Symbol:
Pcdh8
Name:
protocadherin 8
RGD ID:
69350
Description:
Predicted to enable calcium ion binding activity. Involved in chemical synaptic transmission; modulation of chemical synaptic transmission; and regulation of synaptic membrane adhesion. Is active in Schaffer collateral - CA1 synapse; glutamatergic synapse; and postsynaptic membrane. Orthologous to human PCDH8 (protocadherin 8); INTERACTS WITH 1,3-dinitrobenzene; 2,2',4,4'-Tetrabromodiphenyl ether; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
activity-regulated cadherin-like protein; Arcadlin; protocadherin-8
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PCDH8 (protocadherin 8)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Pcdh8 (protocadherin 8)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pcdh8 (protocadherin 8)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100983617 (protocadherin-8)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PCDH8 (protocadherin 8)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101972150 (protocadherin-8)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LOC100155738 (protocadherin-8)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PCDH8 (protocadherin 8)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pcdh8 (protocadherin 8)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PCDH8 (protocadherin 8)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pcdh8 (protocadherin 8)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:ch211-199f5.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pcdh8l
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Xenopus tropicalis (tropical clawed frog):
pcdh8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 61,607,521 - 61,612,090 (-) NCBI GRCr8 mRatBN7.2 15 55,198,470 - 55,203,039 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 55,198,459 - 55,205,872 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 59,313,542 - 59,317,323 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 60,431,918 - 60,435,699 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 57,256,791 - 57,260,575 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 62,196,469 - 62,201,498 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 62,197,060 - 62,200,837 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 65,856,803 - 65,861,374 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 61,056,994 - 61,060,741 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 61,072,773 - 61,076,521 (-) NCBI Celera 15 54,773,168 - 54,776,945 (-) NCBI Celera Cytogenetic Map 15 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pcdh8 Rat 1,3-dinitrobenzene decreases expression EXP 6480464 3-dinitrobenzene results in decreased expression of PCDH8 mRNA CTD PMID:24140754 Pcdh8 Rat 17beta-estradiol multiple interactions ISO PCDH8 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of PCDH8 mRNA CTD PMID:19619570 Pcdh8 Rat 17beta-estradiol increases expression ISO PCDH8 (Homo sapiens) 6480464 Estradiol results in increased expression of PCDH8 mRNA CTD PMID:19619570 Pcdh8 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Pcdh8 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PCDH8 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PCDH8 mRNA CTD PMID:19619570 Pcdh8 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pcdh8 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PCDH8 mRNA CTD PMID:21570461 Pcdh8 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pcdh8 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PCDH8 mRNA CTD PMID:19465110 Pcdh8 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PCDH8 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PCDH8 mRNA CTD PMID:19901195 Pcdh8 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO PCDH8 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of PCDH8 mRNA CTD PMID:19619570 Pcdh8 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO PCDH8 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Pcdh8 Rat 4,4'-sulfonyldiphenol affects methylation ISO Pcdh8 (Mus musculus) 6480464 bisphenol S affects the methylation of PCDH8 exon CTD PMID:33297965 Pcdh8 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PCDH8 mRNA CTD PMID:24780913 and PMID:25825206 Pcdh8 Rat acetaldehyde affects expression ISO Pcdh8 (Mus musculus) 6480464 Acetaldehyde affects the expression of PCDH8 mRNA CTD PMID:22634333 Pcdh8 Rat afimoxifene increases expression ISO PCDH8 (Homo sapiens) 6480464 afimoxifene results in increased expression of PCDH8 mRNA CTD PMID:19901195 Pcdh8 Rat aflatoxin B1 decreases methylation ISO PCDH8 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PCDH8 gene CTD PMID:27153756 Pcdh8 Rat all-trans-retinoic acid increases expression ISO PCDH8 (Homo sapiens) 6480464 Tretinoin results in increased expression of PCDH8 mRNA CTD PMID:21934132 Pcdh8 Rat all-trans-retinoic acid multiple interactions ISO Pcdh8 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PCDH8 mRNA CTD PMID:36189433 Pcdh8 Rat all-trans-retinoic acid decreases expression ISO Pcdh8 (Mus musculus) 6480464 Tretinoin results in decreased expression of PCDH8 mRNA CTD PMID:36189433 Pcdh8 Rat amiodarone increases expression ISO PCDH8 (Homo sapiens) 6480464 Amiodarone results in increased expression of PCDH8 mRNA CTD PMID:19774075 Pcdh8 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PCDH8 mRNA CTD PMID:16483693 Pcdh8 Rat amosite asbestos decreases methylation ISO PCDH8 (Homo sapiens) 6480464 Asbestos and Amosite results in decreased methylation of PCDH8 promoter CTD PMID:29626692 Pcdh8 Rat antimycin A increases expression ISO PCDH8 (Homo sapiens) 6480464 Antimycin A results in increased expression of PCDH8 mRNA CTD PMID:33512557 Pcdh8 Rat arsenite(3-) increases methylation ISO PCDH8 (Homo sapiens) 6480464 arsenite results in increased methylation of PCDH8 promoter CTD PMID:23974009 Pcdh8 Rat belinostat increases expression ISO PCDH8 (Homo sapiens) 6480464 belinostat results in increased expression of PCDH8 mRNA CTD PMID:26272509 Pcdh8 Rat benzo[a]pyrene decreases expression ISO Pcdh8 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PCDH8 mRNA CTD PMID:27195522 Pcdh8 Rat benzo[a]pyrene affects methylation ISO PCDH8 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PCDH8 exon and Benzo(a)pyrene affects the methylation of PCDH8 promoter CTD PMID:27901495 Pcdh8 Rat bisphenol A decreases expression ISO Pcdh8 (Mus musculus) 6480464 bisphenol A results in decreased expression of PCDH8 mRNA CTD PMID:24465770 Pcdh8 Rat bisphenol A increases methylation ISO PCDH8 (Homo sapiens) 6480464 bisphenol A results in increased methylation of PCDH8 gene CTD PMID:38898774 Pcdh8 Rat bisphenol A multiple interactions ISO PCDH8 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of PCDH8 gene CTD PMID:31601247 Pcdh8 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of PCDH8 mRNA CTD PMID:32479839 Pcdh8 Rat cadmium atom affects expression ISO PCDH8 (Homo sapiens) 6480464 Cadmium affects the expression of PCDH8 mRNA CTD PMID:21120746 Pcdh8 Rat chlorpyrifos decreases expression ISO Pcdh8 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PCDH8 mRNA CTD PMID:32715474 Pcdh8 Rat cocaine increases expression ISO PCDH8 (Homo sapiens) 6480464 Cocaine results in increased expression of PCDH8 mRNA and Cocaine results in increased expression of PCDH8 protein CTD PMID:18000554 Pcdh8 Rat crocidolite asbestos increases expression ISO Pcdh8 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of PCDH8 mRNA CTD PMID:29279043 Pcdh8 Rat crocidolite asbestos decreases methylation ISO PCDH8 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased methylation of PCDH8 promoter CTD PMID:29626692 Pcdh8 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PCDH8 mRNA CTD PMID:26577399 Pcdh8 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of PCDH8 mRNA CTD PMID:23640034 Pcdh8 Rat decabromodiphenyl ether multiple interactions EXP 6480464 [Flame Retardants co-treated with pentabromodiphenyl ether co-treated with decabromobiphenyl ether co-treated with hexabromocyclododecane] results in decreased expression of PCDH8 mRNA CTD PMID:32207525 Pcdh8 Rat dorsomorphin multiple interactions ISO PCDH8 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pcdh8 Rat doxorubicin decreases expression ISO PCDH8 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PCDH8 mRNA CTD PMID:29803840 Pcdh8 Rat entinostat increases expression ISO PCDH8 (Homo sapiens) 6480464 entinostat results in increased expression of PCDH8 mRNA CTD PMID:26272509 Pcdh8 Rat entinostat multiple interactions ISO PCDH8 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PCDH8 mRNA CTD PMID:27188386 Pcdh8 Rat ethanol increases expression ISO Pcdh8 (Mus musculus) 6480464 Ethanol results in increased expression of PCDH8 mRNA CTD PMID:30319688 Pcdh8 Rat ethanol multiple interactions ISO Pcdh8 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of PCDH8 mRNA CTD PMID:30319688 Pcdh8 Rat flusilazole affects expression ISO Pcdh8 (Mus musculus) 6480464 flusilazole affects the expression of PCDH8 mRNA CTD PMID:22634333 Pcdh8 Rat fulvestrant multiple interactions ISO PCDH8 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of PCDH8 gene CTD PMID:31601247 Pcdh8 Rat genistein decreases expression ISO Pcdh8 (Mus musculus) 6480464 Genistein results in decreased expression of PCDH8 mRNA CTD PMID:32186404 Pcdh8 Rat GW 4064 increases expression ISO Pcdh8 (Mus musculus) 6480464 GW 4064 results in increased expression of PCDH8 mRNA CTD PMID:26655953 Pcdh8 Rat mercury dibromide multiple interactions ISO PCDH8 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PCDH8 mRNA CTD PMID:27188386 Pcdh8 Rat methylmercury chloride affects expression EXP 6480464 methylmercuric chloride affects the expression of PCDH8 mRNA CTD PMID:20864626 Pcdh8 Rat methylmercury chloride decreases expression ISO PCDH8 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PCDH8 mRNA CTD PMID:28001369 Pcdh8 Rat methylmercury chloride increases expression ISO PCDH8 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PCDH8 mRNA CTD PMID:26272509 Pcdh8 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Pcdh8 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PCDH8 mRNA CTD PMID:36189433 Pcdh8 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Pcdh8 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of PCDH8 mRNA CTD PMID:36189433 Pcdh8 Rat monosodium L-glutamate increases expression ISO Pcdh8 (Mus musculus) 6480464 Sodium Glutamate results in increased expression of PCDH8 mRNA CTD PMID:22078008 Pcdh8 Rat nickel atom decreases expression ISO PCDH8 (Homo sapiens) 6480464 Nickel results in decreased expression of PCDH8 mRNA CTD PMID:25583101 Pcdh8 Rat p-chloromercuribenzoic acid decreases expression ISO PCDH8 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of PCDH8 mRNA CTD PMID:26272509 Pcdh8 Rat p-chloromercuribenzoic acid multiple interactions ISO PCDH8 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PCDH8 mRNA CTD PMID:27188386 Pcdh8 Rat panobinostat multiple interactions ISO PCDH8 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PCDH8 mRNA CTD PMID:27188386 Pcdh8 Rat panobinostat increases expression ISO PCDH8 (Homo sapiens) 6480464 panobinostat results in increased expression of PCDH8 mRNA CTD PMID:26272509 Pcdh8 Rat resveratrol multiple interactions ISO PCDH8 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of PCDH8 mRNA CTD PMID:23557933 Pcdh8 Rat rotenone decreases expression ISO PCDH8 (Homo sapiens) 6480464 Rotenone results in decreased expression of PCDH8 mRNA CTD PMID:29955902 Pcdh8 Rat SB 431542 multiple interactions ISO PCDH8 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pcdh8 Rat sodium arsenite increases expression ISO PCDH8 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PCDH8 mRNA CTD PMID:38568856 Pcdh8 Rat Soman increases expression EXP 6480464 Soman results in increased expression of PCDH8 mRNA CTD PMID:19281266 Pcdh8 Rat tebufenpyrad increases expression ISO PCDH8 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of PCDH8 mRNA CTD PMID:33512557 Pcdh8 Rat thifluzamide increases expression ISO PCDH8 (Homo sapiens) 6480464 thifluzamide results in increased expression of PCDH8 mRNA CTD PMID:33512557 Pcdh8 Rat thiram increases expression ISO PCDH8 (Homo sapiens) 6480464 Thiram results in increased expression of PCDH8 mRNA CTD PMID:38568856 Pcdh8 Rat titanium dioxide decreases methylation ISO Pcdh8 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PCDH8 gene and titanium dioxide results in decreased methylation of PCDH8 promoter CTD PMID:35295148 Pcdh8 Rat trichostatin A increases expression ISO PCDH8 (Homo sapiens) 6480464 trichostatin A results in increased expression of PCDH8 mRNA CTD PMID:24935251 and PMID:26272509 Pcdh8 Rat trichostatin A multiple interactions ISO PCDH8 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PCDH8 mRNA CTD PMID:27188386 Pcdh8 Rat triclosan decreases expression ISO PCDH8 (Homo sapiens) 6480464 Triclosan results in decreased expression of PCDH8 mRNA CTD PMID:30510588 Pcdh8 Rat triptonide increases expression ISO Pcdh8 (Mus musculus) 6480464 triptonide results in increased expression of PCDH8 mRNA CTD PMID:33045310 Pcdh8 Rat valproic acid affects expression ISO Pcdh8 (Mus musculus) 6480464 Valproic Acid affects the expression of PCDH8 mRNA CTD PMID:17292431 Pcdh8 Rat valproic acid increases methylation ISO PCDH8 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PCDH8 gene CTD PMID:29154799 Pcdh8 Rat valproic acid affects expression ISO PCDH8 (Homo sapiens) 6480464 Valproic Acid affects the expression of PCDH8 mRNA CTD PMID:25979313 Pcdh8 Rat valproic acid increases expression ISO PCDH8 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PCDH8 mRNA CTD PMID:23179753 more ... Pcdh8 Rat valproic acid decreases expression ISO PCDH8 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PCDH8 mRNA CTD PMID:23179753 and PMID:27188386 Pcdh8 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of PCDH8 mRNA CTD PMID:22615374
1,3-dinitrobenzene (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetaldehyde (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amiodarone (ISO) ammonium chloride (EXP) amosite asbestos (ISO) antimycin A (ISO) arsenite(3-) (ISO) belinostat (ISO) benzo[a]pyrene (ISO) bisphenol A (ISO) bromobenzene (EXP) cadmium atom (ISO) chlorpyrifos (ISO) cocaine (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) decabromodiphenyl ether (EXP) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) flusilazole (ISO) fulvestrant (ISO) genistein (ISO) GW 4064 (ISO) mercury dibromide (ISO) methylmercury chloride (EXP,ISO) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (ISO) nickel atom (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) resveratrol (ISO) rotenone (ISO) SB 431542 (ISO) sodium arsenite (ISO) Soman (EXP) tebufenpyrad (ISO) thifluzamide (ISO) thiram (ISO) titanium dioxide (ISO) trichostatin A (ISO) triclosan (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP)
Pcdh8 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 61,607,521 - 61,612,090 (-) NCBI GRCr8 mRatBN7.2 15 55,198,470 - 55,203,039 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 55,198,459 - 55,205,872 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 59,313,542 - 59,317,323 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 60,431,918 - 60,435,699 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 57,256,791 - 57,260,575 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 62,196,469 - 62,201,498 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 62,197,060 - 62,200,837 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 65,856,803 - 65,861,374 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 61,056,994 - 61,060,741 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 61,072,773 - 61,076,521 (-) NCBI Celera 15 54,773,168 - 54,776,945 (-) NCBI Celera Cytogenetic Map 15 q12 NCBI
PCDH8 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 52,842,889 - 52,848,640 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 52,842,889 - 52,848,641 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 53,417,024 - 53,422,775 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 52,316,110 - 52,320,775 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 52,316,111 - 52,320,775 NCBI Celera 13 34,403,981 - 34,408,646 (-) NCBI Celera Cytogenetic Map 13 q14.3 NCBI HuRef 13 34,132,296 - 34,136,846 (-) NCBI HuRef CHM1_1 13 53,386,066 - 53,390,732 (-) NCBI CHM1_1 T2T-CHM13v2.0 13 52,058,334 - 52,064,085 (-) NCBI T2T-CHM13v2.0
Pcdh8 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 80,004,224 - 80,008,752 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 80,004,215 - 80,008,752 (-) Ensembl GRCm39 Ensembl GRCm38 14 79,766,772 - 79,771,312 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 79,766,775 - 79,771,312 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 80,166,582 - 80,171,119 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 78,500,948 - 78,505,388 (-) NCBI MGSCv36 mm8 Celera 14 77,267,150 - 77,271,687 (-) NCBI Celera Cytogenetic Map 14 D3 NCBI cM Map 14 42.76 NCBI
Pcdh8 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955404 50,403,752 - 50,413,264 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100983617 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 54,183,685 - 54,188,750 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 52,827,777 - 52,833,666 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 33,880,543 - 33,886,243 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 52,687,943 - 52,692,601 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 52,688,522 - 52,692,399 (-) Ensembl panpan1.1 panPan2
PCDH8 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 22 9,860,590 - 9,865,298 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 22 9,860,827 - 9,865,412 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 22 9,857,555 - 9,862,239 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 22 10,085,702 - 10,090,390 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 22 10,085,937 - 10,090,183 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 22 9,782,421 - 9,787,104 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 22 9,832,472 - 9,837,157 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 22 9,847,219 - 9,851,906 (-) NCBI UU_Cfam_GSD_1.0
LOC101972150 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
LOC100155738 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 26,127,401 - 26,132,123 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 26,127,398 - 26,133,481 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 26,882,342 - 26,887,069 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PCDH8 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 30,602,449 - 30,610,656 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 30,602,321 - 30,606,926 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666057 13,206,860 - 13,211,564 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pcdh8 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 33 Count of miRNA genes: 33 Interacting mature miRNAs: 33 Transcripts: ENSRNOT00000017599 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 724545 Niddm54 Non-insulin dependent diabetes mellitus QTL 54 0.02 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 50794494 73699215 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 2293686 Bmd36 Bone mineral density QTL 36 7.4 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 15 33611058 71477291 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 2293691 Bmd37 Bone mineral density QTL 37 6.6 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 15 33611058 71477291 Rat 2317050 Aia24 Adjuvant induced arthritis QTL 24 2.06 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 15 52847908 73690657 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 1300144 Rf23 Renal function QTL 23 3.61 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 15 40631268 98288169 Rat 1576315 Schws6 Schwannoma susceptibility QTL 6 0.0069 nervous system integrity trait (VT:0010566) post-insult time of death (CMO:0002005) 15 53806152 98806152 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 10054130 Srcrt8 Stress Responsive Cort QTL 8 2.18 0.0085 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 15 22117933 67117933 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 1598828 Glom14 Glomerulus QTL 14 2.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 15 34054139 79054139 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat
42.MMHAP38FLF6.seq
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 55,199,005 - 55,199,187 (+) MAPPER mRatBN7.2 Rnor_6.0 15 62,197,005 - 62,197,186 NCBI Rnor6.0 Rnor_5.0 15 65,857,339 - 65,857,520 UniSTS Rnor5.0 RGSC_v3.4 15 61,056,939 - 61,057,120 UniSTS RGSC3.4 Celera 15 54,773,113 - 54,773,294 UniSTS Cytogenetic Map 15 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
7
3
12
109
42
25
22
8
22
2
112
35
93
45
54
3
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017599 ⟹ ENSRNOP00000017599
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 55,198,459 - 55,205,872 (-) Ensembl Rnor_6.0 Ensembl 15 62,197,060 - 62,200,837 (-) Ensembl
RefSeq Acc Id:
NM_001411975 ⟹ NP_001398904
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 61,607,521 - 61,612,090 (-) NCBI mRatBN7.2 15 55,198,470 - 55,203,039 (-) NCBI
RefSeq Acc Id:
NM_022868 ⟹ NP_074059
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 61,607,521 - 61,612,090 (-) NCBI mRatBN7.2 15 55,198,470 - 55,203,039 (-) NCBI Rnor_6.0 15 62,197,060 - 62,200,837 (-) NCBI Rnor_5.0 15 65,856,803 - 65,861,374 (-) NCBI RGSC_v3.4 15 61,056,994 - 61,060,741 (-) RGD Celera 15 54,773,168 - 54,776,945 (-) RGD
Sequence:
ATGAGTCCAGTGAAGCGCTGGGGCAGCCCCTGCCTTTTCCCCTTGCAGCTATTTAGTCTCTGCTGGGTGCTCTCAGTGGCCCAGAGCAAGACAGTCCGATACAGCACCTTCGAAGAGGATGCCCCTGG CACAGTCATCGGGACCCTTGCAGAGGATCTGCATATGAAAGTGTCTGGAGACACAAGCTTCCGCCTGATGAAGCAATTCAACAGCTCTCTGCTCCGGGTACGCGAGGGGGACGGGCAGCTGACCGTCG GGGATGCAGGCCTGGACCGGGAGCGCCTGTGTGGCCAGTCCCCACAGTGTGTGCTGGCCTTCGATGTTGTCAGCTTCTCGCAGGAACAGTTCCGGCTTGTGCACGTGGAGGTGGAGGTGAGGGATGTA AACGACCACGCGCCCCGCTTTCCCCGAGCCCAGATCCCGGTGGAGGTCTCAGAGAGTGCTCCGGTAGGCACGCGCATCCCCCTGGAGGTGCCTGTAGACGAGGACGTGGGTGCCAATGGGCTGCAGAG TGTACGCCTGGCCGAGCCTCACAGCCCCTTCCGAGTGGAGCTGCAGACGCGCGCGGACGGTGCCCAGTGTGCGGACCTGGTGCTGCTACAGGAGCTGGACCGCGAGAGCCAGGCCTCCTACAGCCTGG AGCTGGTGGCTCAGGACGGCGGGCGACCGCCGCGTTCCGCCACAGCAGCCCTCAGCGTGCGTGTGCTAGATGCCAATGACCATAGCCCGGCCTTCCCGCAGGGTGCCGTGGCGGAGGTGGAATTGGCC GAGGACGCACCTGTGGGATCGCTGCTGCTGGACCTGGACGCTGCCGATCCCGACGAAGGTCCCAACGGCGACGTTGTGTTCACCTTTGGCGCCCGCACCCCTCCCGAAGCCCGCCACCTTTTCCGGCT CGACCCACGCTCTGGCCGCCTCACCTTGGCTGGGCAGGTGGACTACGAGCGCCAAGATACCTATGAGCTGGACGTGCGGGCTCAAGACCGAGGCCCAGGACCCCGGACAGCCACCTGCAAGGTCATCG TGCGCATCCGAGACGTCAACGACAACCCTCCTGATATTTCTATCACCCCTCTGGCCGCCCCCGGGGCTCCAGCCACCTCGCCCTTCGCAGCCGCTGCCGCTGCCGCCGCACTTGGAGGAGCGGACGCA GCCTCGTCGGCAGGGTCTGGAACACAGGAAACCGGCGTCACCTCGTTGGTGCCAGAGGGGGCGGCGCGGGAGAGCCTAGTGGCGCTGGTCAGCACCTCGGACAGGGACTCTGGCGCCAACGGGCAGGT GCGCTGCGCCCTCTACGGGCACGAGCACTTTAGGCTACAGCCGGCCTATGCTGGCAGCTACCTGGTGGTGACCGCCGCATCTCTGGACCGGGAGCGCATCGCGGAGTACAACCTGACGCTGGTGGCCG AAGACCGTGGCGCGCCCCCTCTGCGCACTGTCAGGCCCTACACCGTGCGCGTGGGTGACGAGAATGACAACGCTCCACTCTTCACCAAGCCAGTCTACGAGGTGTCAGTCCGCGAAAACAACCCTCCG GGCGCCTACCTGGCCACAGTGGCCGCCCGCGACCCTGACCTGGGCCGCAACGGTCAGGTCACCTACCGGCTGGTAGAGGCCGAAGTGGGGCGCTCCGGGGAAGCCGTGTCCACTTACGTCTCAGTAGA CCCGGCTACCGGGGCCATCTACGCTCTGCGTAGCTTTGACTATGAGACTCTGCGCCAGCTTGACGTGCGTGTCCAGGCCAGCGACGGCGGTTCCCCTCAGCTTTCCAGCAATGCTCTGGTGCAAGTGC GAGTGCTGGACCAGAACGATCACTCTCCGGTCCTCGTGCATCCGGCGCCGGCCAATGGCTCCCTAGAAGTAGCAGTCCCTGGACGTTCCACCAAGGACACAGCTGTGGCACGCATCCAGGCCCGGGAT GCAGACGAAGGAGCCAACGGGGAACTGGCCTTCGATCTCCTGCAGCAGGAGCCACGCGAGGCCTTCTCCATAGGCCGCCACACGGGGGAGATCGTGCTCACCGGAGACCTCTCGCAGGAGCCTCCTGG CCGCGTGTTCAAGGCCCTACTGGTCATATCCGACGGCGGCCGCCCCCCTCTCACCACCACAGCAACCGTCAGTTTCGTGGTAACAGCCGGTGGTGGGTCAGCTGTGCCTGCCAGCGCCGGGAGCCCGG AGCACTTCCGGCCACCCGGCTCTCGCCTCGCGCCGTCGGGGCCTTCGCTGCAGTGGGACACGCCGCTGATCGTCATCATCGTGTTAGCCGGGAGCTGCACCCTGCTGCTTGCAGCCATCATCGCCATC GCCACCACCTGCAACCGCCGCAAGAAGGAGCCCTACAGTGCCTCTCCGGGCTTTGGGAAGGAGCCTGCGCCCCCTGTTGCAGTCTGGAAGGGCCATTCATTCAACACCATCTCAGGCCGAGAAGCTGA GAAGTTCAGTGGGAAAGACAGCGGGAAAGGAGACAGTGATTTCAATGACAGTGACTCGGACATCAGCGGGGACGCCTTGAAAAAAGACCTCATCAACCACATGCAGAGTGGACTGTGGGCATGCACGG CTGAGTGCAAGATCCTAGGCCATTCTGATCGCTGCTGGAGCCCATCCTGTGCCGGACCCAACACACACCCGCCTCCTCACCCACCAGCCCAGATGTCAACCTTCTGTAAGAGCACGTCCCTGCCTCGG GATCCTCTGCGCAGGGACAATTACTACCAGGCCCAGCTCCCCAAGACAGTGGGGCTGCAGAGCGTCTATGAGAAAGTGCTGCATAGAGACTATGACAGGACAGTCACTTTGCTCTCCCCTCCCCGTCC AGGAAGGCTCCCAGACCTGCAGGAGATTGGAGTACCCCTCTATGAGTCCCCTCCTGGTGGCAGATATGTGTCCCCGAAGAAGGGAACCAATGAAAATGTGTAA
hide sequence
RefSeq Acc Id:
NP_074059 ⟸ NM_022868
- Peptide Label:
isoform 2 precursor
- UniProtKB:
A6HU10 (UniProtKB/TrEMBL)
- Sequence:
MSPVKRWGSPCLFPLQLFSLCWVLSVAQSKTVRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQSPQCVLAFDVVSFSQEQFRLVHVEVEVRDV NDHAPRFPRAQIPVEVSESAPVGTRIPLEVPVDEDVGANGLQSVRLAEPHSPFRVELQTRADGAQCADLVLLQELDRESQASYSLELVAQDGGRPPRSATAALSVRVLDANDHSPAFPQGAVAEVELA EDAPVGSLLLDLDAADPDEGPNGDVVFTFGARTPPEARHLFRLDPRSGRLTLAGQVDYERQDTYELDVRAQDRGPGPRTATCKVIVRIRDVNDNPPDISITPLAAPGAPATSPFAAAAAAAALGGADA ASSAGSGTQETGVTSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAGSYLVVTAASLDRERIAEYNLTLVAEDRGAPPLRTVRPYTVRVGDENDNAPLFTKPVYEVSVRENNPP GAYLATVAARDPDLGRNGQVTYRLVEAEVGRSGEAVSTYVSVDPATGAIYALRSFDYETLRQLDVRVQASDGGSPQLSSNALVQVRVLDQNDHSPVLVHPAPANGSLEVAVPGRSTKDTAVARIQARD ADEGANGELAFDLLQQEPREAFSIGRHTGEIVLTGDLSQEPPGRVFKALLVISDGGRPPLTTTATVSFVVTAGGGSAVPASAGSPEHFRPPGSRLAPSGPSLQWDTPLIVIIVLAGSCTLLLAAIIAI ATTCNRRKKEPYSASPGFGKEPAPPVAVWKGHSFNTISGREAEKFSGKDSGKGDSDFNDSDSDISGDALKKDLINHMQSGLWACTAECKILGHSDRCWSPSCAGPNTHPPPHPPAQMSTFCKSTSLPR DPLRRDNYYQAQLPKTVGLQSVYEKVLHRDYDRTVTLLSPPRPGRLPDLQEIGVPLYESPPGGRYVSPKKGTNENV
hide sequence
Ensembl Acc Id:
ENSRNOP00000017599 ⟸ ENSRNOT00000017599
RefSeq Acc Id:
NP_001398904 ⟸ NM_001411975
- Peptide Label:
isoform 1 precursor
- UniProtKB:
D3ZE55 (UniProtKB/Swiss-Prot), A1A5N4 (UniProtKB/Swiss-Prot), Q9WVR2 (UniProtKB/Swiss-Prot)
BioCyc Gene
G2FUF-12983
BioCyc
Ensembl Genes
ENSRNOG00000013101
Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript
ENSRNOT00000017599.4
UniProtKB/Swiss-Prot
Gene3D-CATH
Cadherins
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE
IMAGE:8362872
IMAGE-MGC_LOAD
InterPro
Cadherin-like_dom
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Cadherin-like_sf
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Cadherin_CS
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Cadherin_N
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Protocadherin/Cadherin-CA
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report
rno:64865
UniProtKB/Swiss-Prot
MGC_CLONE
MGC:156642
IMAGE-MGC_LOAD
NCBI Gene
64865
ENTREZGENE
PANTHER
CADHERIN-87A
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROTOCADHERIN-8
UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
Pfam
Cadherin
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Cadherin_2
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen
Pcdh8
PhenoGen
PRINTS
CADHERIN
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE
CADHERIN_1
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
CADHERIN_2
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx
ENSRNOG00000013101
RatGTEx
SMART
SM00112
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP
Cadherin-like
UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
TIGR
TC232455
UniProt
A1A5N4
ENTREZGENE
A6HU10
ENTREZGENE, UniProtKB/TrEMBL
D3ZE55
ENTREZGENE, UniProtKB/Swiss-Prot
Q9WVR2
ENTREZGENE
UniProt Secondary
A1A5N4
UniProtKB/Swiss-Prot
Q9WVR2
UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Pcdh8
protocadherin 8
Name updated
70584
APPROVED
Note Type
Note
Reference
gene_domains
contains six cadherin repeats
68758
gene_expression
expressed in synapses
68758
gene_protein
972 amino acids; 103.7 kDa,
68758
gene_regulation
induced in hippocampal granule cells by seizures, and by N-methyl-D-aspartate-dependent synaptic activity in long term potentiation
68758