Symbol:
St3gal2
Name:
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
RGD ID:
68413
Description:
Enables beta-galactoside (CMP) alpha-2,3-sialyltransferase activity. Involved in ganglioside biosynthetic process via lactosylceramide. Predicted to be located in Golgi membrane. Predicted to be active in membrane. Orthologous to human ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2); PARTICIPATES IN ganglioside metabolic pathway; globoside metabolic pathway; keratan sulfate biosynthetic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,4-methylenedioxymethamphetamine; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
alpha 2,3-ST 2; beta-galactoside alpha-2,3-sialyltransferase 2; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2; gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase; gal-NAc6S; monosialoganglioside sialyltransferase; sialyltransferase 4B (beta-galactoside alpha-2,3-sialyltransferase); sialyltransferase 5; SIAT4-B; Siat4b; Siat5; ST3Gal II; ST3GALA.2; ST3GalII
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
St3gal2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
St3gal2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
St3gal2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
St3gal2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
LATS2 (large tumor suppressor kinase 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
St3gal2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
st3gal2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
st3gal2.1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 55,798,112 - 55,849,226 (+) NCBI GRCr8 mRatBN7.2 19 38,888,851 - 38,939,874 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 38,923,999 - 38,939,869 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 45,728,513 - 45,744,388 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 46,381,856 - 46,397,731 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 48,692,765 - 48,708,643 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 43,273,251 - 43,324,265 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 43,274,493 - 43,290,363 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 54,101,504 - 54,152,583 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 40,873,202 - 40,889,072 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 40,892,278 - 40,892,994 (-) NCBI Celera 19 38,316,282 - 38,332,162 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
St3gal2 Rat 1,1-dichloroethene increases expression ISO St3gal2 (Mus musculus) 6480464 vinylidene chloride results in increased expression of ST3GAL2 mRNA CTD PMID:26682919 St3gal2 Rat 1,2-dimethylhydrazine increases expression ISO St3gal2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ST3GAL2 mRNA CTD PMID:22206623 St3gal2 Rat 17beta-estradiol increases expression ISO ST3GAL2 (Homo sapiens) 6480464 Estradiol results in increased expression of ST3GAL2 mRNA CTD PMID:19429434 St3gal2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ST3GAL2 mRNA CTD PMID:22298810 St3gal2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ST3GAL2 mRNA CTD PMID:33387578 St3gal2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO St3gal2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ST3GAL2 mRNA CTD PMID:21570461 St3gal2 Rat 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of ST3GAL2 mRNA CTD PMID:30071829 St3gal2 Rat 4,4'-sulfonyldiphenol decreases methylation ISO St3gal2 (Mus musculus) 6480464 bisphenol S results in decreased methylation of ST3GAL2 exon CTD PMID:33297965 St3gal2 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ST3GAL2 mRNA CTD PMID:36041667 St3gal2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ST3GAL2 mRNA CTD PMID:24780913 St3gal2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ST3GAL2 mRNA CTD PMID:28959563 St3gal2 Rat aflatoxin B1 decreases methylation ISO ST3GAL2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ST3GAL2 intron CTD PMID:30157460 St3gal2 Rat all-trans-retinoic acid increases expression ISO ST3GAL2 (Homo sapiens) 6480464 Tretinoin results in increased expression of ST3GAL2 mRNA CTD PMID:33167477 St3gal2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ST3GAL2 mRNA CTD PMID:16483693 St3gal2 Rat arsane affects methylation ISO ST3GAL2 (Homo sapiens) 6480464 Arsenic affects the methylation of ST3GAL2 gene CTD PMID:25304211 St3gal2 Rat arsenic atom affects methylation ISO ST3GAL2 (Homo sapiens) 6480464 Arsenic affects the methylation of ST3GAL2 gene CTD PMID:25304211 St3gal2 Rat arsenous acid decreases expression ISO ST3GAL2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ST3GAL2 mRNA CTD PMID:20458559 St3gal2 Rat arsenous acid increases expression ISO St3gal2 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of ST3GAL2 mRNA CTD PMID:29095437 St3gal2 Rat arsenous acid increases expression ISO ST3GAL2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ST3GAL2 mRNA CTD PMID:20458559 St3gal2 Rat arsenous acid multiple interactions ISO St3gal2 (Mus musculus) 6480464 Metformin inhibits the reaction [Arsenic Trioxide results in increased expression of ST3GAL2 mRNA] CTD PMID:29095437 St3gal2 Rat benzo[a]pyrene decreases expression ISO St3gal2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ST3GAL2 mRNA CTD PMID:19770486 St3gal2 Rat benzo[a]pyrene increases methylation ISO ST3GAL2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ST3GAL2 5' UTR CTD PMID:27901495 St3gal2 Rat benzo[a]pyrene increases expression ISO St3gal2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ST3GAL2 mRNA CTD PMID:22228805 St3gal2 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of ST3GAL2 mRNA CTD PMID:18164116 St3gal2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ST3GAL2 mRNA CTD PMID:25181051 St3gal2 Rat bisphenol A decreases expression ISO ST3GAL2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ST3GAL2 mRNA CTD PMID:36232920 St3gal2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ST3GAL2 mRNA CTD PMID:36041667 St3gal2 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ST3GAL2 mRNA CTD PMID:36041667 St3gal2 Rat cannabidiol decreases expression ISO ST3GAL2 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of ST3GAL2 mRNA CTD PMID:33244087 St3gal2 Rat captan decreases expression ISO St3gal2 (Mus musculus) 6480464 Captan results in decreased expression of ST3GAL2 mRNA CTD PMID:31558096 St3gal2 Rat choline multiple interactions ISO St3gal2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ST3GAL2 mRNA CTD PMID:20938992 St3gal2 Rat copper atom multiple interactions ISO St3gal2 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of ST3GAL2 mRNA CTD PMID:15467011 St3gal2 Rat copper(0) multiple interactions ISO St3gal2 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of ST3GAL2 mRNA CTD PMID:15467011 St3gal2 Rat copper(II) sulfate decreases expression ISO ST3GAL2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ST3GAL2 mRNA CTD PMID:19549813 St3gal2 Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in increased expression of ST3GAL2 mRNA] CTD PMID:20032058 St3gal2 Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of ST3GAL2 mRNA CTD PMID:20032058 St3gal2 Rat diarsenic trioxide increases expression ISO St3gal2 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of ST3GAL2 mRNA CTD PMID:29095437 St3gal2 Rat diarsenic trioxide multiple interactions ISO St3gal2 (Mus musculus) 6480464 Metformin inhibits the reaction [Arsenic Trioxide results in increased expression of ST3GAL2 mRNA] CTD PMID:29095437 St3gal2 Rat diarsenic trioxide increases expression ISO ST3GAL2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ST3GAL2 mRNA CTD PMID:20458559 St3gal2 Rat diarsenic trioxide decreases expression ISO ST3GAL2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ST3GAL2 mRNA CTD PMID:20458559 St3gal2 Rat diazinon increases methylation ISO ST3GAL2 (Homo sapiens) 6480464 Diazinon results in increased methylation of ST3GAL2 gene CTD PMID:22964155 St3gal2 Rat dicrotophos increases expression ISO ST3GAL2 (Homo sapiens) 6480464 dicrotophos results in increased expression of ST3GAL2 mRNA CTD PMID:28302478 St3gal2 Rat dieldrin affects methylation ISO St3gal2 (Mus musculus) 6480464 Dieldrin affects the methylation of ST3GAL2 gene CTD PMID:38995845 St3gal2 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of ST3GAL2 mRNA CTD PMID:25152437 St3gal2 Rat doxorubicin decreases expression ISO ST3GAL2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ST3GAL2 mRNA CTD PMID:29803840 St3gal2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ST3GAL2 mRNA CTD PMID:29391264 St3gal2 Rat ethanol increases expression ISO St3gal2 (Mus musculus) 6480464 Ethanol results in increased expression of ST3GAL2 mRNA CTD PMID:30319688 St3gal2 Rat ethanol affects splicing ISO St3gal2 (Mus musculus) 6480464 Ethanol affects the splicing of ST3GAL2 mRNA CTD PMID:30319688 St3gal2 Rat folic acid multiple interactions ISO St3gal2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ST3GAL2 mRNA CTD PMID:20938992 St3gal2 Rat folpet decreases expression ISO St3gal2 (Mus musculus) 6480464 folpet results in decreased expression of ST3GAL2 mRNA CTD PMID:31558096 St3gal2 Rat furan decreases expression EXP 6480464 furan results in decreased expression of ST3GAL2 mRNA CTD PMID:25539665 St3gal2 Rat furan increases expression EXP 6480464 furan results in increased expression of ST3GAL2 mRNA CTD PMID:27387713 St3gal2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ST3GAL2 mRNA CTD PMID:33387578 St3gal2 Rat hydrogen cyanide decreases expression ISO St3gal2 (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of ST3GAL2 mRNA CTD PMID:33914522 St3gal2 Rat L-methionine multiple interactions ISO St3gal2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ST3GAL2 mRNA CTD PMID:20938992 St3gal2 Rat metformin multiple interactions ISO St3gal2 (Mus musculus) 6480464 Metformin inhibits the reaction [Arsenic Trioxide results in increased expression of ST3GAL2 mRNA] CTD PMID:29095437 St3gal2 Rat methyl methanesulfonate decreases expression ISO ST3GAL2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of ST3GAL2 mRNA CTD PMID:23649840 St3gal2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of ST3GAL2 mRNA CTD PMID:18164116 St3gal2 Rat ozone multiple interactions ISO St3gal2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of ST3GAL2 mRNA CTD PMID:34911549 St3gal2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ST3GAL2 mRNA CTD PMID:33387578 St3gal2 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of ST3GAL2 mRNA CTD PMID:18158353 St3gal2 Rat phosgene affects expression ISO St3gal2 (Mus musculus) 6480464 Phosgene affects the expression of ST3GAL2 mRNA CTD PMID:16300373 St3gal2 Rat pirinixic acid increases expression ISO St3gal2 (Mus musculus) 6480464 pirinixic acid results in increased expression of ST3GAL2 mRNA CTD PMID:18301758 and PMID:23811191 St3gal2 Rat potassium cyanide decreases expression ISO St3gal2 (Mus musculus) 6480464 Potassium Cyanide results in decreased expression of ST3GAL2 mRNA CTD PMID:33914522 St3gal2 Rat raloxifene increases expression ISO ST3GAL2 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of ST3GAL2 mRNA CTD PMID:19429434 St3gal2 Rat rotenone increases expression ISO St3gal2 (Mus musculus) 6480464 Rotenone results in increased expression of ST3GAL2 mRNA CTD PMID:32937126 St3gal2 Rat sodium arsenite increases expression ISO ST3GAL2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ST3GAL2 mRNA CTD PMID:38568856 St3gal2 Rat sunitinib decreases expression ISO ST3GAL2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ST3GAL2 mRNA CTD PMID:31533062 St3gal2 Rat tamoxifen increases expression ISO ST3GAL2 (Homo sapiens) 6480464 Tamoxifen results in increased expression of ST3GAL2 mRNA CTD PMID:19429434 St3gal2 Rat testosterone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in increased expression of ST3GAL2 mRNA] CTD PMID:20032058 St3gal2 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of ST3GAL2 mRNA CTD PMID:15963342 St3gal2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ST3GAL2 mRNA CTD PMID:34492290 St3gal2 Rat titanium dioxide decreases methylation ISO St3gal2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ST3GAL2 gene CTD PMID:35295148 St3gal2 Rat titanium dioxide increases methylation ISO St3gal2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of ST3GAL2 gene CTD PMID:35295148 St3gal2 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of ST3GAL2 mRNA CTD PMID:25729387 St3gal2 Rat triphenyl phosphate affects expression ISO ST3GAL2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ST3GAL2 mRNA CTD PMID:37042841 St3gal2 Rat triptonide decreases expression ISO St3gal2 (Mus musculus) 6480464 triptonide results in decreased expression of ST3GAL2 mRNA CTD PMID:33045310 St3gal2 Rat tunicamycin decreases expression ISO St3gal2 (Mus musculus) 6480464 Tunicamycin results in decreased expression of ST3GAL2 mRNA CTD PMID:17127020 St3gal2 Rat undecane increases expression EXP 6480464 undecane results in increased expression of ST3GAL2 protein CTD PMID:17337753 St3gal2 Rat valproic acid affects expression ISO ST3GAL2 (Homo sapiens) 6480464 Valproic Acid affects the expression of ST3GAL2 mRNA CTD PMID:25979313 St3gal2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of ST3GAL2 mRNA CTD PMID:23034163
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
St3gal2 Rat beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminide alpha-2,3- sialyltransferase enables ISO ST3GAL2 (Homo sapiens) 1624291 PMID:9266697 RGD PMID:9266697 St3gal2 Rat beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminide alpha-2,3- sialyltransferase enables IEA RHEA:18021 1600115 GO_REF:0000116 RHEA GO_REF:0000116 St3gal2 Rat beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminide alpha-2,3- sialyltransferase enables IEA UniProtKB:Q16842 and ensembl:ENSP000003454771600115 GO_REF:0000107 Ensembl GO_REF:0000107 St3gal2 Rat beta-galactoside (CMP) alpha-2,3-sialyltransferase activity enables ISO ST3GAL2 (Homo sapiens) 1624291 PMID:12716912 more ... RGD PMID:12716912 more ... St3gal2 Rat beta-galactoside (CMP) alpha-2,3-sialyltransferase activity enables IEA UniProtKB:Q11204 and ensembl:ENSMUSP00000034197 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 St3gal2 Rat beta-galactoside (CMP) alpha-2,3-sialyltransferase activity enables IEA UniProtKB:Q16842 and ensembl:ENSP000003454771600115 GO_REF:0000107 Ensembl GO_REF:0000107 St3gal2 Rat beta-galactoside (CMP) alpha-2,3-sialyltransferase activity enables ISO St3gal2 (Mus musculus) 1624291 PMID:8144500 and PMID:9184827 RGD PMID:8144500 and PMID:9184827 St3gal2 Rat beta-galactoside (CMP) alpha-2,3-sialyltransferase activity enables IBA MGI:98304 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 St3gal2 Rat beta-galactoside (CMP) alpha-2,3-sialyltransferase activity enables IEA RHEA:21616 1600115 GO_REF:0000116 RHEA GO_REF:0000116 St3gal2 Rat beta-galactoside (CMP) alpha-2,3-sialyltransferase activity enables IEA ARBA:ARBA00043351 1600115 GO_REF:0000117 UniProt GO_REF:0000117 St3gal2 Rat beta-galactoside (CMP) alpha-2,3-sialyltransferase activity enables IDA 68307 PMID:8144500 UniProt St3gal2 Rat glycosyltransferase activity enables IEA UniProtKB-KW:KW-0328 1600115 GO_REF:0000043 UniProt GO_REF:0000043 St3gal2 Rat protein homodimerization activity enables ISS UniProtKB:Q16842 1600115 GO_REF:0000024 UniProt GO_REF:0000024 St3gal2 Rat protein homodimerization activity enables IEA UniProtKB:Q16842 and ensembl:ENSP000003454771600115 GO_REF:0000107 Ensembl GO_REF:0000107 St3gal2 Rat protein homodimerization activity enables ISO ST3GAL2 (Homo sapiens) 1624291 PMID:25916169 RGD PMID:25916169 St3gal2 Rat sialyltransferase activity IDA 68307 RGD St3gal2 Rat sialyltransferase activity enables IEA InterPro:IPR001675 and InterPro:IPR012163 1600115 GO_REF:0000002 InterPro GO_REF:0000002 St3gal2 Rat transferase activity enables IEA UniProtKB-KW:KW-0808 1600115 GO_REF:0000043 UniProt GO_REF:0000043
Imported Annotations - KEGG (archival)
1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP) cannabidiol (ISO) captan (ISO) choline (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) dexamethasone (EXP) diarsenic trioxide (ISO) diazinon (ISO) dicrotophos (ISO) dieldrin (ISO) diuron (EXP) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) folic acid (ISO) folpet (ISO) furan (EXP) gentamycin (EXP) hydrogen cyanide (ISO) L-methionine (ISO) metformin (ISO) methyl methanesulfonate (ISO) N-nitrosodiethylamine (EXP) ozone (ISO) paracetamol (EXP) phenylephrine (EXP) phosgene (ISO) pirinixic acid (ISO) potassium cyanide (ISO) raloxifene (ISO) rotenone (ISO) sodium arsenite (ISO) sunitinib (ISO) tamoxifen (ISO) testosterone (EXP) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (ISO) triptonide (ISO) tunicamycin (ISO) undecane (EXP) valproic acid (ISO) vinclozolin (EXP)
Biological Process
ganglioside biosynthetic process via lactosylceramide (IBA,IDA,IEA,ISO) globoside biosynthetic process via lactosylceramide (IEA,ISO,ISS) glycolipid biosynthetic process (IEA,ISO) glycoprotein biosynthetic process (IEA,ISO) lipid glycosylation (IEA,ISO) lipid metabolic process (IEA) oligosaccharide biosynthetic process (IEA,ISO) protein glycosylation (IBA,IEA,ISO) protein sialylation (ISO) sialylation (IBA,IEA,ISO)
St3gal2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 55,798,112 - 55,849,226 (+) NCBI GRCr8 mRatBN7.2 19 38,888,851 - 38,939,874 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 38,923,999 - 38,939,869 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 45,728,513 - 45,744,388 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 46,381,856 - 46,397,731 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 48,692,765 - 48,708,643 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 43,273,251 - 43,324,265 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 43,274,493 - 43,290,363 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 54,101,504 - 54,152,583 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 40,873,202 - 40,889,072 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 40,892,278 - 40,892,994 (-) NCBI Celera 19 38,316,282 - 38,332,162 (+) NCBI Celera Cytogenetic Map 19 q12 NCBI
ST3GAL2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 70,375,977 - 70,439,100 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 70,375,977 - 70,439,237 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 70,409,880 - 70,473,003 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 68,970,839 - 69,030,492 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 68,972,809 - 69,030,492 NCBI Celera 16 55,055,306 - 55,114,849 (+) NCBI Celera Cytogenetic Map 16 q22.1 NCBI HuRef 16 56,246,172 - 56,305,216 (-) NCBI HuRef CHM1_1 16 71,820,818 - 71,880,362 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 76,187,004 - 76,250,128 (-) NCBI T2T-CHM13v2.0
St3gal2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 111,646,520 - 111,699,132 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 111,646,554 - 111,699,112 (+) Ensembl GRCm39 Ensembl GRCm38 8 110,919,743 - 110,974,058 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 110,919,922 - 110,972,480 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 113,443,765 - 113,496,397 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 113,806,599 - 113,858,234 (+) NCBI MGSCv36 mm8 Celera 8 115,180,767 - 115,196,505 (+) NCBI Celera Cytogenetic Map 8 E1 NCBI cM Map 8 57.81 NCBI
St3gal2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955484 3,177,104 - 3,230,433 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955484 3,176,214 - 3,230,433 (-) NCBI ChiLan1.0 ChiLan1.0
ST3GAL2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 83,726,255 - 83,789,200 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 89,655,506 - 89,715,192 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 54,577,578 - 54,637,626 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 70,218,738 - 70,240,162 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 70,218,748 - 70,240,162 (-) Ensembl panpan1.1 panPan2
ST3GAL2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 76,377,782 - 76,427,998 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 76,379,702 - 76,394,525 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 76,339,604 - 76,389,857 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 76,814,457 - 76,864,970 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 76,796,878 - 76,864,417 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 76,636,437 - 76,687,020 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 76,459,670 - 76,510,167 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 76,951,528 - 77,002,224 (-) NCBI UU_Cfam_GSD_1.0
St3gal2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 36,385,195 - 36,439,669 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 23,149,487 - 23,205,027 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 23,149,452 - 23,203,919 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ST3GAL2
ST3GAL2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 53,530,077 - 53,585,065 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 53,531,781 - 53,545,739 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 16,316,291 - 16,376,499 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
St3gal2
.
Predicted Target Of
Count of predictions: 870 Count of miRNA genes: 291 Interacting mature miRNAs: 384 Transcripts: ENSRNOT00000024248 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 19220689 64220689 Rat 631840 Niddm38 Non-insulin dependent diabetes mellitus QTL 38 3.86 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 19 10329076 74246245 Rat 724546 Kidm3 Kidney mass QTL 3 3.1 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 19 46226778 74246245 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 32365311 74246245 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 36289 74246245 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 24093973 69093973 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10833618 74246245 Rat 2303628 Vencon9 Ventilatory control QTL 9 0.005 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 19 23188586 68188586 Rat 2313395 Anxrr26 Anxiety related response QTL 26 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 19 44385134 74246245 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 32539615 74246245 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 31777888 74246245 Rat 1554318 Bmd5 Bone mineral density QTL 5 12.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 19 23188586 68188586 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 20109306 65109306 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2194317 74246245 Rat 1549835 Tcas7 Tongue tumor susceptibility QTL 7 0.001 tongue integrity trait (VT:0010553) squamous cell carcinoma of the head and neck tumor number (CMO:0001876) 19 41722546 74246245 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2194317 74246245 Rat
BF387076
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 38,938,311 - 38,938,468 (-) MAPPER mRatBN7.2 Rnor_6.0 19 43,275,894 - 43,276,050 NCBI Rnor6.0 Rnor_5.0 19 54,104,147 - 54,104,303 UniSTS Rnor5.0 RGSC_v3.4 19 40,887,515 - 40,887,671 UniSTS RGSC3.4 Celera 19 38,330,605 - 38,330,761 UniSTS RH 3.4 Map 19 474.0 UniSTS Cytogenetic Map 19 q12 UniSTS
RH139813
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 38,939,013 - 38,939,204 (-) MAPPER mRatBN7.2 Rnor_6.0 19 43,275,158 - 43,275,348 NCBI Rnor6.0 Rnor_5.0 19 54,103,411 - 54,103,601 UniSTS Rnor5.0 RGSC_v3.4 19 40,888,217 - 40,888,407 UniSTS RGSC3.4 Celera 19 38,331,307 - 38,331,497 UniSTS RH 3.4 Map 19 481.5 UniSTS Cytogenetic Map 19 q12 UniSTS
RH140953
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 38,939,596 - 38,939,782 (-) MAPPER mRatBN7.2 Rnor_6.0 19 43,274,580 - 43,274,765 NCBI Rnor6.0 Rnor_5.0 19 54,102,833 - 54,103,018 UniSTS Rnor5.0 RGSC_v3.4 19 40,888,800 - 40,888,985 UniSTS RGSC3.4 Celera 19 38,331,890 - 38,332,075 UniSTS RH 3.4 Map 19 478.1 UniSTS RH 3.4 Map 19 477.8 UniSTS Cytogenetic Map 19 q12 UniSTS
AA850466
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 38,939,565 - 38,939,782 (-) MAPPER mRatBN7.2 Rnor_6.0 19 43,274,580 - 43,274,796 NCBI Rnor6.0 Rnor_5.0 19 54,102,833 - 54,103,049 UniSTS Rnor5.0 RGSC_v3.4 19 40,888,769 - 40,888,985 UniSTS RGSC3.4 Celera 19 38,331,859 - 38,332,075 UniSTS RH 3.4 Map 19 477.9 UniSTS Cytogenetic Map 19 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024248 ⟹ ENSRNOP00000024248
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 38,923,999 - 38,939,869 (+) Ensembl Rnor_6.0 Ensembl 19 43,274,493 - 43,290,363 (-) Ensembl
RefSeq Acc Id:
NM_031695 ⟹ NP_113883
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 55,833,356 - 55,849,226 (+) NCBI mRatBN7.2 19 38,923,999 - 38,939,869 (+) NCBI Rnor_6.0 19 43,274,493 - 43,290,363 (-) NCBI Rnor_5.0 19 54,101,504 - 54,152,583 (-) NCBI RGSC_v3.4 19 40,873,202 - 40,889,072 (+) RGD Celera 19 38,316,282 - 38,332,162 (+) RGD
Sequence:
CCGTGGCTGGCCCCACAGTGGGCTGGGAAAGGATTGGCCACGGTGACAGCCGCCCCGTGGCCAGCACAATGAAGTGCTCCCTTCGAGTGTGGTTCCTCTCTATGGCCTTCCTGCTGGTGTTCATTATG
hide sequence
RefSeq Acc Id:
XM_006255625 ⟹ XP_006255687
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 55,799,446 - 55,848,734 (+) NCBI mRatBN7.2 19 38,890,065 - 38,939,874 (+) NCBI Rnor_6.0 19 43,273,251 - 43,324,265 (-) NCBI Rnor_5.0 19 54,101,504 - 54,152,583 (-) NCBI
Sequence:
CCTTTAGCTGGGCAGGGGTGGGGGGAGGGGCCGGGCTGAGCTGCAGCCGCGGCGCTCCGGGAGG
hide sequence
RefSeq Acc Id:
XM_006255626 ⟹ XP_006255688
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 55,799,447 - 55,848,734 (+) NCBI mRatBN7.2 19 38,890,065 - 38,939,874 (+) NCBI Rnor_6.0 19 43,273,251 - 43,324,265 (-) NCBI Rnor_5.0 19 54,101,504 - 54,152,583 (-) NCBI
Sequence:
CCTTTAGCTGGGCAGGGGTGGGGGGAGGGGCCGGGCTGAGCTGCAGCCGCGGCGCTCCGGGAGGGCAGGGCCAGGCAAGGGCGGGACTGGCCTGAGGCAGGCGGACAGGAGAGCCGAGAAGCTAACGG
hide sequence
RefSeq Acc Id:
XM_006255627 ⟹ XP_006255689
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 55,799,441 - 55,848,734 (+) NCBI mRatBN7.2 19 38,890,065 - 38,939,874 (+) NCBI Rnor_6.0 19 43,273,251 - 43,324,265 (-) NCBI Rnor_5.0 19 54,101,504 - 54,152,583 (-) NCBI
Sequence:
CCTTTAGCTGGGCAGGGGTGGGGGGAGGGGCCGGGCTGAGCTGCAGCCGCGGCGCTCCGGGAGGGCAGGGCCAGGCAAGGGCGGGACTGGCCTGAGGCAGGCGGACAGGAGAGCCGAGAAGCTAACGG
hide sequence
RefSeq Acc Id:
XM_039097961 ⟹ XP_038953889
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 55,798,112 - 55,848,734 (+) NCBI mRatBN7.2 19 38,888,851 - 38,939,874 (+) NCBI
RefSeq Acc Id:
XM_039097962 ⟹ XP_038953890
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 55,833,623 - 55,848,734 (+) NCBI mRatBN7.2 19 38,924,274 - 38,939,874 (+) NCBI
RefSeq Acc Id:
NP_113883 ⟸ NM_031695
- UniProtKB:
Q11205 (UniProtKB/Swiss-Prot), G3V8B2 (UniProtKB/TrEMBL), A6IZ75 (UniProtKB/TrEMBL)
- Sequence:
MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGTLGGTHRVKLVPGYTGQQRLVKEGLSGKSCTCSRCMGDAGTSEWFDSHFDSNISPVWTRDNMNLTPDVQRWWMMLQPQFKSHNTNEVL
hide sequence
RefSeq Acc Id:
XP_006255689 ⟸ XM_006255627
- Peptide Label:
isoform X1
- UniProtKB:
Q11205 (UniProtKB/Swiss-Prot), G3V8B2 (UniProtKB/TrEMBL), A6IZ75 (UniProtKB/TrEMBL)
- Sequence:
MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGTLGGTHRVKLVPGYTGQQRLVKEGLSGKSCTCSRCMGDAGTSEWFDSHFDSNISPVWTRDNMNLTPDVQRWWMMLQPQFKSHNTNEVL
hide sequence
RefSeq Acc Id:
XP_006255687 ⟸ XM_006255625
- Peptide Label:
isoform X1
- UniProtKB:
Q11205 (UniProtKB/Swiss-Prot), G3V8B2 (UniProtKB/TrEMBL), A6IZ75 (UniProtKB/TrEMBL)
- Sequence:
MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGTLGGTHRVKLVPGYTGQQRLVKEGLSGKSCTCSRCMGDAGTSEWFDSHFDSNISPVWTRDNMNLTPDVQRWWMMLQPQFKSHNTNEVL
hide sequence
RefSeq Acc Id:
XP_006255688 ⟸ XM_006255626
- Peptide Label:
isoform X1
- UniProtKB:
Q11205 (UniProtKB/Swiss-Prot), G3V8B2 (UniProtKB/TrEMBL), A6IZ75 (UniProtKB/TrEMBL)
- Sequence:
MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGTLGGTHRVKLVPGYTGQQRLVKEGLSGKSCTCSRCMGDAGTSEWFDSHFDSNISPVWTRDNMNLTPDVQRWWMMLQPQFKSHNTNEVL
hide sequence
Ensembl Acc Id:
ENSRNOP00000024248 ⟸ ENSRNOT00000024248
RefSeq Acc Id:
XP_038953889 ⟸ XM_039097961
- Peptide Label:
isoform X1
- UniProtKB:
Q11205 (UniProtKB/Swiss-Prot), G3V8B2 (UniProtKB/TrEMBL), A6IZ75 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953890 ⟸ XM_039097962
- Peptide Label:
isoform X2
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
St3gal2
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Siat4b
sialyltransferase 4B (beta-galactoside alpha-2,3-sialyltransferase)
Symbol and Name updated
1299863 APPROVED
2004-09-10
Siat4b
sialyltransferase 4B (beta-galactoside alpha-2,3-sialyltransferase)
Siat5
sialyltransferase 5
Symbol and Name updated
1299863 APPROVED
2002-06-10
Siat5
sialyltransferase 5
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
mainly expressed in brain and liver
68307
gene_protein
350 amino acids
68307
