Symbol:
Sp7
Name:
Sp7 transcription factor
RGD ID:
631377
Description:
Predicted to enable DEAD/H-box RNA helicase binding activity; DNA-binding transcription activator activity, RNA polymerase II-specific; and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in cellular response to zinc ion starvation and response to insulin. Predicted to be located in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in osteogenesis imperfecta type 12. Orthologous to human SP7 (Sp7 transcription factor); INTERACTS WITH 5-formyltetrahydrofolic acid; ammonium chloride; arsenous acid.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
osterix; Osx; Transcription factor Sp7
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 135,363,193 - 135,373,376 (-) NCBI GRCr8 mRatBN7.2 7 133,484,609 - 133,494,788 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 133,484,609 - 133,494,847 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 135,247,146 - 135,255,771 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 137,476,525 - 137,485,150 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 137,461,680 - 137,470,323 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 143,957,316 - 143,967,488 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 143,958,858 - 143,967,484 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 141,753,826 - 141,762,790 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 141,109,771 - 141,118,397 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 141,186,207 - 141,194,213 (-) NCBI Celera 7 129,919,226 - 129,927,844 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sp7 Rat 1,2-dichloroethane increases expression ISO Sp7 (Mus musculus) 6480464 ethylene dichloride results in increased expression of SP7 mRNA CTD PMID:28960355 Sp7 Rat 17beta-estradiol increases expression ISO SP7 (Homo sapiens) 6480464 Estradiol results in increased expression of SP7 mRNA CTD PMID:17689939 Sp7 Rat 17beta-estradiol multiple interactions ISO SP7 (Homo sapiens) 6480464 fulvestrant inhibits the reaction [Estradiol results in increased expression of SP7 mRNA] CTD PMID:17689939 Sp7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Sp7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SP7 mRNA CTD PMID:28836330 Sp7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO SP7 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of SP7 mRNA CTD PMID:30203000 and PMID:31887333 Sp7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Sp7 (Mus musculus) 6480464 actein inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of SP7 mRNA] CTD PMID:28836330 Sp7 Rat 2,4-di-tert-butylphenol multiple interactions ISO SP7 (Homo sapiens) 6480464 [SAG compound co-treated with 2 and 4-di-tert-butylphenol co-treated with Fibroblast Growth Factor 2 co-treated with Ascorbic Acid co-treated with alpha-glycerophosphoric acid co-treated with Dexamethasone] results in decreased expression of SP7 mRNA CTD PMID:36682590 Sp7 Rat 2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid multiple interactions ISO SP7 (Homo sapiens) 6480464 anacardic acid inhibits the reaction [Tretinoin results in increased expression of SP7 mRNA] CTD PMID:24819975 Sp7 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Sp7 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of SP7 mRNA CTD PMID:25777084 Sp7 Rat 3,3',5,5'-tetrabromobisphenol A multiple interactions ISO Sp7 (Mus musculus) 6480464 tetrabromobisphenol A inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA] CTD PMID:32473317 Sp7 Rat 3-methyladenine multiple interactions ISO Sp7 (Mus musculus) 6480464 3-methyladenine promotes the reaction [T-2 Toxin results in decreased expression of SP7 protein] CTD PMID:36402210 Sp7 Rat 4,4'-sulfonyldiphenol increases expression ISO SP7 (Homo sapiens) 6480464 bisphenol S results in increased expression of SP7 protein CTD PMID:36565802 Sp7 Rat 5-azacytidine increases expression ISO Sp7 (Mus musculus) 6480464 Azacitidine results in increased expression of SP7 mRNA CTD PMID:17085970 Sp7 Rat 5-formyltetrahydrofolic acid multiple interactions EXP 6480464 [Methotrexate co-treated with Leucovorin] results in increased expression of SP7 mRNA CTD PMID:25187349 Sp7 Rat Actein multiple interactions ISO Sp7 (Mus musculus) 6480464 actein inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of SP7 mRNA] CTD PMID:28836330 Sp7 Rat aldehydo-D-glucose multiple interactions ISO SP7 (Homo sapiens) 6480464 [EPO protein co-treated with Glucose] results in increased expression of SP7 mRNA and [EPO protein co-treated with Glucose] results in increased expression of SP7 protein CTD PMID:30894315 Sp7 Rat aldehydo-D-glucose multiple interactions ISO Sp7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in decreased expression of SP7 mRNA CTD PMID:37567420 Sp7 Rat all-trans-retinoic acid multiple interactions ISO SP7 (Homo sapiens) 6480464 anacardic acid inhibits the reaction [Tretinoin results in increased expression of SP7 mRNA] and ginkgolic acid inhibits the reaction [Tretinoin results in increased expression of SP7 mRNA] CTD PMID:24819975 Sp7 Rat all-trans-retinoic acid multiple interactions ISO Sp7 (Mus musculus) 6480464 Tretinoin inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA] CTD PMID:32473317 Sp7 Rat all-trans-retinoic acid increases expression ISO SP7 (Homo sapiens) 6480464 Tretinoin results in increased expression of SP7 mRNA CTD PMID:24819975 Sp7 Rat allethrin multiple interactions ISO Sp7 (Mus musculus) 6480464 Allethrins inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA] CTD PMID:32473317 Sp7 Rat aluminium oxide increases expression ISO SP7 (Homo sapiens) 6480464 Aluminum Oxide results in increased expression of SP7 mRNA CTD PMID:19464052 Sp7 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SP7 mRNA CTD PMID:16483693 Sp7 Rat arsenous acid decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of SP7 mRNA CTD PMID:22465848 Sp7 Rat aucubin increases expression ISO SP7 (Homo sapiens) 6480464 aucubin results in increased expression of SP7 protein CTD PMID:29408431 Sp7 Rat aucubin increases expression ISO Sp7 (Mus musculus) 6480464 aucubin results in increased expression of SP7 mRNA CTD PMID:38492842 Sp7 Rat benzo[a]pyrene affects methylation ISO SP7 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SP7 promoter CTD PMID:27901495 Sp7 Rat berberine increases expression ISO SP7 (Homo sapiens) 6480464 Berberine results in increased expression of SP7 mRNA CTD PMID:26478571 Sp7 Rat bexarotene decreases expression ISO Sp7 (Mus musculus) 6480464 bexarotene results in decreased expression of SP7 mRNA CTD PMID:25932594 Sp7 Rat bexarotene multiple interactions ISO SP7 (Homo sapiens) 6480464 bexarotene inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA] CTD PMID:25932594 Sp7 Rat bisphenol A decreases expression ISO Sp7 (Mus musculus) 6480464 bisphenol A results in decreased expression of SP7 mRNA CTD PMID:23900028 Sp7 Rat bisphenol A decreases expression ISO SP7 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SP7 mRNA and bisphenol A results in decreased expression of SP7 protein CTD PMID:35628159 and PMID:35780740 Sp7 Rat bisphenol A multiple interactions ISO SP7 (Homo sapiens) 6480464 bisphenol A inhibits the reaction [beta-glycerophosphoric acid results in increased expression of SP7 protein] and SR 3335 inhibits the reaction [bisphenol A results in decreased expression of SP7 protein] CTD PMID:35780740 Sp7 Rat bisphenol A multiple interactions EXP 6480464 TGFB1 protein inhibits the reaction [bisphenol A results in decreased expression of SP7 mRNA] CTD PMID:34097993 Sp7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SP7 mRNA CTD PMID:25181051 and PMID:34097993 Sp7 Rat cadmium atom decreases expression ISO SP7 (Homo sapiens) 6480464 Cadmium results in decreased expression of SP7 mRNA CTD PMID:20570719 Sp7 Rat cadmium atom multiple interactions ISO SP7 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SP7 protein and BMP4 protein inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SP7 protein] CTD PMID:36453845 Sp7 Rat cadmium dichloride multiple interactions ISO SP7 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SP7 protein and BMP4 protein inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SP7 protein] CTD PMID:36453845 Sp7 Rat calciol multiple interactions ISO SP7 (Homo sapiens) 6480464 [Dexamethasone co-treated with ascorbate-2-phosphate co-treated with beta-glycerophosphoric acid co-treated with Cholecalciferol] results in increased expression of SP7 mRNA CTD PMID:22940495 Sp7 Rat calcium atom affects secretion EXP 6480464 SP7 protein affects the secretion of Calcium CTD PMID:19064586 Sp7 Rat calcium(0) affects secretion EXP 6480464 SP7 protein affects the secretion of Calcium CTD PMID:19064586 Sp7 Rat cannabidiol increases expression ISO SP7 (Homo sapiens) 6480464 Cannabidiol results in increased expression of SP7 protein CTD PMID:32656944 Sp7 Rat CHIR 99021 increases expression ISO Sp7 (Mus musculus) 6480464 Chir 99021 results in increased expression of SP7 mRNA CTD PMID:32220932 Sp7 Rat CHIR 99021 affects localization ISO Sp7 (Mus musculus) 6480464 Chir 99021 affects the localization of SP7 protein CTD PMID:32220932 Sp7 Rat chromium(3+) trichloride decreases expression ISO Sp7 (Mus musculus) 6480464 chromic chloride results in decreased expression of SP7 mRNA CTD PMID:25966675 Sp7 Rat chromium(3+) trichloride multiple interactions ISO Sp7 (Mus musculus) 6480464 [cobaltous chloride co-treated with chromic chloride] results in decreased expression of SP7 mRNA CTD PMID:25966675 Sp7 Rat cobalt dichloride multiple interactions ISO Sp7 (Mus musculus) 6480464 [cobaltous chloride co-treated with chromic chloride] results in decreased expression of SP7 mRNA CTD PMID:25966675 Sp7 Rat cobalt dichloride multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [cobaltous chloride results in increased expression of SP7 mRNA] more ... CTD PMID:31472278 Sp7 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of SP7 mRNA CTD PMID:31472278 Sp7 Rat cobalt dichloride decreases expression ISO Sp7 (Mus musculus) 6480464 cobaltous chloride results in decreased expression of SP7 mRNA CTD PMID:25966675 Sp7 Rat cordycepin multiple interactions ISO SP7 (Homo sapiens) 6480464 cordycepin inhibits the reaction [pyrrolidine dithiocarbamic acid inhibits the reaction [[Dexamethasone co-treated with ascorbate-2-phosphate co-treated with beta-glycerophosphoric acid] results in increased expression of SP7 mRNA]] CTD PMID:34575692 Sp7 Rat D-glucose multiple interactions ISO SP7 (Homo sapiens) 6480464 [EPO protein co-treated with Glucose] results in increased expression of SP7 mRNA and [EPO protein co-treated with Glucose] results in increased expression of SP7 protein CTD PMID:30894315 Sp7 Rat D-glucose multiple interactions ISO Sp7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in decreased expression of SP7 mRNA CTD PMID:37567420 Sp7 Rat desferrioxamine B multiple interactions ISO Sp7 (Mus musculus) 6480464 Deferoxamine inhibits the reaction [Ascorbic Acid results in increased expression of SP7 mRNA] CTD PMID:21467157 Sp7 Rat dexamethasone multiple interactions ISO Sp7 (Mus musculus) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA more ... CTD PMID:25062436 more ... Sp7 Rat dexamethasone multiple interactions ISO SP7 (Homo sapiens) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA more ... CTD PMID:22940495 more ... Sp7 Rat dexamethasone affects expression EXP 6480464 Dexamethasone affects the expression of SP7 protein CTD PMID:20717928 Sp7 Rat diarsenic trioxide decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of SP7 mRNA CTD PMID:22465848 Sp7 Rat disodium selenite multiple interactions ISO Sp7 (Mus musculus) 6480464 [Dexamethasone co-treated with INS protein co-treated with TF protein co-treated with Sodium Selenite] results in decreased expression of SP7 protein more ... CTD PMID:32324263 Sp7 Rat ellagic acid increases expression ISO Sp7 (Mus musculus) 6480464 Ellagic Acid results in increased expression of SP7 mRNA and Ellagic Acid results in increased expression of SP7 protein CTD PMID:38145796 Sp7 Rat ethyl 3,4-dihydroxybenzoate multiple interactions ISO Sp7 (Mus musculus) 6480464 ethyl protocatechuate inhibits the reaction [Ascorbic Acid results in increased expression of SP7 mRNA] and ethyl protocatechuate inhibits the reaction [Ascorbic Acid results in increased expression of SP7 protein] CTD PMID:21467157 Sp7 Rat fentin hydroxide multiple interactions ISO Sp7 (Mus musculus) 6480464 triphenyltin hydroxide inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA] CTD PMID:32473317 Sp7 Rat folic acid multiple interactions ISO Sp7 (Mus musculus) 6480464 [Folic Acid co-treated with Ascorbic Acid co-treated with beta-glycerophosphoric acid] results in increased expression of SP7 mRNA more ... CTD PMID:32324263 Sp7 Rat fructose multiple interactions ISO Sp7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in decreased expression of SP7 mRNA CTD PMID:37567420 Sp7 Rat fulvestrant multiple interactions ISO SP7 (Homo sapiens) 6480464 fulvestrant inhibits the reaction [Estradiol results in increased expression of SP7 mRNA] more ... CTD PMID:17689939 and PMID:26362186 Sp7 Rat fulvestrant multiple interactions EXP 6480464 fulvestrant inhibits the reaction [naringin results in increased expression of SP7 mRNA] CTD PMID:23596885 Sp7 Rat gamma-aminobutyric acid affects expression EXP 6480464 gamma-Aminobutyric Acid affects the expression of SP7 mRNA CTD PMID:24098073 Sp7 Rat gamma-Oryzanol (TN) affects expression EXP 6480464 gamma-oryzanol affects the expression of SP7 mRNA CTD PMID:24098073 Sp7 Rat Ganoderic acid A multiple interactions ISO Sp7 (Mus musculus) 6480464 ganoderic acid A inhibits the reaction [Lipopolysaccharides results in decreased expression of SP7 mRNA] CTD PMID:39111524 Sp7 Rat genistein increases expression ISO Sp7 (Mus musculus) 6480464 Genistein results in increased expression of SP7 mRNA CTD PMID:24872432 Sp7 Rat Ginkgoic acid multiple interactions ISO SP7 (Homo sapiens) 6480464 ginkgolic acid inhibits the reaction [Tretinoin results in increased expression of SP7 mRNA] CTD PMID:24819975 Sp7 Rat glucose multiple interactions ISO SP7 (Homo sapiens) 6480464 [EPO protein co-treated with Glucose] results in increased expression of SP7 mRNA and [EPO protein co-treated with Glucose] results in increased expression of SP7 protein CTD PMID:30894315 Sp7 Rat glucose multiple interactions ISO Sp7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in decreased expression of SP7 mRNA CTD PMID:37567420 Sp7 Rat glycerol 1-phosphate multiple interactions ISO SP7 (Homo sapiens) 6480464 [SAG compound co-treated with 2 and 4-di-tert-butylphenol co-treated with Fibroblast Growth Factor 2 co-treated with Ascorbic Acid co-treated with alpha-glycerophosphoric acid co-treated with Dexamethasone] results in decreased expression of SP7 mRNA CTD PMID:36682590 Sp7 Rat glycerol 2-phosphate multiple interactions ISO Sp7 (Mus musculus) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA more ... CTD PMID:25062436 more ... Sp7 Rat glycerol 2-phosphate increases expression ISO SP7 (Homo sapiens) 6480464 beta-glycerophosphoric acid results in increased expression of SP7 protein CTD PMID:35780740 Sp7 Rat glycerol 2-phosphate multiple interactions ISO SP7 (Homo sapiens) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA more ... CTD PMID:22940495 more ... Sp7 Rat glycyrrhetinate multiple interactions ISO Sp7 (Mus musculus) 6480464 18alpha-glycyrrhetinic acid inhibits the reaction [BMP2 protein results in increased expression of SP7 mRNA] CTD PMID:21910061 Sp7 Rat glycyrrhetinic acid multiple interactions ISO Sp7 (Mus musculus) 6480464 18alpha-glycyrrhetinic acid inhibits the reaction [BMP2 protein results in increased expression of SP7 mRNA] CTD PMID:21910061 Sp7 Rat herbicide multiple interactions ISO Sp7 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in decreased expression of SP7 mRNA CTD PMID:37567420 Sp7 Rat hydrogen chloride decreases expression ISO SP7 (Homo sapiens) 6480464 Hydrochloric Acid results in decreased expression of SP7 mRNA and Hydrochloric Acid results in decreased expression of SP7 protein CTD PMID:17183249 Sp7 Rat hydrogen peroxide decreases expression ISO SP7 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of SP7 mRNA CTD PMID:26482937 Sp7 Rat hydrogen peroxide multiple interactions ISO SP7 (Homo sapiens) 6480464 naringin inhibits the reaction [Hydrogen Peroxide results in decreased expression of SP7 mRNA] CTD PMID:26482937 Sp7 Rat ionomycin multiple interactions ISO Sp7 (Mus musculus) 6480464 Ionomycin affects the reaction [CALR protein affects the expression of SP7 mRNA] CTD PMID:32220932 Sp7 Rat isonicotinamide increases expression ISO SP7 (Homo sapiens) 6480464 isonicotinamide results in increased expression of SP7 mRNA CTD PMID:21745208 Sp7 Rat L-ascorbic acid multiple interactions ISO Sp7 (Mus musculus) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA more ... CTD PMID:21467157 more ... Sp7 Rat L-ascorbic acid multiple interactions ISO SP7 (Homo sapiens) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA more ... CTD PMID:25932594 and PMID:36682590 Sp7 Rat L-ascorbic acid increases expression ISO Sp7 (Mus musculus) 6480464 Ascorbic Acid results in increased expression of SP7 mRNA and Ascorbic Acid results in increased expression of SP7 protein CTD PMID:21467157 Sp7 Rat L-ascorbic acid 2-phosphate multiple interactions ISO Sp7 (Mus musculus) 6480464 NFE2L1 protein affects the reaction [ascorbate-2-phosphate results in increased expression of SP7 mRNA] CTD PMID:17510056 Sp7 Rat L-ascorbic acid 2-phosphate multiple interactions ISO SP7 (Homo sapiens) 6480464 [Dexamethasone co-treated with ascorbate-2-phosphate co-treated with beta-glycerophosphoric acid co-treated with Cholecalciferol] results in increased expression of SP7 mRNA more ... CTD PMID:22940495 and PMID:34575692 Sp7 Rat L-ascorbic acid 2-phosphate increases expression ISO Sp7 (Mus musculus) 6480464 ascorbate-2-phosphate results in increased expression of SP7 mRNA CTD PMID:17510056 Sp7 Rat lead diacetate decreases expression ISO Sp7 (Mus musculus) 6480464 lead acetate results in decreased expression of SP7 mRNA CTD PMID:22613225 Sp7 Rat lead(0) decreases expression ISO Sp7 (Mus musculus) 6480464 Lead results in decreased expression of SP7 mRNA CTD PMID:23086611 Sp7 Rat lipopolysaccharide decreases expression ISO Sp7 (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of SP7 mRNA CTD PMID:39111524 Sp7 Rat lipopolysaccharide multiple interactions ISO Sp7 (Mus musculus) 6480464 ganoderic acid A inhibits the reaction [Lipopolysaccharides results in decreased expression of SP7 mRNA] CTD PMID:39111524 Sp7 Rat menaquinone increases expression EXP 6480464 Vitamin K 2 results in increased expression of SP7 protein CTD PMID:30639440 Sp7 Rat menaquinone multiple interactions EXP 6480464 PTH protein promotes the reaction [Vitamin K 2 results in increased expression of SP7 protein] and Vitamin K 2 affects the reaction [PTH protein results in increased expression of SP7 protein] CTD PMID:30639440 Sp7 Rat metformin multiple interactions ISO SP7 (Homo sapiens) 6480464 Metformin inhibits the reaction [BMP2 protein results in increased expression of SP7 mRNA] and Metformin inhibits the reaction [BMP2 protein results in increased expression of SP7 protein] CTD PMID:37409753 Sp7 Rat methotrexate multiple interactions EXP 6480464 [Methotrexate co-treated with Leucovorin] results in increased expression of SP7 mRNA CTD PMID:25187349 Sp7 Rat microcystin-LR increases expression EXP 6480464 cyanoginosin LR results in increased expression of SP7 protein CTD PMID:37467923 Sp7 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Sp7 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate analog results in decreased expression of SP7 mRNA and mono-(2-ethylhexyl)phthalate results in decreased expression of SP7 mRNA CTD PMID:25777084 Sp7 Rat Morroniside increases expression ISO Sp7 (Mus musculus) 6480464 morroniside results in increased expression of SP7 mRNA CTD PMID:34638983 Sp7 Rat naringin multiple interactions EXP 6480464 fulvestrant inhibits the reaction [naringin results in increased expression of SP7 mRNA] CTD PMID:23596885 Sp7 Rat naringin multiple interactions ISO SP7 (Homo sapiens) 6480464 naringin inhibits the reaction [Hydrogen Peroxide results in decreased expression of SP7 mRNA] CTD PMID:26482937 Sp7 Rat naringin increases expression EXP 6480464 naringin results in increased expression of SP7 mRNA CTD PMID:23596885 Sp7 Rat notoginsenoside R1 multiple interactions ISO SP7 (Homo sapiens) 6480464 fulvestrant inhibits the reaction [notoginsenoside R1 results in increased expression of SP7 mRNA] CTD PMID:26362186 Sp7 Rat notoginsenoside R1 increases expression ISO SP7 (Homo sapiens) 6480464 notoginsenoside R1 results in increased expression of SP7 mRNA CTD PMID:26362186 Sp7 Rat Octicizer multiple interactions ISO Sp7 (Mus musculus) 6480464 [tris(2-butoxyethyl) phosphate co-treated with IMOL S-140 co-treated with tri-(2-chloroisopropyl)phosphate co-treated with tris(1 and 3-dichloro-2-propyl)phosphate co-treated with triphenyl phosphate co-treated with santicizer 148 co-treated with tris(chloroethyl)phosphate co-treated with 2-ethylhexyldiphenylphosphate co-treated with tributyl phosphate] results in decreased expression of SP7 mRNA CTD PMID:33367866 Sp7 Rat ozone multiple interactions ISO Sp7 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of SP7 mRNA CTD PMID:27106289 Sp7 Rat pioglitazone multiple interactions ISO Sp7 (Mus musculus) 6480464 Pioglitazone inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA] CTD PMID:32473317 Sp7 Rat prallethrin multiple interactions ISO Sp7 (Mus musculus) 6480464 d and d-T80-prallethrin inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA] CTD PMID:32473317 Sp7 Rat pyrrolidine dithiocarbamate multiple interactions ISO SP7 (Homo sapiens) 6480464 cordycepin inhibits the reaction [pyrrolidine dithiocarbamic acid inhibits the reaction [[Dexamethasone co-treated with ascorbate-2-phosphate co-treated with beta-glycerophosphoric acid] results in increased expression of SP7 mRNA]] and pyrrolidine dithiocarbamic acid inhibits the reaction [[Dexamethasone co-treated with ascorbate-2-phosphate co-treated with beta-glycerophosphoric acid] results in increased expression of SP7 mRNA] CTD PMID:34575692 Sp7 Rat quinoxyfen multiple interactions ISO Sp7 (Mus musculus) 6480464 quinoxyfen inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA] CTD PMID:32473317 Sp7 Rat resveratrol multiple interactions ISO SP7 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [resveratrol results in increased expression of SP7 mRNA] and fulvestrant inhibits the reaction [resveratrol results in increased expression of SP7 mRNA] CTD PMID:17689939 Sp7 Rat resveratrol increases expression ISO SP7 (Homo sapiens) 6480464 resveratrol results in increased expression of SP7 mRNA CTD PMID:17689939 and PMID:21745208 Sp7 Rat Salidroside increases expression ISO Sp7 (Mus musculus) 6480464 rhodioloside results in increased expression of SP7 mRNA CTD PMID:24055767 Sp7 Rat SB 203580 multiple interactions EXP 6480464 SB 203580 inhibits the reaction [cobaltous chloride results in increased expression of SP7 mRNA] and SB 203580 inhibits the reaction [cobaltous chloride results in increased expression of SP7 protein] CTD PMID:31472278 Sp7 Rat simvastatin increases expression ISO Sp7 (Mus musculus) 6480464 Simvastatin results in increased expression of SP7 more ... CTD PMID:20564244 and PMID:22058016 Sp7 Rat simvastatin multiple interactions ISO Sp7 (Mus musculus) 6480464 CTNNB1 mutant form inhibits the reaction [Simvastatin results in increased expression of SP7 protein] and DKK1 inhibits the reaction [Simvastatin results in increased expression of SP7 mRNA] CTD PMID:22058016 Sp7 Rat sodium fluoride affects expression EXP 6480464 Sodium Fluoride affects the expression of SP7 mRNA CTD PMID:25132241 Sp7 Rat sodium fluoride increases expression ISO Sp7 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of SP7 mRNA and Sodium Fluoride results in increased expression of SP7 protein CTD PMID:35218729 Sp7 Rat sodium fluoride multiple interactions ISO Sp7 (Mus musculus) 6480464 [Sodium Fluoride co-treated with Aluminum Chloride] results in increased expression of SP7 mRNA more ... CTD PMID:21560300 and PMID:35218729 Sp7 Rat T-2 toxin multiple interactions ISO Sp7 (Mus musculus) 6480464 3-methyladenine promotes the reaction [T-2 Toxin results in decreased expression of SP7 protein] CTD PMID:36402210 Sp7 Rat T-2 toxin decreases expression ISO Sp7 (Mus musculus) 6480464 T-2 Toxin results in decreased expression of SP7 protein CTD PMID:35289972 and PMID:36402210 Sp7 Rat tacrolimus hydrate decreases expression EXP 6480464 Tacrolimus results in decreased expression of SP7 mRNA CTD PMID:15780950 Sp7 Rat Theaflavin 3,3'-digallate multiple interactions ISO Sp7 (Mus musculus) 6480464 theaflavin-3 and 3'-digallate inhibits the reaction [TNF protein results in decreased expression of SP7 protein] CTD PMID:33833684 Sp7 Rat titanium dioxide increases expression ISO SP7 (Homo sapiens) 6480464 titanium dioxide results in increased expression of SP7 mRNA CTD PMID:19464052 Sp7 Rat titanium dioxide decreases methylation ISO Sp7 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SP7 gene CTD PMID:35295148 Sp7 Rat tributyl phosphate multiple interactions ISO Sp7 (Mus musculus) 6480464 [tris(2-butoxyethyl) phosphate co-treated with IMOL S-140 co-treated with tri-(2-chloroisopropyl)phosphate co-treated with tris(1 and 3-dichloro-2-propyl)phosphate co-treated with triphenyl phosphate co-treated with santicizer 148 co-treated with tris(chloroethyl)phosphate co-treated with 2-ethylhexyldiphenylphosphate co-treated with tributyl phosphate] results in decreased expression of SP7 mRNA CTD PMID:33367866 Sp7 Rat tributylstannane multiple interactions ISO SP7 (Homo sapiens) 6480464 tributyltin inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA] CTD PMID:25932594 Sp7 Rat tributylstannane decreases expression ISO Sp7 (Mus musculus) 6480464 tributyltin results in decreased expression of SP7 mRNA CTD PMID:25777084 and PMID:25932594 Sp7 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of SP7 mRNA CTD PMID:33387578 Sp7 Rat triphenyl phosphate multiple interactions ISO Sp7 (Mus musculus) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS1 protein co-treated with triphenyl phosphate] results in decreased expression of SP7 mRNA more ... CTD PMID:25062436 and PMID:33367866 Sp7 Rat triphenyl phosphate decreases expression ISO Sp7 (Mus musculus) 6480464 triphenyl phosphate results in decreased expression of SP7 mRNA CTD PMID:30561715 Sp7 Rat triphenylstannane decreases expression ISO Sp7 (Mus musculus) 6480464 triphenyltin results in decreased expression of SP7 mRNA CTD PMID:25777084 Sp7 Rat triptonide increases expression ISO Sp7 (Mus musculus) 6480464 triptonide results in increased expression of SP7 mRNA CTD PMID:33045310 Sp7 Rat tris(2-butoxyethyl) phosphate multiple interactions ISO Sp7 (Mus musculus) 6480464 [tris(2-butoxyethyl) phosphate co-treated with IMOL S-140 co-treated with tri-(2-chloroisopropyl)phosphate co-treated with tris(1 and 3-dichloro-2-propyl)phosphate co-treated with triphenyl phosphate co-treated with santicizer 148 co-treated with tris(chloroethyl)phosphate co-treated with 2-ethylhexyldiphenylphosphate co-treated with tributyl phosphate] results in decreased expression of SP7 mRNA CTD PMID:33367866 Sp7 Rat tris(2-chloroethyl) phosphate multiple interactions ISO Sp7 (Mus musculus) 6480464 [tris(2-butoxyethyl) phosphate co-treated with IMOL S-140 co-treated with tri-(2-chloroisopropyl)phosphate co-treated with tris(1 and 3-dichloro-2-propyl)phosphate co-treated with triphenyl phosphate co-treated with santicizer 148 co-treated with tris(chloroethyl)phosphate co-treated with 2-ethylhexyldiphenylphosphate co-treated with tributyl phosphate] results in decreased expression of SP7 mRNA CTD PMID:33367866 Sp7 Rat tungsten decreases expression ISO Sp7 (Mus musculus) 6480464 Tungsten results in decreased expression of SP7 mRNA CTD PMID:26865663 Sp7 Rat valproic acid increases methylation ISO SP7 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SP7 gene CTD PMID:29154799 Sp7 Rat warfarin multiple interactions ISO Sp7 (Mus musculus) 6480464 Warfarin inhibits the reaction [BMP2 protein results in increased expression of SP7 mRNA] CTD PMID:21910061 Sp7 Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of SP7 mRNA CTD PMID:21893222 Sp7 Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of SP7 mRNA CTD PMID:21893222
1,2-dichloroethane (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-di-tert-butylphenol (ISO) 2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-methyladenine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-azacytidine (ISO) 5-formyltetrahydrofolic acid (EXP) Actein (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) allethrin (ISO) aluminium oxide (ISO) ammonium chloride (EXP) arsenous acid (EXP) aucubin (ISO) benzo[a]pyrene (ISO) berberine (ISO) bexarotene (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) calciol (ISO) calcium atom (EXP) calcium(0) (EXP) cannabidiol (ISO) CHIR 99021 (ISO) chromium(3+) trichloride (ISO) cobalt dichloride (EXP,ISO) cordycepin (ISO) D-glucose (ISO) desferrioxamine B (ISO) dexamethasone (EXP,ISO) diarsenic trioxide (EXP) disodium selenite (ISO) ellagic acid (ISO) ethyl 3,4-dihydroxybenzoate (ISO) fentin hydroxide (ISO) folic acid (ISO) fructose (ISO) fulvestrant (EXP,ISO) gamma-aminobutyric acid (EXP) gamma-Oryzanol (TN) (EXP) Ganoderic acid A (ISO) genistein (ISO) Ginkgoic acid (ISO) glucose (ISO) glycerol 1-phosphate (ISO) glycerol 2-phosphate (ISO) glycyrrhetinate (ISO) glycyrrhetinic acid (ISO) herbicide (ISO) hydrogen chloride (ISO) hydrogen peroxide (ISO) ionomycin (ISO) isonicotinamide (ISO) L-ascorbic acid (ISO) L-ascorbic acid 2-phosphate (ISO) lead diacetate (ISO) lead(0) (ISO) lipopolysaccharide (ISO) menaquinone (EXP) metformin (ISO) methotrexate (EXP) microcystin-LR (EXP) mono(2-ethylhexyl) phthalate (ISO) Morroniside (ISO) naringin (EXP,ISO) notoginsenoside R1 (ISO) Octicizer (ISO) ozone (ISO) pioglitazone (ISO) prallethrin (ISO) pyrrolidine dithiocarbamate (ISO) quinoxyfen (ISO) resveratrol (ISO) Salidroside (ISO) SB 203580 (EXP) simvastatin (ISO) sodium fluoride (EXP,ISO) T-2 toxin (ISO) tacrolimus hydrate (EXP) Theaflavin 3,3'-digallate (ISO) titanium dioxide (ISO) tributyl phosphate (ISO) tributylstannane (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triphenylstannane (ISO) triptonide (ISO) tris(2-butoxyethyl) phosphate (ISO) tris(2-chloroethyl) phosphate (ISO) tungsten (ISO) valproic acid (ISO) warfarin (ISO) zinc atom (EXP) zinc(0) (EXP)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Expression and function of osteogenic genes runt-related transcription factor 2 and osterix in orthodontic tooth movement in rats.
Han J and He H, Int J Clin Exp Pathol. 2015 Sep 1;8(9):11895-900. eCollection 2015.
3.
Increased expression of the receptor for activation of NF-kappaB and decreased runt-related transcription factor 2 expression in bone of rats with streptozotocin-induced diabetes.
Hie M and Tsukamoto I, Int J Mol Med. 2010 Oct;26(4):611-8. doi: 10.3892/ijmm_00000506.
4.
Zinc deficiency decreases osteoblasts and osteoclasts associated with the reduced expression of Runx2 and RANK.
Hie M, etal., Bone. 2011 Dec;49(6):1152-9. doi: 10.1016/j.bone.2011.08.019. Epub 2011 Aug 26.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
The novel zinc finger-containing transcription factor osterix is required for osteoblast differentiation and bone formation.
Nakashima K, etal., Cell 2002 Jan 11;108(1):17-29.
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
[Histopathologic features of degenerative aortic valve and its mechanisms].
Sun J, etal., Zhonghua Yi Xue Za Zhi. 2013 Jan 22;93(4):280-4.
Sp7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 135,363,193 - 135,373,376 (-) NCBI GRCr8 mRatBN7.2 7 133,484,609 - 133,494,788 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 133,484,609 - 133,494,847 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 135,247,146 - 135,255,771 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 137,476,525 - 137,485,150 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 137,461,680 - 137,470,323 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 143,957,316 - 143,967,488 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 143,958,858 - 143,967,484 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 141,753,826 - 141,762,790 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 141,109,771 - 141,118,397 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 141,186,207 - 141,194,213 (-) NCBI Celera 7 129,919,226 - 129,927,844 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
SP7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 53,326,575 - 53,344,793 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 53,326,575 - 53,345,315 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 53,720,359 - 53,738,577 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 52,006,626 - 52,015,804 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 52,006,628 - 52,015,804 NCBI Celera 12 53,369,632 - 53,379,307 (-) NCBI Celera Cytogenetic Map 12 q13.13 NCBI HuRef 12 50,761,885 - 50,771,562 (-) NCBI HuRef CHM1_1 12 53,687,545 - 53,697,201 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 53,292,290 - 53,310,533 (-) NCBI T2T-CHM13v2.0
Sp7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 102,265,038 - 102,275,498 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 102,265,041 - 102,275,617 (-) Ensembl GRCm39 Ensembl GRCm38 15 102,356,603 - 102,367,035 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 102,356,606 - 102,367,182 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 102,187,608 - 102,196,702 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 102,184,644 - 102,194,367 (-) NCBI MGSCv36 mm8 Celera 15 104,514,244 - 104,523,282 (-) NCBI Celera Cytogenetic Map 15 F3 NCBI cM Map 15 57.51 NCBI
Sp7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 583,981 - 602,856 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 583,981 - 602,856 (-) NCBI ChiLan1.0 ChiLan1.0
SP7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 40,849,740 - 40,859,601 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 40,846,505 - 40,856,578 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 35,409,055 - 35,427,871 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 36,191,091 - 36,209,494 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 36,199,673 - 36,209,494 (+) Ensembl panpan1.1 panPan2
SP7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 1,878,612 - 1,887,063 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 1,880,424 - 1,887,679 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 44,365,530 - 44,382,281 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 1,871,509 - 1,888,303 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 27 1,889,794 - 1,906,485 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 1,874,976 - 1,891,740 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 44,766,164 - 44,782,966 (-) NCBI UU_Cfam_GSD_1.0
Sp7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 62,544,586 - 62,554,293 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 10,612,060 - 10,619,628 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 10,610,542 - 10,613,335 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SP7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 18,543,534 - 18,565,776 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 18,541,368 - 18,566,668 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 18,978,684 - 19,002,387 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SP7
Sp7
.
Predicted Target Of
Count of predictions: 103 Count of miRNA genes: 77 Interacting mature miRNAs: 82 Transcripts: ENSRNOT00000018828 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
D7Mit1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 135,371,291 - 135,371,468 (+) Marker Load Pipeline mRatBN7.2 7 133,492,707 - 133,492,884 (+) MAPPER mRatBN7.2 Rnor_6.0 7 143,965,415 - 143,965,591 NCBI Rnor6.0 Rnor_5.0 7 141,760,721 - 141,760,897 UniSTS Rnor5.0 RGSC_v3.4 7 141,116,327 - 141,116,504 RGD RGSC3.4 RGSC_v3.4 7 141,116,328 - 141,116,504 UniSTS RGSC3.4 RGSC_v3.1 7 141,192,765 - 141,192,941 RGD Celera 7 129,925,775 - 129,925,951 UniSTS RH 3.4 Map 7 1065.7 UniSTS RH 3.4 Map 7 1065.7 RGD RH 2.0 Map 7 799.2 RGD Cytogenetic Map 7 q36 UniSTS
PMC151001P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 133,486,386 - 133,486,584 (+) MAPPER mRatBN7.2 Rnor_6.0 7 143,959,094 - 143,959,291 NCBI Rnor6.0 Rnor_5.0 7 141,754,402 - 141,754,599 UniSTS Rnor5.0 RGSC_v3.4 7 141,110,007 - 141,110,204 UniSTS RGSC3.4 Celera 7 129,919,462 - 129,919,659 UniSTS Cytogenetic Map 7 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
7
2
12
104
40
37
23
9
23
5
94
31
93
32
50
14
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018828 ⟹ ENSRNOP00000018828
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 133,484,953 - 133,494,156 (-) Ensembl Rnor_6.0 Ensembl 7 143,958,858 - 143,966,863 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000081758 ⟹ ENSRNOP00000074457
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 133,484,609 - 133,494,847 (-) Ensembl Rnor_6.0 Ensembl 7 143,958,858 - 143,967,484 (-) Ensembl
RefSeq Acc Id:
NM_001037632 ⟹ NP_001032721
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 135,364,735 - 135,373,361 (-) NCBI mRatBN7.2 7 133,486,151 - 133,494,777 (-) NCBI Rnor_6.0 7 143,958,858 - 143,967,484 (-) NCBI Rnor_5.0 7 141,753,826 - 141,762,790 (-) NCBI RGSC_v3.4 7 141,109,771 - 141,118,397 (-) RGD Celera 7 129,919,226 - 129,927,844 (-) RGD
Sequence:
AGCAGCAGCAGCAGCAGCAGCAGCAGTAGCAGCAGCAGCAGCAGCAGCAGCAGAAGCTGCCGCGCCACTGAGTAGCGGCAAGGACTCCGAGTCAAGAGTCGGATTCTAGGATTGGATCTGAGTGAGCC
hide sequence
RefSeq Acc Id:
NM_181374 ⟹ NP_852039
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 135,364,735 - 135,372,740 (-) NCBI mRatBN7.2 7 133,486,151 - 133,494,156 (-) NCBI Rnor_6.0 7 143,958,858 - 143,966,863 (-) NCBI Rnor_5.0 7 141,753,826 - 141,762,790 (-) NCBI RGSC_v3.4 7 141,109,771 - 141,118,397 (-) RGD Celera 7 129,919,226 - 129,927,223 (-) NCBI
Sequence:
ATTCTCCCATTCTCCCTCCCTCTCCCTTTCCCCTCTCCCACTGGCTCCTGGTTCTCTCCATCTGCCTGACTCCTTGGGACCCGGTCCCCAGCCTGAGGATGGCGTCCTCTCTGCTTGAGGAAGAAGCT
hide sequence
RefSeq Acc Id:
XM_017594791 ⟹ XP_017450280
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 135,363,193 - 135,373,376 (-) NCBI mRatBN7.2 7 133,484,609 - 133,494,788 (-) NCBI Rnor_6.0 7 143,957,316 - 143,967,488 (-) NCBI
Sequence:
CAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTAGCAGCAGCAGCAGCAGCAGCAGCAGAAGCTGCCGCGCCACTGAGTAGCGGCAAGGACTCCGAGTCAAGAGTCGGATTCTAGGATTGGATCTGAGTG
hide sequence
RefSeq Acc Id:
NP_001032721 ⟸ NM_001037632
- Peptide Label:
isoform 1
- UniProtKB:
Q6IMK1 (UniProtKB/TrEMBL), Q811U1 (UniProtKB/TrEMBL)
- Sequence:
MLTAACSKFGGSSPLRDSTALGKGGTKKPYTDLSAPKTMGDAYPAPFSSTNGLLSPAGSPPAPASGYANDYPPFPHSFPGPTGAQDPGLLVPKGHSSSDCLPSVYTSLDMSHPYGSWYKAGIHAGISP
hide sequence
RefSeq Acc Id:
NP_852039 ⟸ NM_181374
- Peptide Label:
isoform 2
- UniProtKB:
Q6IMK2 (UniProtKB/TrEMBL), F7EYG4 (UniProtKB/TrEMBL), Q811U1 (UniProtKB/TrEMBL)
- Sequence:
MASSLLEEEAHYGSSPLAMLTAACSKFGGSSPLRDSTALGKGGTKKPYTDLSAPKTMGDAYPAP
hide sequence
RefSeq Acc Id:
XP_017450280 ⟸ XM_017594791
- Peptide Label:
isoform X1
- UniProtKB:
Q6IMK2 (UniProtKB/TrEMBL), F7EYG4 (UniProtKB/TrEMBL), Q811U1 (UniProtKB/TrEMBL)
- Sequence:
MASSLLEEEAHYGSSPLAMLTAACSKFGGSSPLRDSTALGKGGTKKPYTDLSAPKTMGDAYPAPFSSTNGLLSPAGSPPAPASGYANDYPPFPHSFPGPTGAQDPGLLVPKGHSSSDCLPSVYTSLDM
hide sequence
Ensembl Acc Id:
ENSRNOP00000018828 ⟸ ENSRNOT00000018828
Ensembl Acc Id:
ENSRNOP00000074457 ⟸ ENSRNOT00000081758
RGD ID: 13695698 Promoter ID: EPDNEW_R6223 Type: multiple initiation site Name: Sp7_1 Description: Sp7 transcription factor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 143,967,469 - 143,967,529 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-02-11
Sp7
Sp7 transcription factor
Symbol and Name status set to approved
625702 APPROVED
