW1 mRNA CTD PMID:21266533 Bzw1 Rat dibutyl phthalate multiple interactions ISO Bzw1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of BZW1 mRNA CTD PMID:39150890 Bzw1 Rat dicrotophos decreases expression ISO BZW1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of BZW1 mRNA CTD PMID:28302478 Bzw1 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of BZW1 mRNA CTD PMID:22546817 Bzw1 Rat diethyl phthalate multiple interactions ISO Bzw1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of BZW1 mRNA CTD PMID:39150890 Bzw1 Rat diisobutyl phthalate multiple interactions ISO Bzw1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of BZW1 mRNA CTD PMID:39150890 Bzw1 Rat diisononyl phthalate multiple interactions ISO Bzw1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of BZW1 mRNA CTD PMID:39150890 Bzw1 Rat dioxygen multiple interactions ISO Bzw1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of BZW1 mRNA CTD PMID:30529165 Bzw1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of BZW1 mRNA CTD PMID:21551480 Bzw1 Rat doxorubicin increases expression ISO BZW1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of BZW1 mRNA CTD PMID:29803840 Bzw1 Rat ethanol affects splicing ISO Bzw1 (Mus musculus) 6480464 Ethanol affects the splicing of BZW1 mRNA CTD PMID:30319688 Bzw1 Rat fenpyroximate decreases expression ISO BZW1 (Homo sapiens) 6480464 fenpyroximate results in decreased expression of BZW1 mRNA CTD PMID:33512557 Bzw1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of BZW1 mRNA CTD PMID:24136188 Bzw1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of BZW1 mRNA CTD PMID:24136188 Bzw1 Rat folic acid multiple interactions ISO Bzw1 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Bzw1 Rat folic acid decreases expression ISO Bzw1 (Mus musculus) 6480464 Folic Acid results in decreased expression of BZW1 mRNA CTD PMID:25629700 Bzw1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of BZW1 gene CTD PMID:22079235 Bzw1 Rat furfural multiple interactions ISO BZW1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Bzw1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of BZW1 mRNA CTD PMID:22061828 Bzw1 Rat hypochlorous acid increases expression ISO Bzw1 (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of BZW1 mRNA CTD PMID:19376150 Bzw1 Rat ivermectin decreases expression ISO BZW1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of BZW1 protein CTD PMID:32959892 Bzw1 Rat L-methionine multiple interactions ISO Bzw1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of BZW1 gene CTD PMID:20938992 Bzw1 Rat lipopolysaccharide multiple interactions ISO BZW1 (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with resveratrol] results in decreased expression of BZW1 mRNA CTD PMID:26667767 Bzw1 Rat methidathion increases expression ISO Bzw1 (Mus musculus) 6480464 methidathion results in increased expression of BZW1 mRNA CTD PMID:34813904 Bzw1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of BZW1 mRNA CTD PMID:30047161 Bzw1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of BZW1 mRNA CTD PMID:24136188 Bzw1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of BZW1 mRNA CTD PMID:22546817 Bzw1 Rat nitrates multiple interactions ISO Bzw1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of BZW1 mRNA CTD PMID:35964746 Bzw1 Rat okadaic acid increases expression ISO BZW1 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of BZW1 mRNA CTD PMID:38832940 Bzw1 Rat ozone increases expression ISO Bzw1 (Mus musculus) 6480464 Ozone results in increased expression of BZW1 mRNA CTD PMID:19555225 Bzw1 Rat ozone multiple interactions ISO BZW1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of BZW1 mRNA more ... CTD PMID:32699268 Bzw1 Rat paracetamol affects expression ISO Bzw1 (Mus musculus) 6480464 Acetaminophen affects the expression of BZW1 mRNA CTD PMID:17562736 Bzw1 Rat picoxystrobin decreases expression ISO BZW1 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of BZW1 mRNA CTD PMID:33512557 Bzw1 Rat pioglitazone multiple interactions ISO BZW1 (Homo sapiens) 6480464 [pioglitazone co-treated with tert-Butylhydroperoxide] results in increased expression of BZW1 mRNA and pioglitazone inhibits the reaction [tert-Butylhydroperoxide results in increased expression of BZW1 mRNA] CTD PMID:20847119 Bzw1 Rat resveratrol multiple interactions ISO BZW1 (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with resveratrol] results in decreased expression of BZW1 mRNA CTD PMID:26667767 Bzw1 Rat rimonabant multiple interactions ISO Bzw1 (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of BZW1 mRNA] CTD PMID:19030233 Bzw1 Rat rotenone decreases expression ISO BZW1 (Homo sapiens) 6480464 Rotenone results in decreased expression of BZW1 mRNA CTD PMID:33512557 Bzw1 Rat sodium arsenate increases expression ISO Bzw1 (Mus musculus) 6480464 sodium arsenate results in increased expression of BZW1 mRNA CTD PMID:21795629 Bzw1 Rat sodium arsenite affects methylation ISO BZW1 (Homo sapiens) 6480464 sodium arsenite affects the methylation of BZW1 gene CTD PMID:28589171 Bzw1 Rat sodium arsenite decreases expression ISO BZW1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of BZW1 protein CTD PMID:30528433 Bzw1 Rat sodium arsenite increases expression ISO BZW1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of BZW1 mRNA CTD PMID:38568856 Bzw1 Rat sodium chloride multiple interactions ISO BZW1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of BZW1 protein more ... CTD PMID:38598786 Bzw1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of BZW1 mRNA CTD PMID:19281266 Bzw1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of BZW1 mRNA CTD PMID:30047161 Bzw1 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of BZW1 mRNA CTD PMID:24136188 Bzw1 Rat tamoxifen affects expression ISO Bzw1 (Mus musculus) 6480464 Tamoxifen affects the expression of BZW1 mRNA CTD PMID:17555576 Bzw1 Rat tebufenpyrad decreases expression ISO BZW1 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of BZW1 mRNA CTD PMID:33512557 Bzw1 Rat tert-butyl hydroperoxide multiple interactions ISO BZW1 (Homo sapiens) 6480464 [pioglitazone co-treated with tert-Butylhydroperoxide] results in increased expression of BZW1 mRNA more ... CTD PMID:20847119 Bzw1 Rat tert-butyl hydroperoxide increases expression ISO BZW1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of BZW1 mRNA CTD PMID:20847119 Bzw1 Rat testosterone decreases expression ISO BZW1 (Homo sapiens) 6480464 Testosterone results in decreased expression of BZW1 mRNA CTD PMID:33359661 Bzw1 Rat tetrachloromethane increases expression ISO Bzw1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of BZW1 mRNA CTD PMID:27339419 and PMID:31919559 Bzw1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of BZW1 mRNA CTD PMID:31150632 Bzw1 Rat tetrahydropalmatine decreases expression ISO BZW1 (Homo sapiens) 6480464 tetrahydropalmatine results in decreased expression of BZW1 protein CTD PMID:20109541 Bzw1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of BZW1 mRNA CTD PMID:34492290 Bzw1 Rat titanium dioxide decreases methylation ISO Bzw1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of BZW1 gene and titanium dioxide results in decreased methylation of BZW1 promoter CTD PMID:35295148 Bzw1 Rat titanium dioxide increases methylation ISO Bzw1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of BZW1 gene CTD PMID:35295148 Bzw1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of BZW1 mRNA CTD PMID:33387578 Bzw1 Rat trimellitic anhydride increases expression ISO Bzw1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of BZW1 mRNA CTD PMID:19042947 Bzw1 Rat troglitazone multiple interactions ISO BZW1 (Homo sapiens) 6480464 troglitazone inhibits the reaction [tert-Butylhydroperoxide results in increased expression of BZW1 mRNA] CTD PMID:20847119 Bzw1 Rat valproic acid increases expression ISO BZW1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of BZW1 mRNA CTD PMID:23179753 Bzw1 Rat valproic acid decreases methylation ISO BZW1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of BZW1 gene CTD PMID:29154799
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-acetamidofluorene (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) acetylsalicylic acid (ISO) acrolein (ISO) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amitrole (EXP) antirheumatic drug (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) chromium(6+) (ISO) clozapine (ISO) copper(II) sulfate (ISO) decabromodiphenyl ether (ISO) deguelin (ISO) diarsenic trioxide (ISO) diazinon (EXP,ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) dieldrin (EXP) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (ISO) diuron (EXP) doxorubicin (ISO) ethanol (ISO) fenpyroximate (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) furan (EXP) furfural (ISO) gentamycin (EXP) hypochlorous acid (ISO) ivermectin (ISO) L-methionine (ISO) lipopolysaccharide (ISO) methidathion (ISO) methimazole (EXP) nefazodone (EXP) nickel dichloride (EXP) nitrates (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (ISO) picoxystrobin (ISO) pioglitazone (ISO) resveratrol (ISO) rimonabant (ISO) rotenone (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) Soman (EXP) sulfadimethoxine (EXP) sulindac (EXP) tamoxifen (ISO) tebufenpyrad (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) tetrahydropalmatine (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) troglitazone (ISO) valproic acid (ISO)
Bzw1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 67,424,860 - 67,438,656 (+) NCBI GRCr8 mRatBN7.2 9 59,930,672 - 59,944,468 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 59,930,744 - 59,944,430 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 68,423,960 - 68,435,936 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 73,539,889 - 73,551,866 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 71,857,964 - 71,869,940 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 65,279,675 - 65,293,471 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 65,279,675 - 65,291,651 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 65,086,973 - 65,100,762 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 57,053,423 - 57,065,699 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 57,200,404 - 57,212,681 (+) NCBI Celera 9 57,373,337 - 57,385,338 (+) NCBI Celera Cytogenetic Map 9 q31 NCBI
BZW1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 200,811,589 - 200,827,338 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 200,810,594 - 200,827,338 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 201,676,312 - 201,692,061 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 201,384,892 - 201,396,805 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 201,502,152 - 201,514,065 NCBI Celera 2 195,431,568 - 195,443,290 (+) NCBI Celera Cytogenetic Map 2 q33.1 NCBI HuRef 2 193,527,794 - 193,540,092 (+) NCBI HuRef CHM1_1 2 201,682,306 - 201,694,606 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 201,295,023 - 201,310,790 (+) NCBI T2T-CHM13v2.0
Bzw1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 58,432,057 - 58,446,513 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 58,432,057 - 58,446,512 (+) Ensembl GRCm39 Ensembl GRCm38 1 58,392,898 - 58,407,354 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 58,392,898 - 58,407,353 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 58,449,980 - 58,463,392 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 58,337,682 - 58,351,094 (+) NCBI MGSCv36 mm8 Celera 1 58,912,534 - 58,924,908 (+) NCBI Celera Cytogenetic Map 1 C1.3 NCBI cM Map 1 29.09 NCBI
Bzw1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 673,863 - 688,353 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 676,384 - 688,353 (-) NCBI ChiLan1.0 ChiLan1.0
BZW1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 103,436,638 - 103,448,951 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 103,451,638 - 103,463,945 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 88,067,041 - 88,079,647 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 206,225,963 - 206,238,587 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 206,225,963 - 206,238,587 (+) Ensembl panpan1.1 panPan2
BZW1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 37 10,005,137 - 10,021,442 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 37 10,005,183 - 10,017,448 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 37 10,890,337 - 10,906,641 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 37 9,910,555 - 9,926,864 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 37 9,910,594 - 9,926,914 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 37 9,892,074 - 9,908,376 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 37 9,869,916 - 9,886,220 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 37 9,863,787 - 9,880,092 (+) NCBI UU_Cfam_GSD_1.0
Bzw1
BZW1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 104,525,451 - 104,543,783 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 104,525,900 - 104,543,795 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 115,734,058 - 115,749,664 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BZW1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 86,462,931 - 86,475,381 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 86,463,010 - 86,473,740 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 112,942,630 - 112,955,116 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bzw1
.
Predicted Target Of
Count of predictions: 154 Count of miRNA genes: 107 Interacting mature miRNAs: 127 Transcripts: ENSRNOT00000019486 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7411571 Bw138 Body weight QTL 138 14.3 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 9 32535505 77535505 Rat 1300180 Bw14 Body weight QTL 14 3.776 body mass (VT:0001259) body weight (CMO:0000012) 9 23754024 61381613 Rat 11353957 Bmd92 Bone mineral density QTL 92 0.01 tibia mineral mass (VT:1000283) volumetric bone mineral density (CMO:0001553) 9 46114199 91114199 Rat 631680 Cm11 Cardiac mass QTL 11 3.1 0.00089 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 9 20430519 65430519 Rat 70218 Cm28 Cardiac mass QTL 28 8.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 25268044 79271759 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 1578760 Cm53 Cardiac mass QTL 53 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 56771635 101771635 Rat 631643 Bp120 Blood pressure QTL 120 3 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 22071200 67071200 Rat 12879506 Pur33 Proteinuria QTL 33 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 44649921 89649921 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 1598849 Memor17 Memory QTL 17 2.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) 9 49968546 71098346 Rat 10058949 Gmadr5 Adrenal mass QTL 5 2 0.014 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 9 42791513 87976209 Rat 631656 Bp108 Blood pressure QTL 108 5.97 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 48598251 93598251 Rat 2303170 Bp332 Blood pressure QTL 332 3.73 0.027 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 55847841 77026453 Rat 8662828 Vetf6 Vascular elastic tissue fragility QTL 6 3.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 9 36962359 92058970 Rat 61352 Bp34 Blood pressure QTL 34 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 42495343 79271511 Rat 724515 Uae16 Urinary albumin excretion QTL 16 8 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 58163035 100929646 Rat 1598834 Memor11 Memory QTL 11 2.5 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 9 36962359 77814038 Rat 70186 Niddm26 Non-insulin dependent diabetes mellitus QTL 26 3.87 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 9 22071169 86369743 Rat 7207814 Bmd91 Bone mineral density QTL 91 3.5 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 9 23754144 83851531 Rat 6903941 Pur31 Proteinuria QTL 31 0.036 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 9 40194188 85194188 Rat 2303180 Bp333 Blood pressure QTL 333 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 56627713 78595166 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 11353949 Bp393 Blood pressure QTL 393 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 40194188 85194188 Rat 11353951 Bp394 Blood pressure QTL 394 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 44649921 89649921 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 7411656 Foco26 Food consumption QTL 26 9.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 32535505 77535505 Rat 1641894 Alcrsp12 Alcohol response QTL 12 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 27468639 72468639 Rat
RH130691
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 59,942,369 - 59,942,549 (+) MAPPER mRatBN7.2 Rnor_6.0 9 65,291,373 - 65,291,552 NCBI Rnor6.0 Rnor_5.0 9 65,098,664 - 65,098,843 UniSTS Rnor5.0 RGSC_v3.4 9 57,065,421 - 57,065,600 UniSTS RGSC3.4 Celera 9 57,385,060 - 57,385,239 UniSTS RH 3.4 Map 9 484.0 UniSTS Cytogenetic Map 9 q31 UniSTS
RH143071
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 9 67,426,086 - 67,426,371 (+) Marker Load Pipeline mRatBN7.2 9 59,931,898 - 59,932,183 (+) MAPPER mRatBN7.2 Rnor_6.0 9 65,280,902 - 65,281,186 NCBI Rnor6.0 Rnor_5.0 9 65,088,193 - 65,088,477 UniSTS Rnor5.0 RGSC_v3.4 9 57,054,950 - 57,055,234 UniSTS RGSC3.4 Celera 9 57,374,590 - 57,374,874 UniSTS RH 3.4 Map 9 482.6 UniSTS Cytogenetic Map 9 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019486 ⟹ ENSRNOP00000019486
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 59,930,744 - 59,944,430 (+) Ensembl Rnor_6.0 Ensembl 9 65,279,675 - 65,291,651 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111038 ⟹ ENSRNOP00000086662
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 59,931,073 - 59,944,430 (+) Ensembl
RefSeq Acc Id:
NM_198789 ⟹ NP_942084
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 67,424,860 - 67,436,836 (+) NCBI mRatBN7.2 9 59,930,672 - 59,942,648 (+) NCBI Rnor_6.0 9 65,279,675 - 65,291,651 (+) NCBI Rnor_5.0 9 65,086,973 - 65,100,762 (+) NCBI RGSC_v3.4 9 57,053,423 - 57,065,699 (+) RGD Celera 9 57,373,337 - 57,385,338 (+) RGD
Sequence:
CGCGTTAGTTCCGGTCGCAGAGGAGACAGCGCCGCAGTTGCCGCCAGCTCGGGAATTTCTGGCTCTTTTCTCTTCGCCTTAAATTCGGGTGTCTTTTATGAATAATCAAAAGCAGCAAAAACCAACGC
hide sequence
RefSeq Acc Id:
XM_006245000 ⟹ XP_006245062
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 67,425,217 - 67,438,656 (+) NCBI mRatBN7.2 9 59,931,036 - 59,943,379 (+) NCBI Rnor_6.0 9 65,280,070 - 65,293,471 (+) NCBI Rnor_5.0 9 65,086,973 - 65,100,762 (+) NCBI
Sequence:
CGGGAGGGCGGGCGGATGTACGGGGCGGCGGGGGCCCCGGCGCGCAGCGCCTCGGCGCCTGTGG
hide sequence
RefSeq Acc Id:
XM_017596516 ⟹ XP_017452005
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 67,429,483 - 67,438,656 (+) NCBI mRatBN7.2 9 59,935,295 - 59,944,468 (+) NCBI Rnor_6.0 9 65,284,298 - 65,293,471 (+) NCBI
Sequence:
ATGCTTCTGGAGCAAAACTTGACTACCGCCGCTATGCAGAAACACTCTTTGACATTCTGGTGGCTGGCGGAATGCTGGCCCCAGGTTTTTAACAAGTTAATCAGGCGCTACAAATACCTGGAGAAAGG
hide sequence
RefSeq Acc Id:
NP_942084 ⟸ NM_198789
- UniProtKB:
Q6P7P5 (UniProtKB/Swiss-Prot), A6IP58 (UniProtKB/TrEMBL)
- Sequence:
MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGF
hide sequence
RefSeq Acc Id:
XP_006245062 ⟸ XM_006245000
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A479 (UniProtKB/TrEMBL)
- Sequence:
MYGAAGAPARSASAPVVRSARRPPPQATGVSFMNNQKQQKPTLSGQRFKTRKRDEKERFDPTQF
hide sequence
RefSeq Acc Id:
XP_017452005 ⟸ XM_017596516
- Peptide Label:
isoform X2
- Sequence:
MLLEQNLTTAAMQKHSLTFWWLAECWPQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGFSESERN
hide sequence
Ensembl Acc Id:
ENSRNOP00000019486 ⟸ ENSRNOT00000019486
Ensembl Acc Id:
ENSRNOP00000086662 ⟸ ENSRNOT00000111038
RGD ID: 13696686 Promoter ID: EPDNEW_R7211 Type: multiple initiation site Name: Bzw1_1 Description: basic leucine zipper and W2 domains 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 65,279,681 - 65,279,741 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Bzw1
basic leucine zipper and W2 domains 1
Symbol and Name status set to approved
1299863 APPROVED
