Symbol:
Fbxo11
Name:
F-box protein 11
RGD ID:
727935
Description:
Predicted to enable protein-arginine N-methyltransferase activity; ubiquitin-like ligase-substrate adaptor activity; and ubiquitin-protein transferase activity. Involved in negative regulation of calcium ion transmembrane transport via high voltage-gated calcium channel and positive regulation of protein catabolic process. Predicted to be located in cytoplasm; nucleolus; and nucleoplasm. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in breast carcinoma and lung non-small cell carcinoma. Orthologous to human FBXO11 (F-box protein 11); PARTICIPATES IN p53 signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
F-box only protein 11; F-box only protein 11-like; LOC103689957; Vit1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FBXO11 (F-box protein 11) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Fbxo11 (F-box protein 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fbxo11 (F-box protein 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FBXO11 (F-box protein 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FBXO11 (F-box protein 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fbxo11 (F-box protein 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FBXO11 (F-box protein 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FBXO11 (F-box protein 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fbxo11 (F-box protein 11) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
FBXO11 (F-box protein 11)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Fbxo11 (F-box protein 11)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fbxo11a (F-box protein 11a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
BE0003N10.3
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
FBXO11
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
dre-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fbxo11
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 12,240,348 - 12,316,223 (+) NCBI GRCr8 mRatBN7.2 6 6,486,761 - 6,562,664 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 6,486,015 - 6,562,662 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 6,820,525 - 6,844,805 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 7,129,930 - 7,154,210 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 6,657,075 - 6,681,355 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 11,662,356 - 11,737,427 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 11,662,356 - 11,686,682 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 21,634,305 - 21,709,376 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 6 21,398,929 - 21,414,145 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 11,542,561 - 11,566,829 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 11,542,560 - 11,566,829 (-) NCBI Celera 6 6,301,914 - 6,326,193 (+) NCBI Celera Cytogenetic Map 6 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - PID (archival)
1.
miR-324-5p upregulation potentiates resistance to cisplatin by targeting FBXO11 signalling in non-small cell lung cancer cells.
Ba Z, etal., J Biochem. 2019 Dec 1;166(6):517-527. doi: 10.1093/jb/mvz066.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Modulation of Ca2+-induced Ca2+ release by ubiquitin protein ligase E3 component n-recognin UBR3 and 6 in cardiac myocytes.
Ma XE, etal., Channels (Austin). 2020 Dec;14(1):326-335. doi: 10.1080/19336950.2020.1824957.
4.
The tumor suppressive miR-26a regulation of FBXO11 inhibits proliferation, migration and invasion of hepatocellular carcinoma cells.
Ma Y, etal., Biomed Pharmacother. 2018 May;101:648-655. doi: 10.1016/j.biopha.2018.02.118. Epub 2018 Mar 22.
5.
NCBI rat LocusLink and RefSeq merged data October 15, 2003
NCBI rat LocusLink and RefSeq merged data October 15, 2003
6.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
F-box protein 11 promotes the growth and metastasis of gastric cancer via PI3K/AKT pathway-mediated EMT.
Sun C, etal., Biomed Pharmacother. 2018 Feb;98:416-423. doi: 10.1016/j.biopha.2017.12.088. Epub 2017 Dec 27.
11.
LINC01436, regulating miR-585 and FBXO11, is an oncogenic lncRNA in the progression of gastric cancer.
Zhang Y, etal., Cell Biol Int. 2020 Mar;44(3):882-893. doi: 10.1002/cbin.11287. Epub 2020 Jan 8.
12.
PKD1 phosphorylation-dependent degradation of SNAIL by SCF-FBXO11 regulates epithelial-mesenchymal transition and metastasis.
Zheng H, etal., Cancer Cell. 2014 Sep 8;26(3):358-373. doi: 10.1016/j.ccr.2014.07.022.
Fbxo11 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 12,240,348 - 12,316,223 (+) NCBI GRCr8 mRatBN7.2 6 6,486,761 - 6,562,664 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 6,486,015 - 6,562,662 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 6,820,525 - 6,844,805 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 7,129,930 - 7,154,210 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 6,657,075 - 6,681,355 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 11,662,356 - 11,737,427 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 11,662,356 - 11,686,682 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 21,634,305 - 21,709,376 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 6 21,398,929 - 21,414,145 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 11,542,561 - 11,566,829 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 11,542,560 - 11,566,829 (-) NCBI Celera 6 6,301,914 - 6,326,193 (+) NCBI Celera Cytogenetic Map 6 q12 NCBI
FBXO11 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 47,806,920 - 47,906,498 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 47,789,316 - 47,906,498 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 48,034,059 - 48,133,637 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 47,887,563 - 47,986,318 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 47,957,375 - 48,044,465 NCBI Celera 2 47,873,581 - 47,972,357 (-) NCBI Celera Cytogenetic Map 2 p16.3 NCBI HuRef 2 47,770,542 - 47,869,544 (-) NCBI HuRef CHM1_1 2 47,964,454 - 48,063,258 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 47,812,869 - 47,912,466 (-) NCBI T2T-CHM13v2.0
Fbxo11 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 88,298,287 - 88,373,473 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 88,298,287 - 88,372,719 (-) Ensembl GRCm39 Ensembl GRCm38 17 87,990,859 - 88,066,045 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 87,990,859 - 88,065,291 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 88,390,199 - 88,464,625 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 87,899,185 - 87,973,611 (-) NCBI MGSCv36 mm8 Celera 17 92,401,160 - 92,425,975 (-) NCBI Celera Cytogenetic Map 17 E4 NCBI cM Map 17 57.87 NCBI
Fbxo11 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955441 14,471,283 - 14,553,916 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955441 14,471,283 - 14,495,508 (-) NCBI ChiLan1.0 ChiLan1.0
FBXO11 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 78,478,591 - 78,577,716 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 78,482,579 - 78,582,236 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 47,926,629 - 48,026,245 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 48,849,746 - 48,948,007 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 48,830,780 - 48,886,300 (-) Ensembl panpan1.1 panPan2
FBXO11 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 49,838,003 - 49,864,211 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 49,838,776 - 49,925,064 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 49,693,555 - 49,780,653 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 50,711,840 - 50,799,252 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 50,711,894 - 50,799,655 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 50,419,057 - 50,506,412 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 50,705,887 - 50,793,282 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 50,893,652 - 50,980,961 (-) NCBI UU_Cfam_GSD_1.0
Fbxo11 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 33,194,074 - 33,280,085 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936508 4,685,595 - 4,708,694 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936508 4,622,695 - 4,708,694 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FBXO11 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 92,696,441 - 92,792,616 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 92,696,402 - 92,792,623 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 98,680,348 - 98,710,235 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FBXO11 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 59,276,380 - 59,375,635 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 59,276,447 - 59,374,442 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 52,468,631 - 52,568,736 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fbxo11
.
Predicted Target Of
Count of predictions: 104 Count of miRNA genes: 96 Interacting mature miRNAs: 99 Transcripts: ENSRNOT00000021998 Prediction methods: Miranda Result types: miRGate_prediction
8552962 Pigfal16 Plasma insulin-like growth factor 1 level QTL 16 9.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 6 1 41223769 Rat 7411603 Foco13 Food consumption QTL 13 5.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 41223769 Rat 1598843 Cm63 Cardiac mass QTL 63 2.6 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 1 39036266 Rat 738024 Sach5 Saccharine consumption QTL 5 3.9 0.00039 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 6 1 43394190 Rat 1549905 Stresp10 Stress response QTL 10 6.83 0.0066 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 6 1 27574569 Rat 7411542 Bw127 Body weight QTL 127 5.5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 1 41223769 Rat 2293706 Bmd20 Bone mineral density QTL 20 4.3 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 5074497 19988050 Rat 9589048 Scfw3 Subcutaneous fat weight QTL 3 4.57 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 6 1 41223769 Rat 1331743 Uae28 Urinary albumin excretion QTL 28 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 1 34235784 Rat 738023 Alc17 Alcohol consumption QTL 17 3.1 0.003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 6 1 27574569 Rat 1354616 Despr12 Despair related QTL 12 0.0012 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 6 1 27574569 Rat 2293709 Bss23 Bone structure and strength QTL 23 5.18 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 6 1 42487980 Rat 2293650 Bss31 Bone structure and strength QTL 31 5.05 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 6 1 42487980 Rat 7411584 Foco4 Food consumption QTL 4 4.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 42838846 Rat 2300176 Bmd51 Bone mineral density QTL 51 11.7 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 6 1 27574569 Rat 1300128 Rf16 Renal function QTL 16 3.89 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 34434305 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 1300164 Rf15 Renal function QTL 15 3.12 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 54641141 Rat 2293656 Bss28 Bone structure and strength QTL 28 6.79 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 6 1 42487980 Rat 9589129 Insul24 Insulin level QTL 24 19.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 6 1 41223769 Rat 2300190 Bmd52 Bone mineral density QTL 52 11.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 6 1 27574569 Rat 1578758 Tcas9 Tongue tumor susceptibility QTL 9 3.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 6 1 37618905 Rat
RH126790
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 6,562,426 - 6,562,642 (-) MAPPER mRatBN7.2 Rnor_6.0 6 11,662,378 - 11,662,593 NCBI Rnor6.0 Rnor_5.0 6 21,634,327 - 21,634,542 UniSTS Rnor5.0 RGSC_v3.4 6 11,542,581 - 11,542,796 UniSTS RGSC3.4 Celera 6 6,325,958 - 6,326,173 UniSTS Cytogenetic Map 6 q12 UniSTS
RH140511
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 6,562,226 - 6,562,406 (-) MAPPER mRatBN7.2 Rnor_6.0 6 11,662,614 - 11,662,793 NCBI Rnor6.0 Rnor_5.0 6 21,634,563 - 21,634,742 UniSTS Rnor5.0 RGSC_v3.4 6 11,542,817 - 11,542,996 UniSTS RGSC3.4 Celera 6 6,325,758 - 6,325,937 UniSTS Cytogenetic Map 6 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021998 ⟹ ENSRNOP00000021998
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 6,486,015 - 6,562,662 (+) Ensembl Rnor_6.0 Ensembl 6 11,662,356 - 11,686,682 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093590
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 6 11,663,240 - 11,663,788 (-) Ensembl
RefSeq Acc Id:
NM_181631 ⟹ NP_853662
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 12,291,942 - 12,316,221 (+) NCBI mRatBN7.2 6 6,538,383 - 6,562,662 (+) NCBI Rnor_6.0 6 11,662,358 - 11,686,682 (-) NCBI Rnor_5.0 6 21,634,305 - 21,709,376 (-) NCBI RGSC_v3.4 6 11,542,561 - 11,566,829 (-) RGD Celera 6 6,301,914 - 6,326,193 (+) RGD
Sequence:
GATGATGTTCCTGCAGATATGGTTGCAGAAGAATCAGGTCCTGGTGCACAAAACAGTCCATACCAGCTTCGTAGAAAAACTCTTTTGCCAAAAAGAACAGCGTGTCCTACAAAGAACAGCATGGAGGG
hide sequence
RefSeq Acc Id:
XM_017594113 ⟹ XP_017449602
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 12,240,683 - 12,316,223 (+) NCBI mRatBN7.2 6 6,487,135 - 6,562,664 (+) NCBI Rnor_6.0 6 11,662,356 - 11,737,427 (-) NCBI
Sequence:
TGCCGCGCTTTGTTTGGTTTCGGGGCCGGCACCCTCCGTCCCCACCCCTCCTCGGGGCTTCCCG
hide sequence
RefSeq Acc Id:
XM_039112126 ⟹ XP_038968054
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 12,240,348 - 12,316,223 (+) NCBI mRatBN7.2 6 6,486,761 - 6,562,664 (+) NCBI
RefSeq Acc Id:
XM_039112127 ⟹ XP_038968055
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 12,240,348 - 12,316,223 (+) NCBI mRatBN7.2 6 6,486,761 - 6,562,664 (+) NCBI
RefSeq Acc Id:
XM_063261802 ⟹ XP_063117872
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 12,240,905 - 12,316,223 (+) NCBI
RefSeq Acc Id:
NP_853662 ⟸ NM_181631
- UniProtKB:
Q7TSL3 (UniProtKB/Swiss-Prot), A6H9C5 (UniProtKB/TrEMBL)
- Sequence:
MVAEESGPGAQNSPYQLRRKTLLPKRTACPTKNSMEGASTSTTENFGHRAKRARVSGKSQDLSAAPAEQYLQEKLPDEVVLKIFSYLLEQDLCRAACVCKRFSELANDPILWKRLYMEVFEYTRPMMH
hide sequence
RefSeq Acc Id:
XP_017449602 ⟸ XM_017594113
- Peptide Label:
isoform X4
- UniProtKB:
Q7TSL3 (UniProtKB/Swiss-Prot), A6H9C5 (UniProtKB/TrEMBL)
- Sequence:
MVAEESGPGAQNSPYQLRRKTLLPKRTACPTKNSMEGASTSTTENFGHRAKRARVSGKSQDLSAAPAEQYLQEKLPDEVVLKIFSYLLEQDLCRAACVCKRFSELANDPILWKRLYMEVFEYTRPMMH
hide sequence
Ensembl Acc Id:
ENSRNOP00000021998 ⟸ ENSRNOT00000021998
RefSeq Acc Id:
XP_038968054 ⟸ XM_039112126
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QBJ7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968055 ⟸ XM_039112127
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063117872 ⟸ XM_063261802
- Peptide Label:
isoform X3
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Fbxo11
F-box protein 11
LOC103689957
F-box only protein 11-like
Data merged from RGD:9197316
737654 PROVISIONAL
2014-08-25
LOC103689957
F-box only protein 11-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-03-04
Fbxo11
F-box protein 11
Fbxo11
F-box only protein 11
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-09-30
Fbxo11
Symbol and Name status set to provisional
70820 PROVISIONAL
