Symbol:
Dhrs4
Name:
dehydrogenase/reductase 4
RGD ID:
708482
Description:
Predicted to enable several functions, including 3-beta-hydroxysteroid 3-dehydrogenase (NADP+) activity; alcohol dehydrogenase (NADP+) activity; and retinal dehydrogenase activity. Predicted to be involved in several processes, including positive regulation of reactive oxygen species metabolic process; retinal metabolic process; and steroid metabolic process. Located in peroxisome. Orthologous to several human genes including DHRS4 (dehydrogenase/reductase 4); PARTICIPATES IN retinol metabolic pathway; vitamin A deficiency pathway; INTERACTS WITH (+)-schisandrin B; 2,2',4,4'-Tetrabromodiphenyl ether; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
carbonyl reductase; CR; DCR-AKL; dehydrogenase/reductase (SDR family) member 4; dehydrogenase/reductase SDR family member 4; LOC266686; NADP-retinol dehydrogenase; NADPH-dependent carbonyl reductase; NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase; NADPH-dependent retinol dehydrogenase/reductase; NDRD; peroxisomal short-chain alcohol dehydrogenase; PHCR; PSCD; short chain dehydrogenase/reductase family 25C member 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DHRS4 (dehydrogenase/reductase 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Dhrs4 (dehydrogenase/reductase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DHRS4 (dehydrogenase/reductase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DHRS4 (hydrogenase/reductase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DHRS4 (dehydrogenase/reductase (SDR family) member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103231490 (dehydrogenase/reductase SDR family member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DHRS4L2 (dehydrogenase/reductase 4 like 2) HGNC
EggNOG, Ensembl, OrthoDB, Panther, PhylomeDB, Treefam
Homo sapiens (human):
DHRS4L1 (dehydrogenase/reductase 4 like 1 (pseudogene)) HGNC
Panther, PhylomeDB
Homo sapiens (human):
DHRS2 (dehydrogenase/reductase 2) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
DHRS4 (dehydrogenase/reductase 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Dhrs4 (dehydrogenase/reductase 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
DHRS4L1 (dehydrogenase/reductase 4 like 1 (pseudogene))
Alliance
DIOPT (OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Homo sapiens (human):
DHRS4L2 (dehydrogenase/reductase 4 like 2)
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
dhrs4 (dehydrogenase/reductase (SDR family) member 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG10672
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
dhs-13
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
dhrs4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 32,924,482 - 32,948,103 (+) NCBI GRCr8 mRatBN7.2 15 28,966,544 - 28,978,135 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 28,966,553 - 28,978,127 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 30,812,271 - 30,823,840 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 31,959,479 - 31,971,048 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 30,201,827 - 30,213,396 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 34,155,043 - 34,167,073 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 34,155,504 - 34,167,072 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 38,045,908 - 38,057,499 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 33,609,570 - 33,621,142 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 33,625,453 - 33,636,460 (+) NCBI Celera 15 28,542,580 - 28,554,149 (+) NCBI Celera Cytogenetic Map 15 p13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dhrs4 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DHRS4 mRNA] CTD PMID:31150632 Dhrs4 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:732150 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DHRS4 mRNA CTD PMID:36331819 Dhrs4 Rat 1,2-dimethylhydrazine increases expression ISO RGD:732150 6480464 1,2-Dimethylhydrazine results in increased expression of DHRS4 mRNA CTD PMID:22206623 Dhrs4 Rat 17beta-estradiol increases expression ISO RGD:732150 6480464 Estradiol results in increased expression of DHRS4 mRNA CTD PMID:39298647 Dhrs4 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of DHRS4 mRNA CTD PMID:27291303 Dhrs4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:732150 6480464 Tetrachlorodibenzodioxin results in decreased expression of DHRS4 mRNA CTD PMID:19770486 Dhrs4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:732150 6480464 Tetrachlorodibenzodioxin affects the expression of DHRS4 mRNA CTD PMID:21570461 Dhrs4 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO RGD:732150 6480464 3,4,3',4'-tetrachlorobiphenyl inhibits the reaction [Dietary Fats results in increased expression of DHRS4 mRNA] CTD PMID:19467301 Dhrs4 Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:732150 6480464 4,4'-diaminodiphenylmethane results in decreased expression of DHRS4 mRNA CTD PMID:18648102 Dhrs4 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:732150 6480464 bisphenol S results in increased expression of DHRS4 mRNA CTD PMID:39298647 Dhrs4 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:732149 6480464 bisphenol S results in increased expression of DHRS4 protein CTD PMID:34186270 Dhrs4 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of DHRS4 mRNA CTD PMID:19483382 Dhrs4 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of DHRS4 mRNA CTD PMID:19483382 Dhrs4 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DHRS4 mRNA CTD PMID:24780913 Dhrs4 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of DHRS4 mRNA CTD PMID:31881176 Dhrs4 Rat aflatoxin B1 decreases methylation ISO RGD:732149 6480464 Aflatoxin B1 results in decreased methylation of DHRS4 gene CTD PMID:27153756 Dhrs4 Rat all-trans-retinal increases reduction ISO RGD:732150 6480464 DHRS4 protein results in increased reduction of Retinaldehyde CTD PMID:12680773 Dhrs4 Rat all-trans-retinoic acid decreases expression ISO RGD:732149 6480464 Tretinoin results in decreased expression of DHRS4 mRNA CTD PMID:33167477 Dhrs4 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of DHRS4 mRNA CTD PMID:19483382 Dhrs4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DHRS4 mRNA CTD PMID:16483693 Dhrs4 Rat arsane affects methylation ISO RGD:732149 6480464 Arsenic affects the methylation of DHRS4 gene CTD PMID:25304211 Dhrs4 Rat arsenic atom affects methylation ISO RGD:732149 6480464 Arsenic affects the methylation of DHRS4 gene CTD PMID:25304211 Dhrs4 Rat atrazine decreases expression ISO RGD:732149 6480464 Atrazine results in decreased expression of DHRS4 mRNA CTD PMID:22378314 Dhrs4 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of DHRS4 mRNA CTD PMID:19483382 Dhrs4 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:732150 6480464 Diethylhexyl Phthalate results in increased expression of DHRS4 mRNA CTD PMID:19850644 Dhrs4 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:732150 6480464 Diethylhexyl Phthalate results in decreased expression of DHRS4 mRNA CTD PMID:28085963 Dhrs4 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:732150 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of DHRS4 mRNA] CTD PMID:19850644 Dhrs4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DHRS4 mRNA CTD PMID:25181051 Dhrs4 Rat bisphenol A decreases expression ISO RGD:732149 6480464 bisphenol A results in decreased expression of DHRS4 protein CTD PMID:34186270 Dhrs4 Rat bisphenol A decreases expression ISO RGD:732150 6480464 bisphenol A results in decreased expression of DHRS4 mRNA CTD PMID:33221593 Dhrs4 Rat bisphenol AF increases expression ISO RGD:732149 6480464 bisphenol AF results in increased expression of DHRS4 protein CTD PMID:34186270 Dhrs4 Rat Bisphenol B increases expression ISO RGD:732149 6480464 bisphenol B results in increased expression of DHRS4 protein CTD PMID:34186270 Dhrs4 Rat carbon nanotube increases expression ISO RGD:732150 6480464 Nanotubes, Carbon results in increased expression of DHRS4 mRNA CTD PMID:25554681 Dhrs4 Rat CGP 52608 multiple interactions ISO RGD:732149 6480464 CGP 52608 promotes the reaction [RORA protein binds to DHRS4 gene] CTD PMID:28238834 Dhrs4 Rat ciguatoxin CTX1B affects expression ISO RGD:732150 6480464 Ciguatoxins affects the expression of DHRS4 mRNA CTD PMID:18353800 Dhrs4 Rat clofibrate multiple interactions ISO RGD:732150 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of DHRS4 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Dhrs4 Rat clofibrate increases expression ISO RGD:732150 6480464 Clofibrate results in increased expression of DHRS4 mRNA; Clofibrate results in increased expression of DHRS4 more ... CTD PMID:12680773|PMID:23811191 Dhrs4 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of DHRS4 mRNA CTD PMID:19483382 Dhrs4 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of DHRS4 mRNA CTD PMID:17602206 Dhrs4 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of DHRS4 mRNA CTD PMID:22465980 Dhrs4 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of DHRS4 mRNA CTD PMID:22465980 Dhrs4 Rat copper(II) sulfate decreases expression ISO RGD:732149 6480464 Copper Sulfate results in decreased expression of DHRS4 mRNA CTD PMID:19549813 Dhrs4 Rat crocidolite asbestos increases expression ISO RGD:732149 6480464 Asbestos, Crocidolite results in increased expression of DHRS4 mRNA CTD PMID:29523930 Dhrs4 Rat cyclosporin A decreases expression ISO RGD:732150 6480464 Cyclosporine results in decreased expression of DHRS4 mRNA CTD PMID:19770486 Dhrs4 Rat Dibutyl phosphate affects expression ISO RGD:732149 6480464 di-n-butylphosphoric acid affects the expression of DHRS4 mRNA CTD PMID:37042841 Dhrs4 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of DHRS4 mRNA CTD PMID:21266533 Dhrs4 Rat dibutyl phthalate decreases expression ISO RGD:732150 6480464 Dibutyl Phthalate results in decreased expression of DHRS4 mRNA CTD PMID:17361019 Dhrs4 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of DHRS4 mRNA CTD PMID:21266533 Dhrs4 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of DHRS4 mRNA CTD PMID:21551480 Dhrs4 Rat doxorubicin decreases expression ISO RGD:732149 6480464 Doxorubicin results in decreased expression of DHRS4 mRNA CTD PMID:29803840 Dhrs4 Rat elemental selenium increases expression ISO RGD:732149 6480464 Selenium results in increased expression of DHRS4 mRNA CTD PMID:19244175 Dhrs4 Rat epoxiconazole decreases expression ISO RGD:732150 6480464 epoxiconazole results in decreased expression of DHRS4 mRNA CTD PMID:35436446 Dhrs4 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of DHRS4 protein CTD PMID:19609968 Dhrs4 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of DHRS4 mRNA CTD PMID:24136188 Dhrs4 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of DHRS4 mRNA CTD PMID:24793618 Dhrs4 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of DHRS4 mRNA CTD PMID:33387578 Dhrs4 Rat hydrogen peroxide affects expression ISO RGD:732149 6480464 Hydrogen Peroxide affects the expression of DHRS4 mRNA CTD PMID:21179406 Dhrs4 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of DHRS4 mRNA CTD PMID:36868495 Dhrs4 Rat inulin multiple interactions ISO RGD:732150 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of DHRS4 mRNA CTD PMID:36331819 Dhrs4 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of DHRS4 mRNA CTD PMID:19483382 Dhrs4 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of DHRS4 mRNA CTD PMID:30467583 Dhrs4 Rat mono(2-ethylhexyl) phthalate increases expression ISO RGD:732150 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of DHRS4 protein CTD PMID:27384973 Dhrs4 Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of DHRS4 mRNA CTD PMID:21515302 Dhrs4 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of DHRS4 protein CTD PMID:19716841 Dhrs4 Rat NADP zwitterion multiple interactions ISO RGD:732149 6480464 NADP binds to and results in increased activity of DHRS4 protein CTD PMID:25526675 Dhrs4 Rat NADP(+) multiple interactions ISO RGD:732149 6480464 NADP binds to and results in increased activity of DHRS4 protein CTD PMID:25526675 Dhrs4 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of DHRS4 mRNA CTD PMID:24136188 Dhrs4 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of DHRS4 mRNA CTD PMID:24136188 Dhrs4 Rat okadaic acid decreases expression ISO RGD:732149 6480464 Okadaic Acid results in decreased expression of DHRS4 mRNA CTD PMID:38832940 Dhrs4 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of DHRS4 mRNA CTD PMID:19483382 Dhrs4 Rat ozone multiple interactions ISO RGD:732150 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Dhrs4 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of DHRS4 mRNA CTD PMID:27638505 Dhrs4 Rat paracetamol multiple interactions ISO RGD:732150 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of DHRS4 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Dhrs4 Rat perfluorohexanesulfonic acid increases expression ISO RGD:732150 6480464 perfluorohexanesulfonic acid results in increased expression of DHRS4 mRNA CTD PMID:28558994 Dhrs4 Rat perfluorononanoic acid increases expression ISO RGD:732150 6480464 perfluoro-n-nonanoic acid results in increased expression of DHRS4 mRNA CTD PMID:28558994 Dhrs4 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:732150 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DHRS4 mRNA; [perfluorooctane sulfonic more ... CTD PMID:28558994|PMID:36331819 Dhrs4 Rat perfluorooctane-1-sulfonic acid increases expression ISO RGD:732150 6480464 perfluorooctane sulfonic acid results in increased expression of DHRS4 mRNA CTD PMID:28558994 Dhrs4 Rat perfluorooctanoic acid increases expression ISO RGD:732150 6480464 perfluorooctanoic acid results in increased expression of DHRS4 mRNA CTD PMID:17681415|PMID:28558994 Dhrs4 Rat perfluorooctanoic acid affects expression ISO RGD:732150 6480464 perfluorooctanoic acid affects the expression of DHRS4 mRNA CTD PMID:18281256 Dhrs4 Rat phenobarbital increases expression ISO RGD:732150 6480464 Phenobarbital results in increased expression of DHRS4 mRNA CTD PMID:19270015 Dhrs4 Rat phlorizin decreases expression ISO RGD:732150 6480464 Phlorhizin results in decreased expression of DHRS4 mRNA CTD PMID:22538082 Dhrs4 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of DHRS4 mRNA CTD PMID:19483382 Dhrs4 Rat pirinixic acid increases expression ISO RGD:732150 6480464 pirinixic acid results in increased expression of DHRS4 mRNA CTD PMID:17426115|PMID:18301758|PMID:23811191 Dhrs4 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of DHRS4 mRNA CTD PMID:22484513 Dhrs4 Rat resveratrol increases expression ISO RGD:732150 6480464 resveratrol results in increased expression of DHRS4 protein CTD PMID:25505154 Dhrs4 Rat selenium atom increases expression ISO RGD:732149 6480464 Selenium results in increased expression of DHRS4 mRNA CTD PMID:19244175 Dhrs4 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of DHRS4 protein CTD PMID:29459688 Dhrs4 Rat sodium arsenite decreases expression ISO RGD:732149 6480464 sodium arsenite results in decreased expression of DHRS4 mRNA CTD PMID:38568856 Dhrs4 Rat sunitinib increases expression ISO RGD:732149 6480464 Sunitinib results in increased expression of DHRS4 mRNA CTD PMID:31533062 Dhrs4 Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of DHRS4 mRNA CTD PMID:21515302 Dhrs4 Rat testosterone enanthate affects expression ISO RGD:732149 6480464 testosterone enanthate affects the expression of DHRS4 mRNA CTD PMID:17440010 Dhrs4 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DHRS4 mRNA] CTD PMID:31150632 Dhrs4 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of DHRS4 mRNA CTD PMID:31150632 Dhrs4 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of DHRS4 mRNA CTD PMID:19483382 Dhrs4 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of DHRS4 mRNA CTD PMID:34492290 Dhrs4 Rat trichloroethene increases expression ISO RGD:732150 6480464 Trichloroethylene results in increased expression of DHRS4 mRNA CTD PMID:25549359|PMID:28973375 Dhrs4 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of DHRS4 mRNA CTD PMID:33387578 Dhrs4 Rat trovafloxacin decreases expression ISO RGD:732150 6480464 trovafloxacin results in decreased expression of DHRS4 mRNA CTD PMID:35537566 Dhrs4 Rat tungsten increases expression ISO RGD:732150 6480464 Tungsten results in increased expression of DHRS4 mRNA CTD PMID:30912803 Dhrs4 Rat valproic acid decreases expression ISO RGD:732150 6480464 Valproic Acid results in decreased expression of DHRS4 mRNA CTD PMID:21427059 Dhrs4 Rat vitamin E increases expression ISO RGD:732149 6480464 Vitamin E results in increased expression of DHRS4 mRNA CTD PMID:19244175
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinal (ISO) all-trans-retinoic acid (ISO) amiodarone (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzbromarone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) carbon nanotube (ISO) CGP 52608 (ISO) ciguatoxin CTX1B (ISO) clofibrate (EXP,ISO) clofibric acid (EXP) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) diuron (EXP) doxorubicin (ISO) elemental selenium (ISO) epoxiconazole (ISO) ethanol (EXP) finasteride (EXP) flutamide (EXP) gentamycin (EXP) hydrogen peroxide (ISO) indometacin (EXP) inulin (ISO) L-ethionine (EXP) methapyrilene (EXP) mono(2-ethylhexyl) phthalate (ISO) Muraglitazar (EXP) N-nitrosomorpholine (EXP) NADP zwitterion (ISO) NADP(+) (ISO) nefazodone (EXP) nimesulide (EXP) okadaic acid (ISO) omeprazole (EXP) ozone (ISO) p-toluidine (EXP) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phlorizin (ISO) pirinixic acid (EXP,ISO) resveratrol (ISO) selenium atom (ISO) sodium arsenite (EXP,ISO) sunitinib (ISO) Tesaglitazar (EXP) testosterone enanthate (ISO) tetrachloromethane (EXP) thioacetamide (EXP) trichloroethene (EXP,ISO) trovafloxacin (ISO) tungsten (ISO) valproic acid (ISO) vitamin E (ISO)
Dhrs4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 32,924,482 - 32,948,103 (+) NCBI GRCr8 mRatBN7.2 15 28,966,544 - 28,978,135 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 28,966,553 - 28,978,127 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 30,812,271 - 30,823,840 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 31,959,479 - 31,971,048 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 30,201,827 - 30,213,396 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 34,155,043 - 34,167,073 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 34,155,504 - 34,167,072 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 38,045,908 - 38,057,499 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 33,609,570 - 33,621,142 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 33,625,453 - 33,636,460 (+) NCBI Celera 15 28,542,580 - 28,554,149 (+) NCBI Celera Cytogenetic Map 15 p13 NCBI
DHRS4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 23,953,770 - 23,969,279 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 23,953,734 - 23,969,279 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 24,422,979 - 24,438,488 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 23,492,805 - 23,508,328 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 23,492,804 - 23,508,326 NCBI Celera 14 4,285,601 - 4,303,126 (+) NCBI Celera Cytogenetic Map 14 q11.2 NCBI HuRef 14 4,539,991 - 4,555,519 (+) NCBI HuRef CHM1_1 14 24,421,623 - 24,437,128 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 18,154,102 - 18,169,615 (+) NCBI T2T-CHM13v2.0
Dhrs4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 55,715,880 - 55,727,797 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 55,716,215 - 55,727,797 (+) Ensembl GRCm39 Ensembl GRCm38 14 55,478,741 - 55,490,340 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 55,478,758 - 55,490,340 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 56,097,595 - 56,109,177 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 54,432,868 - 54,444,411 (+) NCBI MGSCv36 mm8 Celera 14 53,283,670 - 53,295,252 (+) NCBI Celera Cytogenetic Map 14 C3 NCBI cM Map 14 28.19 NCBI
DHRS4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 25,352,031 - 25,367,508 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 24,568,524 - 24,584,000 (+) NCBI NHGRI_mPanPan1 PanPan1.1 14 22,831,557 - 22,953,699 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 22,831,756 - 22,846,695 (+) Ensembl panpan1.1 panPan2
DHRS4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 4,046,532 - 4,058,498 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 4,046,544 - 4,084,744 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 3,968,424 - 3,980,384 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 4,157,197 - 4,169,172 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 4,157,179 - 4,169,172 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 3,847,979 - 3,859,935 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 3,909,733 - 3,921,692 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 4,171,825 - 4,183,775 (+) NCBI UU_Cfam_GSD_1.0
DHRS4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 75,242,124 - 75,255,598 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 75,242,121 - 75,255,594 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 80,512,359 - 80,525,829 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC103231490 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 24,170,090 - 24,185,509 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 24,169,818 - 24,185,634 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 22,224,518 - 22,239,925 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 41 Count of miRNA genes: 38 Interacting mature miRNAs: 40 Transcripts: ENSRNOT00000024782 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 10755503 Bp391 Blood pressure QTL 391 2.37 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 20248600 37896129 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 10054130 Srcrt8 Stress Responsive Cort QTL 8 2.18 0.0085 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 15 22117933 67117933 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 2324620 Coatc3 Coat color QTL 3 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 15 19856566 46187442 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 631550 Bw7 Body weight QTL 7 3.6 body mass (VT:0001259) body weight (CMO:0000012) 15 19856566 34924750 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat
BE114851
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 28,975,446 - 28,975,617 (+) MAPPER mRatBN7.2 Rnor_6.0 15 34,164,385 - 34,164,555 NCBI Rnor6.0 Rnor_5.0 15 38,054,811 - 38,054,981 UniSTS Rnor5.0 RGSC_v3.4 15 33,618,454 - 33,618,624 UniSTS RGSC3.4 Celera 15 28,551,461 - 28,551,631 UniSTS RH 3.4 Map 15 260.61 UniSTS Cytogenetic Map 15 p13 UniSTS
RH130081
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 28,977,811 - 28,977,998 (+) MAPPER mRatBN7.2 Rnor_6.0 15 34,166,750 - 34,166,936 NCBI Rnor6.0 Rnor_5.0 15 38,057,176 - 38,057,362 UniSTS Rnor5.0 RGSC_v3.4 15 33,620,819 - 33,621,005 UniSTS RGSC3.4 Celera 15 28,553,826 - 28,554,012 UniSTS RH 3.4 Map 15 260.81 UniSTS Cytogenetic Map 15 p13 UniSTS
BE113024
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 28,968,298 - 28,968,515 (+) MAPPER mRatBN7.2 Rnor_6.0 15 34,157,238 - 34,157,454 NCBI Rnor6.0 Rnor_5.0 15 38,047,662 - 38,047,878 UniSTS Rnor5.0 RGSC_v3.4 15 33,611,304 - 33,611,520 UniSTS RGSC3.4 Celera 15 28,544,314 - 28,544,530 UniSTS RH 3.4 Map 15 260.21 UniSTS Cytogenetic Map 15 p13 UniSTS
BE120291
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 28,970,324 - 28,970,507 (+) MAPPER mRatBN7.2 Rnor_6.0 15 34,159,263 - 34,159,445 NCBI Rnor6.0 Rnor_5.0 15 38,049,689 - 38,049,871 UniSTS Rnor5.0 RGSC_v3.4 15 33,613,332 - 33,613,514 UniSTS RGSC3.4 Celera 15 28,546,339 - 28,546,521 UniSTS RH 3.4 Map 15 260.81 UniSTS Cytogenetic Map 15 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024782 ⟹ ENSRNOP00000024782
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 28,966,553 - 28,978,127 (+) Ensembl Rnor_6.0 Ensembl 15 34,155,504 - 34,167,072 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119531 ⟹ ENSRNOP00000082872
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 28,966,553 - 28,977,730 (+) Ensembl
RefSeq Acc Id:
NM_153315 ⟹ NP_695227
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 32,936,534 - 32,948,103 (+) NCBI mRatBN7.2 15 28,966,565 - 28,978,135 (+) NCBI Rnor_6.0 15 34,155,504 - 34,167,073 (+) NCBI Rnor_5.0 15 38,045,908 - 38,057,499 (+) NCBI RGSC_v3.4 15 33,609,570 - 33,621,142 (+) RGD Celera 15 28,542,580 - 28,554,149 (+) RGD
Sequence:
CGCGGAGCGGGTCCTGGAAGCGTAGCAGGCTGTCCAGGGAGGCAGGACGCTCGCAGCTAGACCAGCCTCCTGTCCTTTGAACGTCCCCTCCCCTAGCAGAGTTCAACCCAGCTTCCGGATCTGAACTA
hide sequence
RefSeq Acc Id:
XM_039093040 ⟹ XP_038948968
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 32,936,515 - 32,946,246 (+) NCBI mRatBN7.2 15 28,966,544 - 28,976,256 (+) NCBI
RefSeq Acc Id:
XM_063274033 ⟹ XP_063130103
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 32,924,482 - 32,948,096 (+) NCBI
RefSeq Acc Id:
NP_695227 ⟸ NM_153315
- UniProtKB:
Q6IRD4 (UniProtKB/Swiss-Prot), Q8VID1 (UniProtKB/Swiss-Prot), A0A8I5ZUW8 (UniProtKB/TrEMBL)
- Sequence:
MQKAGLLLRGWTRAWKSVRMASSGLTRQNPLANKVALVTASTDGIGLAIARRLAEDGAHVVISSRKQQNVDRAVATLQGEGLSVTGVVCHVGKAEDREKLVNMALKLHQGIDILVSNAAVNPFFGNLM
hide sequence
Ensembl Acc Id:
ENSRNOP00000024782 ⟸ ENSRNOT00000024782
RefSeq Acc Id:
XP_038948968 ⟸ XM_039093040
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000082872 ⟸ ENSRNOT00000119531
RefSeq Acc Id:
XP_063130103 ⟸ XM_063274033
- Peptide Label:
isoform X1
- UniProtKB:
Q8VID1 (UniProtKB/Swiss-Prot), Q6IRD4 (UniProtKB/Swiss-Prot), A0A8I5ZUW8 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-06-01
Dhrs4
dehydrogenase/reductase 4
Dhrs4
dehydrogenase/reductase (SDR family) member 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Dhrs4
dehydrogenase/reductase (SDR family) member 4
LOC266686
carbonyl reductase
Symbol and Name updated
1299863 APPROVED
