Symbol:
Hnrnpl
Name:
heterogeneous nuclear ribonucleoprotein L
RGD ID:
71059
Description:
Enables mRNA 3'-UTR binding activity and mRNA CDS binding activity. Involved in several processes, including cellular response to amino acid starvation; circadian rhythm; and regulation of gene expression. Located in perinuclear region of cytoplasm. Human ortholog(s) of this gene implicated in hepatocellular carcinoma; lung cancer; and systemic scleroderma. Orthologous to human HNRNPL (heterogeneous nuclear ribonucleoprotein L); PARTICIPATES IN spliceosome pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
heterogenous nuclear ribonucleoprotein L; hnrnp-L; Hnrpl
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 93,226,373 - 93,239,084 (+) NCBI GRCr8 mRatBN7.2 1 84,098,558 - 84,111,568 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 84,100,879 - 84,111,553 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 89,510,654 - 89,521,604 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 97,969,995 - 97,980,674 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 91,266,512 - 91,277,462 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 86,994,090 - 87,006,776 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 86,996,093 - 87,006,776 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 88,174,400 - 88,187,394 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 83,919,015 - 83,929,698 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 84,005,781 - 84,007,795 (+) NCBI Celera 1 78,491,204 - 78,501,887 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hnrnpl Rat (S)-nicotine decreases expression ISO Hnrnpl (Mus musculus) 6480464 Nicotine results in decreased expression of HNRNPL mRNA CTD PMID:21955143 Hnrnpl Rat 1,2-dimethylhydrazine multiple interactions ISO Hnrnpl (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of HNRNPL mRNA CTD PMID:22206623 Hnrnpl Rat 17alpha-ethynylestradiol multiple interactions ISO Hnrnpl (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HNRNPL mRNA CTD PMID:17942748 Hnrnpl Rat 17alpha-ethynylestradiol decreases expression ISO Hnrnpl (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of HNRNPL mRNA CTD PMID:17942748 Hnrnpl Rat 17alpha-ethynylestradiol affects expression ISO Hnrnpl (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of HNRNPL mRNA CTD PMID:17555576 Hnrnpl Rat 17beta-estradiol increases expression ISO Hnrnpl (Mus musculus) 6480464 Estradiol results in increased expression of HNRNPL mRNA CTD PMID:39298647 Hnrnpl Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:21394737 Hnrnpl Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Hnrnpl (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HNRNPL mRNA CTD PMID:17942748 Hnrnpl Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HNRNPL mRNA CTD PMID:34747641 Hnrnpl Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hnrnpl (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HNRNPL mRNA CTD PMID:21570461 Hnrnpl Rat 2,6-dimethoxyphenol multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [pyrogallol 1 and 3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization of HNRNPL protein CTD PMID:38598786 Hnrnpl Rat 2-hydroxypropanoic acid increases expression ISO HNRNPL (Homo sapiens) 6480464 Lactic Acid results in increased expression of HNRNPL mRNA CTD PMID:30851411 Hnrnpl Rat 3',5'-cyclic UMP affects binding ISO HNRNPL (Homo sapiens) 6480464 HNRNPL protein binds to cyclic 3' and 5'-uridine monophosphate CTD PMID:30528433 Hnrnpl Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of HNRNPL mRNA CTD PMID:28628672 Hnrnpl Rat 4,4'-sulfonyldiphenol affects expression ISO Hnrnpl (Mus musculus) 6480464 bisphenol S affects the expression of HNRNPL mRNA CTD PMID:39298647 Hnrnpl Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HNRNPL mRNA CTD PMID:36041667 Hnrnpl Rat 4,4'-sulfonyldiphenol increases expression ISO HNRNPL (Homo sapiens) 6480464 bisphenol S results in increased expression of HNRNPL protein CTD PMID:34186270 Hnrnpl Rat 4,4'-sulfonyldiphenol decreases methylation ISO Hnrnpl (Mus musculus) 6480464 bisphenol S results in decreased methylation of HNRNPL exon CTD PMID:33297965 Hnrnpl Rat 5-fluorouracil multiple interactions ISO HNRNPL (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of HNRNPL mRNA] CTD PMID:15016801 Hnrnpl Rat acrolein multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of HNRNPL mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of HNRNPL mRNA CTD PMID:32699268 Hnrnpl Rat Aflatoxin B2 alpha decreases methylation ISO HNRNPL (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of HNRNPL intron CTD PMID:30157460 Hnrnpl Rat alpha-pinene multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of HNRNPL mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of HNRNPL mRNA CTD PMID:32699268 Hnrnpl Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HNRNPL mRNA CTD PMID:16483693 Hnrnpl Rat arsenous acid decreases expression ISO HNRNPL (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of HNRNPL protein CTD PMID:25419056 Hnrnpl Rat atrazine increases expression ISO HNRNPL (Homo sapiens) 6480464 Atrazine results in increased expression of HNRNPL mRNA CTD PMID:22378314 Hnrnpl Rat benzo[a]pyrene decreases expression ISO HNRNPL (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of HNRNPL protein CTD PMID:20097212 Hnrnpl Rat benzo[a]pyrene increases methylation ISO HNRNPL (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of HNRNPL 5' UTR CTD PMID:27901495 Hnrnpl Rat benzo[a]pyrene affects methylation ISO HNRNPL (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HNRNPL promoter CTD PMID:27901495 Hnrnpl Rat benzo[a]pyrene diol epoxide I increases expression ISO HNRNPL (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Hnrnpl Rat beta-lapachone decreases expression ISO HNRNPL (Homo sapiens) 6480464 beta-lapachone results in decreased expression of HNRNPL mRNA CTD PMID:38218311 Hnrnpl Rat bis(2-ethylhexyl) phthalate increases expression ISO Hnrnpl (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of HNRNPL mRNA CTD PMID:33754040 Hnrnpl Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HNRNPL mRNA CTD PMID:25181051 more ... Hnrnpl Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HNRNPL mRNA CTD PMID:36041667 Hnrnpl Rat bisphenol A increases expression ISO Hnrnpl (Mus musculus) 6480464 bisphenol A results in increased expression of HNRNPL mRNA CTD PMID:33221593 Hnrnpl Rat bisphenol A multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [ginger extract results in increased abundance of Oils and Volatile] inhibits the reaction [bisphenol A results in decreased expression of HNRNPL protein] CTD PMID:33376534 Hnrnpl Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HNRNPL mRNA CTD PMID:33296240 Hnrnpl Rat bisphenol A decreases expression ISO HNRNPL (Homo sapiens) 6480464 bisphenol A results in decreased expression of HNRNPL mRNA and bisphenol A results in decreased expression of HNRNPL protein CTD PMID:29275510 more ... Hnrnpl Rat bisphenol AF increases expression ISO HNRNPL (Homo sapiens) 6480464 bisphenol AF results in increased expression of HNRNPL protein CTD PMID:34186270 Hnrnpl Rat bisphenol F multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of HNRNPL mRNA CTD PMID:28628672 Hnrnpl Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HNRNPL mRNA CTD PMID:36041667 Hnrnpl Rat bisphenol F decreases expression ISO Hnrnpl (Mus musculus) 6480464 bisphenol F results in decreased expression of HNRNPL mRNA CTD PMID:38685157 Hnrnpl Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of HNRNPL protein CTD PMID:28903499 Hnrnpl Rat caffeine affects phosphorylation ISO HNRNPL (Homo sapiens) 6480464 Caffeine affects the phosphorylation of HNRNPL protein CTD PMID:35688186 Hnrnpl Rat carbamazepine affects expression ISO HNRNPL (Homo sapiens) 6480464 Carbamazepine affects the expression of HNRNPL mRNA CTD PMID:25979313 Hnrnpl Rat carbon nanotube affects expression ISO HNRNPL (Homo sapiens) 6480464 Nanotubes and Carbon affects the expression of HNRNPL protein CTD PMID:22001959 Hnrnpl Rat chloroprene decreases expression ISO Hnrnpl (Mus musculus) 6480464 Chloroprene results in decreased expression of HNRNPL mRNA CTD PMID:23125180 Hnrnpl Rat cisplatin multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [Piroxicam co-treated with Cisplatin] results in increased expression of HNRNPL mRNA CTD PMID:21858171 Hnrnpl Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of HNRNPL mRNA CTD PMID:17602206 Hnrnpl Rat copper atom affects binding ISO HNRNPL (Homo sapiens) 6480464 HNRNPL protein binds to Copper CTD PMID:15359738 Hnrnpl Rat copper(0) affects binding ISO HNRNPL (Homo sapiens) 6480464 HNRNPL protein binds to Copper CTD PMID:15359738 Hnrnpl Rat coumarin decreases phosphorylation ISO HNRNPL (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of HNRNPL protein CTD PMID:35688186 Hnrnpl Rat CU-O LINKAGE decreases expression ISO HNRNPL (Homo sapiens) 6480464 cupric oxide results in decreased expression of HNRNPL protein CTD PMID:25470785 Hnrnpl Rat dexamethasone multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of HNRNPL mRNA CTD PMID:28628672 Hnrnpl Rat diarsenic trioxide decreases expression ISO HNRNPL (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of HNRNPL protein CTD PMID:25419056 Hnrnpl Rat diazinon increases methylation ISO HNRNPL (Homo sapiens) 6480464 Diazinon results in increased methylation of HNRNPL gene CTD PMID:22964155 Hnrnpl Rat Dibutyl phosphate affects expression ISO HNRNPL (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of HNRNPL mRNA CTD PMID:37042841 Hnrnpl Rat dioxygen multiple interactions ISO Hnrnpl (Mus musculus) 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency] results in decreased expression of HNRNPL protein more ... CTD PMID:30529165 and PMID:35258167 Hnrnpl Rat dioxygen multiple interactions ISO HNRNPL (Homo sapiens) 6480464 heclin inhibits the reaction [LINC01588 mRNA inhibits the reaction [Oxygen deficiency results in decreased expression of HNRNPL protein]] more ... CTD PMID:35258167 Hnrnpl Rat dioxygen decreases expression ISO HNRNPL (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of HNRNPL protein CTD PMID:35258167 Hnrnpl Rat dorsomorphin multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HNRNPL mRNA CTD PMID:27188386 Hnrnpl Rat doxorubicin decreases response to substance ISO HNRNPL (Homo sapiens) 6480464 HNRNPL protein results in decreased susceptibility to Doxorubicin CTD PMID:24675091 Hnrnpl Rat doxorubicin decreases expression ISO HNRNPL (Homo sapiens) 6480464 Doxorubicin results in decreased expression of HNRNPL mRNA CTD PMID:29803840 Hnrnpl Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of HNRNPL mRNA CTD PMID:29391264 Hnrnpl Rat enzyme inhibitor multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of HNRNPL protein CTD PMID:23301498 Hnrnpl Rat ethanol decreases expression ISO Hnrnpl (Mus musculus) 6480464 Ethanol results in decreased expression of HNRNPL mRNA CTD PMID:21955143 Hnrnpl Rat ethanol affects splicing ISO Hnrnpl (Mus musculus) 6480464 Ethanol affects the splicing of HNRNPL mRNA CTD PMID:30319688 Hnrnpl Rat folic acid multiple interactions ISO Hnrnpl (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of HNRNPL mRNA CTD PMID:22206623 Hnrnpl Rat FR900359 increases phosphorylation ISO HNRNPL (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of HNRNPL protein CTD PMID:37730182 Hnrnpl Rat furfural multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Hnrnpl Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of HNRNPL mRNA CTD PMID:33387578 Hnrnpl Rat glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of HNRNPL mRNA CTD PMID:26302742 Hnrnpl Rat glyphosate decreases expression ISO Hnrnpl (Mus musculus) 6480464 Glyphosate results in decreased expression of HNRNPL mRNA CTD PMID:35897073 Hnrnpl Rat hydrogen sulfide decreases expression ISO Hnrnpl (Mus musculus) 6480464 Hydrogen Sulfide results in decreased expression of HNRNPL protein CTD PMID:29932956 Hnrnpl Rat indometacin multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of HNRNPL mRNA CTD PMID:28628672 Hnrnpl Rat ivermectin decreases expression ISO HNRNPL (Homo sapiens) 6480464 Ivermectin results in decreased expression of HNRNPL protein CTD PMID:32959892 Hnrnpl Rat methotrexate affects expression ISO Hnrnpl (Mus musculus) 6480464 Methotrexate affects the expression of HNRNPL mRNA CTD PMID:18502557 Hnrnpl Rat morphine increases expression ISO Hnrnpl (Mus musculus) 6480464 Morphine deficiency results in increased expression of HNRNPL mRNA and Morphine results in increased expression of HNRNPL mRNA CTD PMID:21955143 and PMID:27126842 Hnrnpl Rat N-methyl-4-phenylpyridinium increases expression ISO Hnrnpl (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of HNRNPL protein CTD PMID:26558463 Hnrnpl Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of HNRNPL mRNA CTD PMID:17602206 Hnrnpl Rat nicotine decreases expression ISO Hnrnpl (Mus musculus) 6480464 Nicotine results in decreased expression of HNRNPL mRNA CTD PMID:21955143 Hnrnpl Rat ozone multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of HNRNPL mRNA more ... CTD PMID:32699268 Hnrnpl Rat p-chloromercuribenzoic acid multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HNRNPL mRNA CTD PMID:27188386 Hnrnpl Rat piroxicam multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [Piroxicam co-treated with Cisplatin] results in increased expression of HNRNPL mRNA CTD PMID:21858171 Hnrnpl Rat quinoline decreases expression ISO HNRNPL (Homo sapiens) 6480464 quinoline analog results in decreased expression of HNRNPL protein CTD PMID:18645022 Hnrnpl Rat rac-lactic acid increases expression ISO HNRNPL (Homo sapiens) 6480464 Lactic Acid results in increased expression of HNRNPL mRNA CTD PMID:30851411 Hnrnpl Rat saxitoxin decreases expression ISO Hnrnpl (Mus musculus) 6480464 Saxitoxin results in decreased expression of HNRNPL protein CTD PMID:29228856 Hnrnpl Rat SB 431542 multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HNRNPL mRNA CTD PMID:27188386 Hnrnpl Rat sodium chloride multiple interactions ISO HNRNPL (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of HNRNPL protein CTD PMID:38598786 Hnrnpl Rat sulforaphane multiple interactions ISO Hnrnpl (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of HNRNPL mRNA CTD PMID:30529165 Hnrnpl Rat sunitinib decreases expression ISO HNRNPL (Homo sapiens) 6480464 Sunitinib results in decreased expression of HNRNPL mRNA CTD PMID:31533062 Hnrnpl Rat tamoxifen affects expression ISO Hnrnpl (Mus musculus) 6480464 Tamoxifen affects the expression of HNRNPL mRNA CTD PMID:17555576 Hnrnpl Rat tetrachloromethane decreases expression ISO Hnrnpl (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of HNRNPL mRNA CTD PMID:31919559 Hnrnpl Rat titanium dioxide decreases methylation ISO Hnrnpl (Mus musculus) 6480464 titanium dioxide results in decreased methylation of HNRNPL gene CTD PMID:35295148 Hnrnpl Rat titanium dioxide increases methylation ISO Hnrnpl (Mus musculus) 6480464 titanium dioxide results in increased methylation of HNRNPL promoter CTD PMID:35295148 Hnrnpl Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of HNRNPL mRNA CTD PMID:33387578 Hnrnpl Rat trichostatin A affects expression ISO HNRNPL (Homo sapiens) 6480464 trichostatin A affects the expression of HNRNPL mRNA CTD PMID:28542535 Hnrnpl Rat triphenyl phosphate affects expression ISO HNRNPL (Homo sapiens) 6480464 triphenyl phosphate affects the expression of HNRNPL mRNA CTD PMID:37042841 Hnrnpl Rat triptonide decreases expression ISO Hnrnpl (Mus musculus) 6480464 triptonide results in decreased expression of HNRNPL mRNA CTD PMID:33045310 Hnrnpl Rat trovafloxacin increases expression ISO Hnrnpl (Mus musculus) 6480464 trovafloxacin results in increased expression of HNRNPL mRNA CTD PMID:35537566 Hnrnpl Rat valproic acid decreases expression ISO HNRNPL (Homo sapiens) 6480464 Valproic Acid results in decreased expression of HNRNPL mRNA CTD PMID:23179753 and PMID:29154799
(S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 3',5'-cyclic UMP (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 5-fluorouracil (ISO) acrolein (ISO) Aflatoxin B2 alpha (ISO) alpha-pinene (ISO) ammonium chloride (EXP) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (EXP,ISO) Brodifacoum (EXP) caffeine (ISO) carbamazepine (ISO) carbon nanotube (ISO) chloroprene (ISO) cisplatin (ISO) clofibric acid (EXP) copper atom (ISO) copper(0) (ISO) coumarin (ISO) CU-O LINKAGE (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) enzyme inhibitor (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) furfural (ISO) gentamycin (EXP) glyphosate (EXP,ISO) hydrogen sulfide (ISO) indometacin (ISO) ivermectin (ISO) methotrexate (ISO) morphine (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) nicotine (ISO) ozone (ISO) p-chloromercuribenzoic acid (ISO) piroxicam (ISO) quinoline (ISO) rac-lactic acid (ISO) saxitoxin (ISO) SB 431542 (ISO) sodium chloride (ISO) sulforaphane (ISO) sunitinib (ISO) tamoxifen (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) trovafloxacin (ISO) valproic acid (ISO)
1.
Identification of new autoantibody specificities directed at proteins involved in the transforming growth factor beta pathway in patients with systemic sclerosis.
Bussone G, etal., Arthritis Res Ther. 2011 May 13;13(3):R74. doi: 10.1186/ar3336.
2.
Proteomic analysis of in vivo-assembled pre-mRNA splicing complexes expands the catalog of participating factors.
Chen YI, etal., Nucleic Acids Res. 2007;35(12):3928-44. Epub 2007 May 30.
3.
PLG regulates hnRNP-L expression in the rat striatum and pre-frontal cortex: identification by ddPCR.
Costain WJ and Mishra RK, Peptides 2003 Jan;24(1):137-46.
4.
Lymphoid gene expression as a predictor of risk of secondary brain tumors.
Edick MJ, etal., Genes Chromosomes Cancer. 2005 Feb;42(2):107-16.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
hnRNP L regulates the tumorigenic capacity of lung cancer xenografts in mice via caspase-9 pre-mRNA processing.
Goehe RW, etal., J Clin Invest. 2010 Nov;120(11):3923-39. doi: 10.1172/JCI43552. Epub 2010 Oct 25.
8.
hnRNP A2 and hnRNP L bind the 3'UTR of glucose transporter 1 mRNA and exist as a complex in vivo.
Hamilton BJ, etal., Biochem Biophys Res Commun. 1999 Aug 11;261(3):646-51.
9.
Rhythmic serotonin N-acetyltransferase mRNA degradation is essential for the maintenance of its circadian oscillation.
Kim TD, etal., Mol Cell Biol. 2005 Apr;25(8):3232-46.
10.
HnRNPL as a key factor in spermatogenesis: Lesson from functional proteomic studies of azoospermia patients with sertoli cell only syndrome.
Li J, etal., J Proteomics. 2012 Jun 6;75(10):2879-91. doi: 10.1016/j.jprot.2011.12.040. Epub 2012 Jan 10.
11.
A conserved serine of heterogeneous nuclear ribonucleoprotein L (hnRNP L) mediates depolarization-regulated alternative splicing of potassium channels.
Liu G, etal., J Biol Chem. 2012 Jun 29;287(27):22709-16. doi: 10.1074/jbc.M112.357343. Epub 2012 May 8.
12.
The hnRNA-binding proteins hnRNP L and PTB are required for efficient translation of the Cat-1 arginine/lysine transporter mRNA during amino acid starvation.
Majumder M, etal., Mol Cell Biol. 2009 May;29(10):2899-912. doi: 10.1128/MCB.01774-08. Epub 2009 Mar 9.
13.
Natural antisense transcript stabilizes inducible nitric oxide synthase messenger RNA in rat hepatocytes.
Matsui K, etal., Hepatology. 2008 Feb;47(2):686-97.
14.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
15.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.
GOA pipeline
RGD automated data pipeline
17.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
An exonic splicing silencer is involved in the regulated splicing of glucose 6-phosphate dehydrogenase mRNA.
Szeszel-Fedorowicz W, etal., J Biol Chem. 2006 Nov 10;281(45):34146-58. Epub 2006 Sep 15.
20.
Autoantibody recognition of an N-terminal epitope of hnRNP L marks the risk for developing HBV-related hepatocellular carcinoma.
Yau WY, etal., J Proteomics. 2013 Dec 6;94:346-58. doi: 10.1016/j.jprot.2013.10.003. Epub 2013 Oct 11.
Hnrnpl Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 93,226,373 - 93,239,084 (+) NCBI GRCr8 mRatBN7.2 1 84,098,558 - 84,111,568 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 84,100,879 - 84,111,553 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 89,510,654 - 89,521,604 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 97,969,995 - 97,980,674 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 91,266,512 - 91,277,462 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 86,994,090 - 87,006,776 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 86,996,093 - 87,006,776 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 88,174,400 - 88,187,394 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 83,919,015 - 83,929,698 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 84,005,781 - 84,007,795 (+) NCBI Celera 1 78,491,204 - 78,501,887 (+) NCBI Celera Cytogenetic Map 1 q21 NCBI
HNRNPL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 38,836,370 - 38,852,347 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 38,836,370 - 38,852,347 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 39,327,010 - 39,342,987 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 44,018,868 - 44,034,819 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 44,018,868 - 44,032,457 NCBI Celera 19 36,129,470 - 36,145,420 (-) NCBI Celera Cytogenetic Map 19 q13.2 NCBI HuRef 19 35,773,794 - 35,789,557 (-) NCBI HuRef CHM1_1 19 39,327,480 - 39,343,450 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 41,640,403 - 41,656,404 (-) NCBI T2T-CHM13v2.0
Hnrnpl Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 28,507,971 - 28,521,693 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 28,507,966 - 28,521,691 (+) Ensembl GRCm39 Ensembl GRCm38 7 28,808,546 - 28,822,268 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 28,808,541 - 28,822,266 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 29,595,909 - 29,607,285 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 28,519,673 - 28,531,004 (+) NCBI MGSCv36 mm8 Celera 7 23,371,763 - 23,383,139 (+) NCBI Celera Cytogenetic Map 7 B1 NCBI cM Map 7 16.93 NCBI
Hnrnpl Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955468 670,559 - 683,540 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955468 668,177 - 683,540 (+) NCBI ChiLan1.0 ChiLan1.0
HNRNPL Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 45,140,619 - 45,158,142 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 47,011,145 - 47,027,200 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 35,943,720 - 35,959,795 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 44,493,832 - 44,509,183 (-) NCBI panpan1.1 PanPan1.1 panPan2
HNRNPL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 114,267,195 - 114,279,107 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 114,267,210 - 114,278,837 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 113,668,694 - 113,682,944 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 114,867,366 - 114,881,619 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 114,869,714 - 114,881,615 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 114,424,849 - 114,439,087 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 114,060,575 - 114,072,464 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 115,054,052 - 115,068,304 (+) NCBI UU_Cfam_GSD_1.0
Hnrnpl Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 13,365,722 - 13,378,495 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936661 1,793,801 - 1,806,579 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936661 1,793,791 - 1,806,564 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HNRNPL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 47,643,566 - 47,657,833 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 47,643,561 - 47,655,856 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 43,180,634 - 43,194,945 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HNRNPL Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 33,452,705 - 33,469,070 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 33,452,852 - 33,466,284 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 11,466,361 - 11,483,112 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hnrnpl
.
Predicted Target Of
Count of predictions: 377 Count of miRNA genes: 189 Interacting mature miRNAs: 215 Transcripts: ENSRNOT00000027425, ENSRNOT00000027494, ENSRNOT00000057034 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
WI-13808
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 84,105,765 - 84,105,895 (+) MAPPER mRatBN7.2 Rnor_6.0 1 87,000,974 - 87,001,103 NCBI Rnor6.0 Rnor_5.0 1 88,181,592 - 88,181,721 UniSTS Rnor5.0 RGSC_v3.4 1 83,923,896 - 83,924,025 UniSTS RGSC3.4 Celera 1 78,496,085 - 78,496,214 UniSTS Cytogenetic Map 1 q21 UniSTS
AI599652
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 93,238,316 - 93,238,819 (+) Marker Load Pipeline mRatBN7.2 8 8,601,113 - 8,601,258 (+) MAPPER mRatBN7.2 mRatBN7.2 1 84,110,800 - 84,111,303 (+) MAPPER mRatBN7.2 Rnor_6.0 8 9,673,364 - 9,673,508 NCBI Rnor6.0 Rnor_6.0 1 87,006,009 - 87,006,511 NCBI Rnor6.0 Rnor_5.0 8 9,647,369 - 9,647,513 UniSTS Rnor5.0 Rnor_5.0 1 88,186,627 - 88,187,129 UniSTS Rnor5.0 RGSC_v3.4 1 83,928,931 - 83,929,433 UniSTS RGSC3.4 RGSC_v3.4 8 8,436,039 - 8,436,183 UniSTS RGSC3.4 Celera 8 10,109,633 - 10,109,777 UniSTS Celera 1 78,501,120 - 78,501,622 UniSTS RH 3.4 Map 1 844.0 UniSTS Cytogenetic Map 1 q21 UniSTS Cytogenetic Map 8 q11 UniSTS
D6S1116E
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 93,235,556 - 93,235,815 (+) Marker Load Pipeline mRatBN7.2 1 84,108,040 - 84,108,299 (+) MAPPER mRatBN7.2 Rnor_6.0 1 87,003,249 - 87,003,507 NCBI Rnor6.0 Rnor_5.0 1 88,183,867 - 88,184,125 UniSTS Rnor5.0 RGSC_v3.4 1 83,926,171 - 83,926,429 UniSTS RGSC3.4 Celera 1 78,498,360 - 78,498,618 UniSTS Cytogenetic Map 1 q21 UniSTS
UniSTS:479127
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 5,939,834 - 5,940,272 (+) MAPPER mRatBN7.2 Rnor_6.0 3 261,494 - 261,931 NCBI Rnor6.0 Rnor_5.0 3 257,367 - 257,804 UniSTS Rnor5.0 RGSC_v3.4 3 1,378,472 - 1,378,909 UniSTS RGSC3.4 Celera 3 778,564 - 779,001 UniSTS Cytogenetic Map 1 q21 UniSTS Cytogenetic Map 3 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027425 ⟹ ENSRNOP00000027425
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 84,100,879 - 84,111,553 (+) Ensembl Rnor_6.0 Ensembl 1 86,996,093 - 87,006,776 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000027494 ⟹ ENSRNOP00000027494
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 84,100,879 - 84,111,553 (+) Ensembl Rnor_6.0 Ensembl 1 86,996,093 - 87,006,776 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000057034 ⟹ ENSRNOP00000053867
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 84,100,911 - 84,111,549 (+) Ensembl Rnor_6.0 Ensembl 1 87,000,093 - 87,006,753 (+) Ensembl
RefSeq Acc Id:
NM_001134760 ⟹ NP_001128232
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 93,228,401 - 93,239,084 (+) NCBI mRatBN7.2 1 84,100,885 - 84,111,568 (+) NCBI Rnor_6.0 1 86,996,093 - 87,006,776 (+) NCBI Rnor_5.0 1 88,174,400 - 88,187,394 (+) NCBI RGSC_v3.4 1 83,919,015 - 83,929,698 (+) RGD Celera 1 78,491,204 - 78,501,887 (+) RGD
Sequence:
ATGTCGCGGAGGCTGCTGCCCCGGGCGGAGAAGCGGCGTCGGCGGCTCGAGCAGAGGCAGCAGCCGGACGAGCAGCTGAGGCGGGCGGGAGCGATGGTGAAGATGGCGGCGGCGGGCGGCGGAGGCGG
hide sequence
RefSeq Acc Id:
NM_032619 ⟹ NP_116008
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 93,228,401 - 93,239,084 (+) NCBI mRatBN7.2 1 84,100,885 - 84,111,568 (+) NCBI Rnor_6.0 1 86,996,093 - 87,006,776 (+) NCBI Rnor_5.0 1 88,174,400 - 88,187,394 (+) NCBI RGSC_v3.4 1 83,919,015 - 83,929,698 (+) RGD Celera 1 78,491,204 - 78,501,887 (+) RGD
Sequence:
ATGTCGCGGAGGCTGCTGCCCCGGGCGGAGAAGCGGCGTCGGCGGCTCGAGCAGAGGCAGCAGC
hide sequence
RefSeq Acc Id:
XM_006228691 ⟹ XP_006228753
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 93,226,373 - 93,239,070 (+) NCBI mRatBN7.2 1 84,098,558 - 84,111,557 (+) NCBI Rnor_6.0 1 86,994,090 - 87,006,765 (+) NCBI Rnor_5.0 1 88,174,400 - 88,187,394 (+) NCBI
Sequence:
TGGTCCCTTTAAGGTCCGCCCCTCCCTCCCCCAAAACTTCCCAGTGTCTGCTCTTTTCGATCCCGGACGGCCGGCCAAGCTCGCCGCCGAGCTGGAGAACTACGATGACCCCCACAAAACCCCTGCCT
hide sequence
RefSeq Acc Id:
XM_006228692 ⟹ XP_006228754
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 93,226,377 - 93,239,070 (+) NCBI mRatBN7.2 1 84,098,558 - 84,111,554 (+) NCBI Rnor_6.0 1 86,994,091 - 87,006,765 (+) NCBI Rnor_5.0 1 88,174,400 - 88,187,394 (+) NCBI
Sequence:
GGTCCCTTTAAGGTCCGCCCCTCCCTCCCCCAAAACTTCCCAGTGTCTGCTCTTTTCGATCCCGGACGGCCGGCCAAGCTCGCCGCCGAGCTGGAGAACTACGATGACCCCCACAAAACCCCTGCCTC
hide sequence
RefSeq Acc Id:
NP_116008 ⟸ NM_032619
- Peptide Label:
isoform b
- UniProtKB:
A6J9L2 (UniProtKB/TrEMBL)
- Sequence:
MSRRLLPRAEKRRRRLEQRQQPDEQLRRAGAMVKMAAAGGGGGGGRYYGGGNEGGRAPKRLKTENAGDQHGGGGGGGSGAAGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
hide sequence
RefSeq Acc Id:
NP_001128232 ⟸ NM_001134760
- Peptide Label:
isoform a
- UniProtKB:
F1LPP9 (UniProtKB/Swiss-Prot), Q5U1Y5 (UniProtKB/Swiss-Prot), F1LQ48 (UniProtKB/TrEMBL), A0A8L2QEL3 (UniProtKB/TrEMBL)
- Sequence:
MSRRLLPRAEKRRRRLEQRQQPDEQLRRAGAMVKMAAAGGGGGGGRYYGGGNEGGRAPKRLKTENAGDQHGGGGGGGSGAAGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
hide sequence
RefSeq Acc Id:
XP_006228753 ⟸ XM_006228691
- Peptide Label:
isoform X1
- UniProtKB:
A6J9L2 (UniProtKB/TrEMBL)
- Sequence:
MPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCC
hide sequence
RefSeq Acc Id:
XP_006228754 ⟸ XM_006228692
- Peptide Label:
isoform X2
- UniProtKB:
A6J9L3 (UniProtKB/TrEMBL), A6J9L2 (UniProtKB/TrEMBL)
- Sequence:
MPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCC
hide sequence
Ensembl Acc Id:
ENSRNOP00000053867 ⟸ ENSRNOT00000057034
Ensembl Acc Id:
ENSRNOP00000027494 ⟸ ENSRNOT00000027494
Ensembl Acc Id:
ENSRNOP00000027425 ⟸ ENSRNOT00000027425
RGD ID: 13689886 Promoter ID: EPDNEW_R410 Type: initiation region Name: Hnrnpl_1 Description: heterogeneous nuclear ribonucleoprotein L SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 86,996,119 - 86,996,179 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-18
Hnrnpl
heterogeneous nuclear ribonucleoprotein L
Hnrpl
heterogeneous nuclear ribonucleoprotein L
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-07-09
Hnrpl
heterogeneous nuclear ribonucleoprotein L
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
