Advanced Search (OLGA)

Gene: Myh1 (myosin heavy chain 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Myh1 (Ensembl: Myh2)

Name:

myosin heavy chain 1 (Ensembl:myosin heavy chain 2)

RGD ID:

735061

Description:

Predicted to enable ATP hydrolysis activity and microfilament motor activity. Involved in muscle contraction. Part of muscle myosin complex. Orthologous to human MYH1 (myosin heavy chain 1); PARTICIPATES IN myocarditis pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MYHC; myosin, heavy chain 1, skeletal muscle, adult; myosin, heavy polypeptide 1, skeletal muscle, adult; type 2X myosin heavy chain

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	52,384,810 - 52,408,698 (+)	NCBI		GRCr8
mRatBN7.2	10	51,885,913 - 51,909,699 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	51,885,913 - 51,946,295 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	56,542,792 - 56,566,565 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	56,031,797 - 56,055,568 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	51,542,188 - 51,565,983 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	53,740,841 - 53,764,610 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	53,713,938 - 53,848,347 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	53,493,997 - 53,517,766 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	53,894,388 - 53,917,948 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	53,928,512 - 53,931,551 (+)	NCBI
Celera	10	51,068,765 - 51,092,552 (+)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Myh1	Rat	Congenital Muscular Dystrophy with Central Nervous System Involvement		ISO	MYH1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Muscular dystrophy more ...	ClinVar	PMID:25741868
Myh1	Rat	congenital myopathy 6		ISO	MYH1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Myopathy more ...	ClinVar	PMID:28492532
Myh1	Rat	Fukuyama congenital muscular dystrophy		ISO	MYH1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital muscular dystrophy-dystroglycanopathy with brain and eye anomalies and type A4	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Myh1	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of MYH1 mRNA]	CTD	PMID:31150632
Myh1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Myh1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of MYH1 mRNA	CTD	PMID:22206623
Myh1	Rat	17beta-estradiol	affects expression	ISO	Myh1 (Mus musculus)	6480464	Estradiol affects the expression of MYH1 mRNA	CTD	PMID:19484750
Myh1	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of MYH1 mRNA	CTD	PMID:32145629
Myh1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of MYH1 mRNA	CTD	PMID:24780913
Myh1	Rat	aconitine	increases expression	EXP		6480464	Aconitine results in increased expression of MYH1 protein	CTD	PMID:33236894
Myh1	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of MYH1 mRNA	CTD	PMID:28606764
Myh1	Rat	aldehydo-D-glucose	multiple interactions	ISO	Myh1 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of MYH1 mRNA	CTD	PMID:37567420
Myh1	Rat	all-trans-retinoic acid	multiple interactions	ISO	Myh1 (Mus musculus)	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of MYH1 mRNA	CTD	PMID:36189433
Myh1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of MYH1 mRNA	CTD	PMID:16483693
Myh1	Rat	arsane	decreases expression	ISO	Myh1 (Mus musculus)	6480464	Arsenic results in decreased expression of MYH1 mRNA and Arsenic results in decreased expression of MYH1 protein	CTD	PMID:22552367 and PMID:33124703
Myh1	Rat	arsenic atom	decreases expression	ISO	Myh1 (Mus musculus)	6480464	Arsenic results in decreased expression of MYH1 mRNA and Arsenic results in decreased expression of MYH1 protein	CTD	PMID:22552367 and PMID:33124703
Myh1	Rat	benzo[a]pyrene	affects methylation	ISO	MYH1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of MYH1 5' UTR and Benzo(a)pyrene affects the methylation of MYH1 promoter	CTD	PMID:27901495
Myh1	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	MYH1 (Homo sapiens)	6480464	7 more ...	CTD	PMID:24431215
Myh1	Rat	benzo[a]pyrene diol epoxide I	multiple interactions	ISO	MYH1 (Homo sapiens)	6480464	pyrrolidine dithiocarbamic acid inhibits the reaction [7 more ...	CTD	PMID:24431215
Myh1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Myh1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of MYH1 mRNA	CTD	PMID:28085963
Myh1	Rat	bisphenol A	affects expression	ISO	Myh1 (Mus musculus)	6480464	bisphenol A affects the expression of MYH1 mRNA	CTD	PMID:27082013
Myh1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of MYH1 mRNA	CTD	PMID:32145629
Myh1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of MYH1 mRNA	CTD	PMID:30816183 and PMID:32528016
Myh1	Rat	bisphenol A	multiple interactions	ISO	MYH1 (Homo sapiens)	6480464	[Phenolsulfonphthalein deficiency co-treated with bisphenol A deficiency] results in increased expression of MYH1 protein	CTD	PMID:31629898
Myh1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of MYH1 mRNA	CTD	PMID:25181051
Myh1	Rat	bisphenol A	multiple interactions	ISO	Myh1 (Mus musculus)	6480464	[XRCC6 gene mutant form results in increased susceptibility to potassium bromate] affects the reaction [bisphenol A affects the expression of MYH1 mRNA]	CTD	PMID:27082013
Myh1	Rat	boric acid	affects expression	ISO	MYH1 (Homo sapiens)	6480464	boric acid affects the expression of MYH1 mRNA	CTD	PMID:25637568
Myh1	Rat	cadmium atom	multiple interactions	ISO	MYH1 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MYH1 mRNA	CTD	PMID:35301059
Myh1	Rat	cadmium dichloride	multiple interactions	ISO	MYH1 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MYH1 mRNA	CTD	PMID:35301059
Myh1	Rat	carbon nanotube	decreases expression	ISO	Myh1 (Mus musculus)	6480464	Nanotubes and Carbon analog results in decreased expression of MYH1 mRNA	CTD	PMID:25620056
Myh1	Rat	carbon nanotube	increases expression	ISO	Myh1 (Mus musculus)	6480464	Nanotubes and Carbon results in increased expression of MYH1 mRNA	CTD	PMID:25620056
Myh1	Rat	CGP 52608	multiple interactions	ISO	MYH1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to MYH1 gene]	CTD	PMID:28238834
Myh1	Rat	chlorpyrifos	increases expression	EXP		6480464	Chlorpyrifos results in increased expression of MYH1 mRNA	CTD	PMID:32289335
Myh1	Rat	chlorpyrifos	multiple interactions	EXP		6480464	[Chlorpyrifos co-treated with Dietary Fats] results in increased expression of MYH1 mRNA	CTD	PMID:32289335
Myh1	Rat	chromium(6+)	decreases expression	ISO	Myh1 (Mus musculus)	6480464	chromium hexavalent ion results in decreased expression of MYH1 protein	CTD	PMID:22552367
Myh1	Rat	chrysene	increases expression	ISO	Myh1 (Mus musculus)	6480464	chrysene results in increased expression of MYH1 mRNA	CTD	PMID:26377693
Myh1	Rat	ciguatoxin CTX1B	affects expression	ISO	Myh1 (Mus musculus)	6480464	Ciguatoxins affects the expression of MYH1 mRNA	CTD	PMID:18353800
Myh1	Rat	ciprofibrate	decreases expression	ISO	Myh1 (Mus musculus)	6480464	ciprofibrate results in decreased expression of MYH1 mRNA	CTD	PMID:12771043
Myh1	Rat	Cuprizon	affects expression	EXP		6480464	Cuprizone affects the expression of MYH1 mRNA	CTD	PMID:26577399
Myh1	Rat	curcumin	decreases expression	EXP		6480464	Curcumin results in decreased expression of MYH1 mRNA	CTD	PMID:18299980
Myh1	Rat	D-glucose	multiple interactions	ISO	Myh1 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of MYH1 mRNA	CTD	PMID:37567420
Myh1	Rat	dexamethasone	increases expression	EXP		6480464	Dexamethasone results in increased expression of MYH1 mRNA	CTD	PMID:14618091
Myh1	Rat	diisononyl phthalate	increases expression	ISO	Myh1 (Mus musculus)	6480464	diisononyl phthalate results in increased expression of MYH1 mRNA	CTD	PMID:33391822
Myh1	Rat	folic acid	decreases expression	ISO	MYH1 (Homo sapiens)	6480464	Folic Acid results in decreased expression of MYH1 mRNA	CTD	PMID:21867686
Myh1	Rat	fructose	multiple interactions	ISO	Myh1 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of MYH1 mRNA	CTD	PMID:37567420
Myh1	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of MYH1 mRNA	CTD	PMID:27387713
Myh1	Rat	glucose	multiple interactions	ISO	Myh1 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of MYH1 mRNA	CTD	PMID:37567420
Myh1	Rat	glycidol	decreases expression	EXP		6480464	glycidol results in decreased expression of MYH1 mRNA	CTD	PMID:24395379 and PMID:24915197
Myh1	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	Myh1 (Mus musculus)	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of MYH1 mRNA	CTD	PMID:36189433
Myh1	Rat	N-nitrosodiethylamine	decreases expression	ISO	Myh1 (Mus musculus)	6480464	Diethylnitrosamine results in decreased expression of MYH1 mRNA	CTD	PMID:12771043
Myh1	Rat	nickel sulfate	increases expression	ISO	Myh1 (Mus musculus)	6480464	nickel sulfate results in increased expression of MYH1 mRNA	CTD	PMID:16166746
Myh1	Rat	paracetamol	decreases expression	ISO	MYH1 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of MYH1 mRNA	CTD	PMID:22230336
Myh1	Rat	phenobarbital	affects expression	ISO	Myh1 (Mus musculus)	6480464	Phenobarbital affects the expression of MYH1 mRNA	CTD	PMID:23091169
Myh1	Rat	phenol red	multiple interactions	ISO	MYH1 (Homo sapiens)	6480464	[Phenolsulfonphthalein deficiency co-treated with bisphenol A deficiency] results in increased expression of MYH1 protein	CTD	PMID:31629898
Myh1	Rat	pioglitazone	multiple interactions	ISO	Myh1 (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of MYH1 mRNA	CTD	PMID:27935865
Myh1	Rat	pirinixic acid	increases expression	ISO	Myh1 (Mus musculus)	6480464	pirinixic acid results in increased expression of MYH1 mRNA	CTD	PMID:20813756
Myh1	Rat	potassium bromate	multiple interactions	ISO	Myh1 (Mus musculus)	6480464	[XRCC6 gene mutant form results in increased susceptibility to potassium bromate] affects the reaction [bisphenol A affects the expression of MYH1 mRNA]	CTD	PMID:27082013
Myh1	Rat	progesterone	decreases expression	ISO	MYH1 (Homo sapiens)	6480464	Progesterone results in decreased expression of MYH1 mRNA	CTD	PMID:18070364
Myh1	Rat	pyrrolidine dithiocarbamate	multiple interactions	ISO	MYH1 (Homo sapiens)	6480464	pyrrolidine dithiocarbamic acid inhibits the reaction [7 more ...	CTD	PMID:24431215
Myh1	Rat	quercetin	increases expression	EXP		6480464	Quercetin results in increased expression of MYH1 mRNA	CTD	PMID:23117658
Myh1	Rat	quercetin	multiple interactions	EXP		6480464	[Warfarin co-treated with Vitamin K co-treated with Quercetin] results in increased expression of MYH1 mRNA	CTD	PMID:23117658
Myh1	Rat	sodium fluoride	increases expression	ISO	Myh1 (Mus musculus)	6480464	Sodium Fluoride results in increased expression of MYH1 protein	CTD	PMID:28918527
Myh1	Rat	spermine	increases expression	ISO	Myh1 (Mus musculus)	6480464	Spermine results in increased expression of MYH1 mRNA	CTD	PMID:18673383
Myh1	Rat	testosterone	affects expression	ISO	Myh1 (Mus musculus)	6480464	Testosterone deficiency affects the expression of MYH1 mRNA	CTD	PMID:21045173
Myh1	Rat	testosterone	multiple interactions	ISO	Myh1 (Mus musculus)	6480464	Testosterone affects the reaction [Testosterone deficiency affects the expression of MYH1 mRNA]	CTD	PMID:21045173
Myh1	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of MYH1 mRNA]	CTD	PMID:31150632
Myh1	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of MYH1 mRNA	CTD	PMID:31150632
Myh1	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of MYH1 mRNA	CTD	PMID:33387578
Myh1	Rat	Triptolide	decreases expression	ISO	Myh1 (Mus musculus)	6480464	triptolide results in decreased expression of MYH1 mRNA	CTD	PMID:32061799
Myh1	Rat	vitamin K	multiple interactions	EXP		6480464	[Warfarin co-treated with Vitamin K co-treated with Quercetin] results in increased expression of MYH1 mRNA	CTD	PMID:23117658
Myh1	Rat	warfarin	multiple interactions	EXP		6480464	[Warfarin co-treated with Vitamin K co-treated with Quercetin] results in increased expression of MYH1 mRNA	CTD	PMID:23117658
Myh1	Rat	zinc atom	decreases expression	ISO	Myh1 (Mus musculus)	6480464	Zinc deficiency results in decreased expression of MYH1 mRNA	CTD	PMID:20857495
Myh1	Rat	zinc(0)	decreases expression	ISO	Myh1 (Mus musculus)	6480464	Zinc deficiency results in decreased expression of MYH1 mRNA	CTD	PMID:20857495

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Myh1	Rat	muscle contraction		IDA		1599030		RGD
Myh1	Rat	striated muscle contraction		TAS		1302818		RGD

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Myh1	Rat	A band	located_in	ISO	Myh1 (Mus musculus)	1624291	PMID:18761673	RGD	PMID:18761673
Myh1	Rat	cytoplasmic ribonucleoprotein granule	located_in	ISO	MYH1 (Homo sapiens)	1624291	PMID:15121898	RGD	PMID:15121898
Myh1	Rat	intercalated disc	located_in	ISO	Myh1 (Mus musculus)	1624291	PMID:11732910	RGD	PMID:11732910
Myh1	Rat	muscle myosin complex		IDA		1302818		RGD
Myh1	Rat	muscle myosin complex	part_of	ISO	MYH1 (Homo sapiens)	1624291	PMID:18310078	RGD	PMID:18310078
Myh1	Rat	myosin filament	located_in	IEA	UniProtKB-KW:KW-0787	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Myh1	Rat	actin filament binding	enables	IEA	InterPro:IPR008989	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Myh1	Rat	ATP binding	enables	IEA	UniRule:UR000686469	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Myh1	Rat	ATP hydrolysis activity		TAS		1302818		RGD
Myh1	Rat	calmodulin binding	enables	IEA	UniProtKB-KW:KW-0112	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Myh1	Rat	microfilament motor activity		TAS		1302818		RGD
Myh1	Rat	protein binding	enables	ISO	MYH1 (Homo sapiens)	1624291	UniProtKB:A1A4E9 more ...	RGD	PMID:25416956 and PMID:32296183

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Myh1	Rat	myocarditis pathway		IEA		6907045		KEGG	rno:05416

#	Reference Title	Reference Citation
1.	Coupled expression of troponin T and troponin I isoforms in single skeletal muscle fibers correlates with contractility.	Brotto MA, etal., Am J Physiol Cell Physiol. 2006 Feb;290(2):C567-76. Epub 2005 Sep 28.
2.	Type 2X-myosin heavy chain is coded by a muscle fiber type-specific and developmentally regulated gene.	DeNardi C, etal., J Cell Biol 1993 Nov;123(4):823-35.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8287498	PMID:10460968	PMID:11732910	PMID:15121898	PMID:15578571	PMID:16839454	PMID:17030512	PMID:17670891	PMID:18310078	PMID:18761673	PMID:19369448	PMID:19738937
PMID:22206666	PMID:22464481	PMID:23058369	PMID:33573052

Myh1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	52,384,810 - 52,408,698 (+)	NCBI		GRCr8
mRatBN7.2	10	51,885,913 - 51,909,699 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	51,885,913 - 51,946,295 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	56,542,792 - 56,566,565 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	56,031,797 - 56,055,568 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	51,542,188 - 51,565,983 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	53,740,841 - 53,764,610 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	53,713,938 - 53,848,347 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	53,493,997 - 53,517,766 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	53,894,388 - 53,917,948 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	53,928,512 - 53,931,551 (+)	NCBI
Celera	10	51,068,765 - 51,092,552 (+)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

MYH1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	10,492,307 - 10,518,542 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	10,492,307 - 10,518,542 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	10,395,624 - 10,421,859 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	10,336,349 - 10,362,584 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	10,336,352 - 10,360,684	NCBI
Celera	17	10,426,467 - 10,452,723 (-)	NCBI		Celera
Cytogenetic Map	17	p13.1	NCBI
HuRef	17	10,295,198 - 10,321,455 (-)	NCBI		HuRef
CHM1_1	17	10,405,462 - 10,431,716 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	10,399,791 - 10,426,053 (-)	NCBI		T2T-CHM13v2.0

Myh1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	67,090,922 - 67,115,401 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	67,090,878 - 67,115,401 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	67,200,102 - 67,224,577 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	67,200,052 - 67,224,575 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	67,013,616 - 67,038,077 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	67,016,309 - 67,040,770 (+)	NCBI		MGSCv36	mm8
Celera	11	74,138,951 - 74,163,820 (+)	NCBI		Celera
Cytogenetic Map	11	B3	NCBI
cM Map	11	40.59	NCBI

Myh1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955467	6,685,753 - 6,707,491 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955467	6,684,104 - 6,707,597 (+)	NCBI	ChiLan1.0	ChiLan1.0

MYH1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	63,230,666 - 63,257,025 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	68,041,211 - 68,067,576 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	41,134,861 - 41,161,226 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	45,882,261 - 45,908,472 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	45,882,261 - 45,908,467 (+)	Ensembl	panpan1.1		panPan2

MYH2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	34,810,791 - 34,838,177 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	34,810,921 - 34,837,904 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	34,947,344 - 34,972,447 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	34,915,611 - 34,943,047 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	34,915,741 - 34,942,730 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	34,881,239 - 34,906,337 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	34,838,682 - 34,863,782 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	35,019,632 - 35,044,733 (-)	NCBI		UU_Cfam_GSD_1.0

Myh1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	49,889,783 - 49,914,464 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936595	3,363,975 - 3,388,385 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936595	3,363,974 - 3,416,849 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MYH1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	55,225,590 - 55,249,340 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	55,225,581 - 55,251,495 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	57,965,087 - 57,984,759 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MYH1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	9,834,434 - 9,860,744 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666059	11,481,624 - 11,507,924 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Myh1
100 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	55
Count of miRNA genes:	49
Interacting mature miRNAs:	52
Transcripts:	ENSRNOT00000004295
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	35710580	68663659	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	46989699	68663659	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	51663405	75085664	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
2	11	21	68	26	29	10	19	10	81	51	60	10	28	19


RefSeq Transcripts	NM_001135158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085434	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF157005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ872906	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215376	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217583	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217866	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223843	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S68736	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004236 ⟹ ENSRNOP00000004236

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	10	53,713,938 - 53,738,031 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000004295 ⟹ ENSRNOP00000004295

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	51,885,913 - 51,909,699 (+)	Ensembl
Rnor_6.0 Ensembl	10	53,740,841 - 53,764,610 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000045718 ⟹ ENSRNOP00000046362

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	51,923,355 - 51,946,295 (+)	Ensembl
Rnor_6.0 Ensembl	10	53,778,662 - 53,801,603 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000082871 ⟹ ENSRNOP00000072943

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	51,885,913 - 51,946,295 (+)	Ensembl
Rnor_6.0 Ensembl	10	53,781,239 - 53,848,347 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085582 ⟹ ENSRNOP00000071998

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	51,885,913 - 51,909,699 (+)	Ensembl
Rnor_6.0 Ensembl	10	53,713,941 - 53,764,500 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000086599 ⟹ ENSRNOP00000071422

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	10	53,713,938 - 53,848,347 (+)	Ensembl

RefSeq Acc Id:

NM_001135158 ⟹ NP_001128630

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	52,384,912 - 52,408,698 (+)	NCBI
mRatBN7.2	10	51,885,913 - 51,909,699 (+)	NCBI
Rnor_6.0	10	53,740,841 - 53,764,610 (+)	NCBI
Rnor_5.0	10	53,493,997 - 53,517,766 (+)	NCBI
RGSC_v3.4	10	53,894,388 - 53,917,948 (+)	RGD
Celera	10	51,068,765 - 51,092,552 (+)	RGD

Sequence:

show sequence

TCTTTCCTCATAAAGCTTCAAGTTCAGACCCACGGTCGAAGTTGCATCCCTAAAGGCAGACTCTCCCACTGGGCTGCCCCCAATAGCCCGCAGCCATGAGTTCCGACGCCGAGATGGCCGTTTTCGGG
GAGGCTGCTCCTTACCTCCGGAAGTCTGAAAAGGAGCGAATCGAGGCTCAGAACAAGCCTTTTGATGCCAAGTCATCCGTGTTTGTGGTGGATGCTAAGGAGTCTTTTGTAAAAGCAACGGTGCAGAG
CAGGGAAGGGGGGAAGGTGACAGCCAAGACCGAAGGTGGCGCTACTGTAACAGTAAAAGATGATCAAGTCTTCCCCATGAACCCTCCCAAGTACGACAAGATCGAGGACATGGCCATGATGACCCACC
TCCACGAGCCTGCTGTGCTGTACAACCTCAAAGAGCGTTACGCAGCCTGGATGATCTACACCTACTCGGGCCTGTTCTGTGTCACTGTCAACCCCTACAAGTGGCTGCCAGTGTATAATGCAGAGGTG
GTGGCAGCTTACCGAGGCAAAAAGCGCCAGGAGGCCCCGCCCCACATCTTCTCTATCTCTGACAACGCCTACCAGTTCATGTTGACAGATCGGGAGAACCAGTCTATTTTGATCACCGGAGAATCTGG
GGCTGGGAAGACTGTGAACACGAAGCGTGTCATCCAGTACTTTGCAACAATTGCAGTCACTGGGGAGAAGAAGAAGGAGGAAGCACCTTCTGGCAAAATGCAGGGGACCCTGGAGGATCAAATCATCA
GTGCCAATCCTCTGCTGGAAGCCTTCGGGAATGCCAAGACCGTGAGGAATGACAACTCCTCTCGCTTTGGTAAATTCATCAGGATCCACTTTGGTACCACAGGGAAGCTGGCTTCTGCTGATATTGAA
ACATATCTTCTGGAGAAGTCTAGAGTCACCTTCCAGCTAAAAGCTGAGAGAAGCTACCATATTTTTTACCAGATCATGTCTAACAAGAAGCCAGATCTAATTGAAATGCTCCTGATCACCACCAACCC
ATACGACTACGCCTTTGTCAGTCAGGGGGAGATCACAGTGCCCAGCATTGATGACCAAGAAGAGTTGATGGCCACAGATAGTGCCATTGATATTCTGGGCTTCACTTCTGATGAAAGAGTCTCCATCT
ATAAGCTCACGGGGGCTGTGATGCATTATGGGAACATGAAGTTCAAGCAGAAGCAACGTGAGGAGCAGGCTGAGCCGGATGGCACGGAAGTGGCTGACAAGGCTGCCTATCTCCAAAATCTGAACTCT
GCTGACCTGCTCAAAGCCCTGTGTTACCCCAGGGTCAAGGTCGGCAATGAGTATGTCACCAAAGGCCAGACTGTGCAGCAGGTGTACAACGCTGTGGGTGCCCTGGCCAAAGCTGTCTACGAGAAGAT
GTTCCTTTGGATGGTCACCCGCATCAACCAGCAGCTGGACACCAAGCAGCCCAGGCAGTACTTCATCGGGGTCTTGGACATCGCTGGCTTTGAGATCTTTGATTTCAACAGCCTGGAGCAGCTGTGCA
TCAACTTCACCAACGAGAAACTGCAACAGTTTTTCAACCACCACATGTTCGTGCTGGAGCAGGAGGAGTACAAGAAGGAAGGCATCGAGTGGGAGTTCATCGACTTCGGGATGGACCTGGCGGCCTGC
ATCGAGCTCATCGAGAAGCCAATGGGCATCTTCTCCATCCTGGAAGAGGAGTGCATGTTCCCCAAAGCGACAGACACCTCCTTCAAGAACAAGCTGTATGAACAGCATCTTGGAAAGTCCAACAACTT
CCAGAAGCCCAAACCCGCCAAAGGCAAGGTTGAGGCCCACTTCTCTCTGGTGCACTATGCCGGCACCGTTGACTACAACATCGCTGGCTGGCTGGACAAGAACAAGGACCCCCTGAATGAGACCGTGG
TGGGGCTGTACCAGAAGTCTTCAATGAAAACTCTGGCTTACCTCTTCTCTGGGGCAGCAGCTGCTGCTGAAGCAGAGTCTGGTGGCGGTGGTGGAAAGAAAGGGGCAAAGAAGAAGGGTTCTTCCTTC
CAGACTGTGTCAGCTCTCTTCAGGGAGAACCTGAATAAGCTGATGACCAATCTGAGGAGCACTCACCCCCACTTTGTCCGGTGCATCATCCCCAATGAGACTAAGACGCCTGGTGCCATGGAGCACGA
ACTGGTCCTGCACCAGCTGAGGTGTAACGGGGTACTGGAAGGCATCCGCATCTGCAGGAAGGGGTTCCCCAGCAGGATCCTCTACGCAGACTTCAAGCAGAGATACAAGGTGTTAAATGCAAGTGCCA
TCCCCGAGGGACAATTCATCGATAGCAAGAAGGCTTCTGAGAAGCTCCTTGGCTCCATCGACATTGACCACACTCAGTATAAGTTTGGTCACACCAAGGTCTTTTTCAAAGCTGGTCTTCTGGGGCTC
CTAGAGGAGATGAGAGATGACAAGTTGGCCCAGCTGATTACCCGGACGCAGGCCATGTGCCGAGGGTACTTGGCAAGAGTGGAGTACCAGAAGATGGTGGAGCGAAGAGAGTCCATCTTCTGCATCCA
GTACAACGTCCGAGCCTTCATGAATGTGAAACACTGGCCCTGGATGAAGCTGTATTTCAAGATCAAACCTCTCTTGAAGAGTGCCGAGACAGAGAAGGAGATGGCCAACATGAAGGAAGAGTTTGAAA
AAACTAAAGAAAACCTTGCAAAGGCAGAGGCCAAAAGGAAAGAGCTAGAAGAAAAGATGGTGGCTCTGATGCAGGAGAAAAATGACCTGCAGCTCCAAGTTCAGTCTGAAGCAGACAGCTTGGCTGAT
GCTGAGGAAAGATGCGACCAGCTGATCAAAACCAAAATCCAGCTGGAGGCCAAAATCAAAGAGGTGACTGAGAGAGCAGAGGATGAGGAAGAGATCAACGCCGAGCTCACCGCCAAGAAGAGGAAGCT
GGAGGACGAGTGCTCAGAGCTGAAGAAAGACATCGATGACCTTGAGCTGACACTGGCCAAGGTTGAGAAGGAGAAGCACGCCACGGAGAACAAGGTGAAAAACCTCACAGAGGAGATGGCGGGCCTGG
ACGAAACCATCGCCAAGCTGACCAAGGAGAAGAAGGCCTTGCAGGAGGCCCACCAGCAGACCCTGGATGACCTGCAGGCAGAGGAGGACAAAGTCAACACCCTGACCAAAGCCAAAATCAAGCTGGAA
CAGCAAGTGGATGACCTTGAAGGCTCTCTGGAACAAGAAAAGAAAATCCGGATGGATCTTGAAAGAGCCAAGAGGAAACTCGAGGGGGACCTAAAACTGGCCCAAGAGTCCACAATGGACGTAGAAAA
TGACAAACAGCAGCTCGATGAGAAACTCAAAAAGAAAGAGTTTGAAATGAGCAACCTGCAGAGCAAGATCGAGGATGAACAGGCCCTCGGCATGCAGCTGCAGAAGAAGATCAAGGAGTTGCAGGCTC
GCATTGAGGAGCTGGAGGAGGAAATCGAGGCAGAGCGGGCCTCCAGGGCCAAAGCAGAGAAGCAGCGCTCTGACCTCTCCCGGGAACTGGAGGAGATCAGCGAGCGGCTGGAAGAAGCCGGCGGGGCC
ACTTCAGCCCAGATCGAGATGAACAAGAAGAGAGAGGCCGAGTTCCAGAAAATGCGCAGGGACCTGGAGGAGGCCACCCTGCAGCACGAAGCCACAGCAGCCACCCTGAGGAAGAAGCACGCGGACAG
CGTGGCTGAGCTCGGGGAGCAGATCGACAACCTGCAGCGGGTGAAGCAGAAGCTGGAGAAGGAGAAGAGCGAGATGAAGATGGAGATCGACGACCTCGCTAGCAACATGGAGGTCATTTCCAAATCCA
AGGGAAACCTTGAGAAGATGTGCCGCACTCTGGAGGACCAGGTGAGCGAGCTGAAGACCAAGGAGGAGGAGCAGCAGCGGCTCATCAACGAGCTGACCGCGCAGAGGGGGCGTCTGCAGACAGAGTCA
GGTGAATATTCACGCCAGCTGGATGAAAAGGATTCATTAGTTTCTCAGCTCTCCAGGGGCAAACAGGCATTCACTCAACAGATTGAGGAGCTGAAGAGGCAGCTTGAAGAGGAAGTAAAGGCCAAGAG
TGCCCTGGCTCATGCTCTTCAGTCCTCCCGCCATGACTGTGACCTTCTGCGGGAACAGTATGAAGAAGAACAGGAAGCCAAGGCTGAACTGCAGAGGGCCATGTCCAAGGCCAACAGTGAAGTGGCCC
AGTGGAGGACGAAATATGAGACGGATGCCATCCAGCGCACGGAAGAACTGGAGGAGGCCAAGAAGAAGCTGGCTCAGCGTCTGCAGGATGCTGAGGAGCACGTAGAAGCCGTGAACGCCAAGTGTGCT
TCCCTGGAGAAGACGAAGCAGAGGCTGCAGAATGAGGTGGAGGACCTCATGATTGATGTGGAGAGGACCAACGCTGCCTGTGCCGCCCTGGACAAGAAGCAGAGAAACTTCGACAAGATCCTGGCAGA
ATGGAAACAGAAGTATGAGGAAACGCATGCTGAACTTGAAGCCTCCCAGAAGGAGTCCCGCTCTCTCAGCACAGAGTTGTTCAAGATTAAGAATGCTTATGAGGAATCTTTAGACCAACTTGAAACCT
TGAAAAGGGAAAATAAGAATTTGCAACAGGAGATCTCTGACCTCACTGAACAGATTGCAGAAGGAGGGAAACGTATCCATGAACTGGAAAAAATAAAGAAGCAAATTGAGCAAGAAAAATCCGAGCTC
CAGGCTGCTTTAGAGGAAGCAGAGGCATCTCTGGAGCACGAGGAGGGAAAGATCCTGCGCATCCAGCTGGAGCTGAACCAAGTCAAGTCTGAGATCGACAGGAAGATTGCTGAGAAGGATGAGGAAAT
TGACCAGCTGAAGAGAAACCACATTCGAGTCGTGGAGTCCATGCAGAGCACGCTGGATGCCGAGATCAGGAGCAGGAATGACGCCATCAGGATCAAGAAGAAGATGGAGGGAGACCTCAATGAGATGG
AAATCCAGCTGAACCACTCCAACCGCATGGCTGCTGAGGCCCTGAGAAACTACAGGAACACCCAAGGCATCCTCAAGGACACCCAGTTGCACCTGGATGACGCTCTCCGGGGCCAGGAGGACCTGAAG
GAGCAGCTGGCCATGGTGGAGCGCAGAGCCAACCTGCTGCAGGCTGAGATCGAGGAGCTGCGGGCCACTCTGGAGCAGACTGAGAGGAGCAGGAAGATTGCAGAGCAGGAACTGCTGGACGCCAGTGA
GCGCGTGCAGCTCCTCCACACCCAGAACACCAGCCTCATCAACACCAAGAAGAAGCTGGAGACAGACATTTCCCAGATCCAGGGAGAGATGGAGGACATCGTCCAGGAAGCCCGCAATGCAGAAGAGA
AGGCCAAGAAAGCCATCACTGACGCCGCCATGATGGCGGAGGAGCTGAAGAAGGAGCAGGACACCAGCGCCCATCTGGAGCGGATGAAGAAGAACCTGGAGCAGACGGTGAAGGACCTGCAGCACCGT
CTGGACGAGGCTGAGCAGCTGGCGCTGAAGGGCGGCAAGAAGCAGATCCAGAAACTGGAGGCCAGGGTCCGTGAACTTGAAGGAGAAGTTGAAAACGAACAGAAGCGCAATGTTGAAGCTATCAAGGG
TCTGCGCAAACATGAGAGAAGAGTGAAAGAACTCACTTACCAAACTGAGGAAGACCGCAAGAACGTTCTCAGGCTCCAGGACCTTGTGGACAAACTGCAATCAAAGGTCAAAGCATACAAGAGACAAG
CCGAGGAAGCGGAGGAACAATCCAACGTCAACCTGGCCAAGTTCCGCAAGATCCAGCACGAGCTGGAGGAAGCCGAGGAGCGGGCTGACATCGCCGAGTCCCAGGTCAACAAGCTGCGGGTGAAGAGC
CGCGAGGTTCACACCAAAATCATAAGCGAAGAGTGATCGATCCAAAGCAGGAAAGTGACCAAAGAGATGAGCAAAATGTGAAGATCTTTGTCACTCCATTTTGTACTTACGACTTTGGGAGATAAAAA
ATTTATCTGCCAAGA

hide sequence

RefSeq Acc Id:

XM_039085434 ⟹ XP_038941362

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	52,384,810 - 52,408,696 (+)	NCBI
mRatBN7.2	10	51,886,199 - 51,909,592 (+)	NCBI


Protein RefSeqs	NP_001128630	(Get FASTA)	NCBI Sequence Viewer
	XP_038941362	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB29713	(Get FASTA)	NCBI Sequence Viewer
	AAD51613	(Get FASTA)	NCBI Sequence Viewer
	ABI34117	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004295.7
	ENSRNOP00000071998.2
	ENSRNOP00000072943.2

RefSeq Acc Id:

NP_001128630 ⟸ NM_001135158

- UniProtKB:

F1LRV9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSSDAEMAVFGEAAPYLRKSEKERIEAQNKPFDAKSSVFVVDAKESFVKATVQSREGGKVTAKTEGGATVTVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNP
YKWLPVYNAEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEAPSGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFG
TTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPDLIEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIDILGFTSDERVSIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVA
DKAAYLQNLNSADLLKALCYPRVKVGNEYVTKGQTVQQVYNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWE
FIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHLGKSNNFQKPKPAKGKVEAHFSLVHYAGTVDYNIAGWLDKNKDPLNETVVGLYQKSSMKTLAYLFSGAAAAAEAESGGGGG
KKGAKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHT
KVFFKAGLLGLLEEMRDDKLAQLITRTQAMCRGYLARVEYQKMVERRESIFCIQYNVRAFMNVKHWPWMKLYFKIKPLLKSAETEKEMANMKEEFEKTKENLAKAEAKRKELEEKMVALMQEKNDLQL
QVQSEADSLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKV
NTLTKAKIKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLAQESTMDVENDKQQLDEKLKKKEFEMSNLQSKIEDEQALGMQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEE
ISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNMEVISKSKGNLEKMCRTLEDQVSELKTKEEEQQRLINEL
TAQRGRLQTESGEYSRQLDEKDSLVSQLSRGKQAFTQQIEELKRQLEEEVKAKSALAHALQSSRHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAE
EHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKILAEWKQKYEETHAELEASQKESRSLSTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKI
KKQIEQEKSELQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHIRVVESMQSTLDAEIRSRNDAIRIKKKMEGDLNEMEIQLNHSNRMAAEALRNYRNTQGILKDTQLHL
DDALRGQEDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKN
LEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEVENEQKRNVEAIKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQSKVKAYKRQAEEAEEQSNVNLAKFRKIQHELEEAEERADIA
ESQVNKLRVKSREVHTKIISEE

hide sequence

Ensembl Acc Id:

ENSRNOP00000072943 ⟸ ENSRNOT00000082871

Ensembl Acc Id:

ENSRNOP00000046362 ⟸ ENSRNOT00000045718

Ensembl Acc Id:

ENSRNOP00000004295 ⟸ ENSRNOT00000004295

Ensembl Acc Id:

ENSRNOP00000004236 ⟸ ENSRNOT00000004236

Protein Domains

Myosin motor Myosin N-terminal SH3-like

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13697292

Promoter ID:

EPDNEW_R7815

Type:

multiple initiation site

Name:

Myh4_1

Description:

myosin heavy chain 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R7816

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	53,740,840 - 53,740,900	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-24656	BioCyc
Ensembl Genes	ENSRNOG00000049695	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000004295.7	UniProtKB/TrEMBL
	ENSRNOT00000082871.2	UniProtKB/TrEMBL
	ENSRNOT00000085582.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.820	UniProtKB/TrEMBL
	1.20.5.340	UniProtKB/TrEMBL
	1.20.5.370	UniProtKB/TrEMBL
	1.20.5.4820	UniProtKB/TrEMBL
	1.20.58.530	UniProtKB/TrEMBL
	2.30.30.360	UniProtKB/TrEMBL
	3.40.850.10	UniProtKB/TrEMBL
	6.10.250.2420	UniProtKB/TrEMBL
	Myosin VI head, motor domain, U50 subdomain	UniProtKB/TrEMBL
InterPro	IQ_motif_EF-hand-BS	UniProtKB/TrEMBL
	Kinesin_motor_dom_sf	UniProtKB/TrEMBL
	Myosin_head_motor_dom	UniProtKB/TrEMBL
	Myosin_N	UniProtKB/TrEMBL
	Myosin_S1_N	UniProtKB/TrEMBL
	Myosin_tail	UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/TrEMBL
	XRCC4-like_C	UniProtKB/TrEMBL
NCBI Gene	287408	ENTREZGENE
PANTHER	MYOSIN HEAVY CHAIN, NON-MUSCLE	UniProtKB/TrEMBL
	MYOSIN-1	UniProtKB/TrEMBL
	MYOSIN-4	UniProtKB/TrEMBL
Pfam	Myosin_head	UniProtKB/TrEMBL
	Myosin_N	UniProtKB/TrEMBL
	Myosin_tail_1	UniProtKB/TrEMBL
PhenoGen	Myh1	PhenoGen
PRINTS	MYOSINHEAVY	UniProtKB/TrEMBL
PROSITE	MYOSIN_MOTOR	UniProtKB/TrEMBL
	PS50096	UniProtKB/TrEMBL
	SH3_LIKE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000049695	RatGTEx
SMART	MYSc	UniProtKB/TrEMBL
	SM00015	UniProtKB/TrEMBL
Superfamily-SCOP	Myosin rod fragments	UniProtKB/TrEMBL
	SSF52540	UniProtKB/TrEMBL
	Tropomyosin	UniProtKB/TrEMBL
UniProt	A0A0G2K1V4_RAT	UniProtKB/TrEMBL
	A0A0G2K484_RAT	UniProtKB/TrEMBL
	F1LRV9	ENTREZGENE, UniProtKB/TrEMBL
	Q0GC39_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-29	Myh1	myosin heavy chain 1	Myh1	myosin, heavy chain 1, skeletal muscle, adult	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-05	Myh1	myosin, heavy chain 1, skeletal muscle, adult	Myh1	myosin, heavy polypeptide 1, skeletal muscle, adult	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Myh1	myosin, heavy polypeptide 1, skeletal muscle, adult		type 2X myosin heavy chain	Name updated	1299863	APPROVED
2004-09-10	Myh1	type 2X myosin heavy chain	MYHC		Symbol and Name updated	1299863	APPROVED

Note Type	Note	Reference
gene_expression	highly expressed in diaphram	1302818
gene_other	speed of shortening of muscle fibers expressing 2X-MyHC is intermediate between that of fibers expressing 2A-MyHC and 2B-MyHC	1302818

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)