Advanced Search (OLGA)

Gene: Gjd4 (gap junction protein, delta 4) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Gjd4

Name:

gap junction protein, delta 4

RGD ID:

628621

Description:

Predicted to enable gap junction channel activity. Predicted to be involved in cell-cell signaling. Predicted to act upstream of or within regulation of satellite cell activation involved in skeletal muscle regeneration. Predicted to be located in plasma membrane. Predicted to be part of connexin complex. Orthologous to human GJD4 (gap junction protein delta 4); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

connexin 39; Cx39; gap junction channel protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GJD4 (gap junction protein delta 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Gjd4 (gap junction protein, delta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gjd4 (gap junction protein delta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GJD4 (gap junction protein delta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GJD4 (gap junction protein delta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gjd4 (gap junction protein delta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GJD4 (gap junction protein delta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GJD4 (gap junction protein delta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gjd4 (gap junction protein delta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Gjd4 (gap junction protein, delta 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GJD4 (gap junction protein delta 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gjd4	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	62,043,770 - 62,047,527 (-)	NCBI		GRCr8
mRatBN7.2	17	57,348,844 - 57,352,601 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	57,349,877 - 57,352,446 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	60,513,557 - 60,516,116 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	64,516,574 - 64,519,133 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	58,670,719 - 58,673,284 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	62,297,086 - 62,299,655 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	62,297,086 - 62,299,655 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	64,070,841 - 64,073,410 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	66,004,119 - 66,006,688 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	66,015,269 - 66,015,903 (-)	NCBI
Celera	17	58,630,370 - 58,632,939 (-)	NCBI		Celera
Cytogenetic Map	17	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gjd4	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1550043	6480464	[Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in increased methylation of GJD4 gene	CTD	PMID:21212295
Gjd4	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of GJD4 mRNA	CTD	PMID:32109520
Gjd4	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2,3,7,8-tetrachlorodibenzofuran results in decreased expression of GJD4 mRNA	CTD	PMID:32109520
Gjd4	Rat	2-palmitoylglycerol	increases expression	ISO	RGD:1603351	6480464	2-palmitoylglycerol results in increased expression of GJD4 mRNA	CTD	PMID:37199045
Gjd4	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of GJD4 mRNA	CTD	PMID:16483693
Gjd4	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1603351	6480464	Benzo(a)pyrene affects the methylation of GJD4 promoter	CTD	PMID:27901495
Gjd4	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1603351	6480464	Benzo(a)pyrene results in decreased methylation of GJD4 exon	CTD	PMID:27901495
Gjd4	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of GJD4 mRNA	CTD	PMID:25181051
Gjd4	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of GJD4 mRNA	CTD	PMID:19167457
Gjd4	Rat	CGP 52608	multiple interactions	ISO	RGD:1603351	6480464	CGP 52608 promotes the reaction [RORA protein binds to GJD4 gene]	CTD	PMID:28238834
Gjd4	Rat	dexamethasone	increases expression	ISO	RGD:1550043	6480464	Dexamethasone results in increased expression of GJD4 mRNA	CTD	PMID:22733784
Gjd4	Rat	hydralazine	multiple interactions	ISO	RGD:1603351	6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of GJD4 mRNA	CTD	PMID:17183730
Gjd4	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1550043	6480464	[Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in increased methylation of GJD4 gene	CTD	PMID:21212295
Gjd4	Rat	paracetamol	decreases expression	ISO	RGD:1603351	6480464	Acetaminophen results in decreased expression of GJD4 mRNA	CTD	PMID:22230336
Gjd4	Rat	resveratrol	multiple interactions	ISO	RGD:1603351	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of GJD4 mRNA	CTD	PMID:23557933
Gjd4	Rat	Theaflavin 3,3'-digallate	affects expression	ISO	RGD:1603351	6480464	theaflavin-3,3'-digallate affects the expression of GJD4 mRNA	CTD	PMID:34925699
Gjd4	Rat	valproic acid	multiple interactions	ISO	RGD:1603351	6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of GJD4 mRNA	CTD	PMID:17183730

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gjd4	Rat	cell communication	involved_in	IEA	InterPro:IPR000500\|InterPro:IPR017990	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gjd4	Rat	cell-cell signaling	involved_in	IBA	MGI:1334209\|MGI:2153060\|MGI:95713\|MGI:95716\|MGI:95718\|MGI:95720\|MGI:95722\|PANTHER:PTN008334405\|RGD:2690\|RGD:2691\|RGD:2694\|RGD:628889\|RGD:628890\|UniProtKB:P17302\|ZFIN:ZDB-GENE-030911-1\|ZFIN:ZDB-GENE-991105-4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gjd4	Rat	regulation of satellite cell activation involved in skeletal muscle regeneration	acts_upstream_of_or_within	ISO	RGD:1550043	1624291	MGI:5009133 PMID:21272575	RGD	PMID:21272575
Gjd4	Rat	regulation of satellite cell activation involved in skeletal muscle regeneration	acts_upstream_of_or_within	IEA	UniProtKB:Q8BSD4\|ensembl:ENSMUSP00000035472	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gjd4	Rat	transmembrane transport	involved_in	IEA	GO:0005243	1600115	GO_REF:0000108	GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gjd4	Rat	anchoring junction	located_in	IEA	UniProtKB-KW:KW-0965	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gjd4	Rat	connexin complex	part_of	IBA	MGI:2384150\|MGI:95718\|MGI:95720\|MGI:95722\|PANTHER:PTN008334405\|RGD:2690\|RGD:2691\|RGD:2692\|RGD:628890\|UniProtKB:P28228\|UniProtKB:P29033\|UniProtKB:P33725\|UniProtKB:P36382\|UniProtKB:P48165\|UniProtKB:Q6S9C0\|UniProtKB:Q8N144\|UniProtKB:Q9Y6H8\|ZFIN:ZDB-GENE-030911-1	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gjd4	Rat	connexin complex	part_of	IEA	InterPro:IPR000500\|InterPro:IPR017990	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gjd4	Rat	gap junction	located_in	IEA	UniProtKB-SubCell:SL-0124	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gjd4	Rat	gap junction	located_in	IEA	UniProtKB-KW:KW-0303	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gjd4	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gjd4	Rat	plasma membrane	located_in	ISO	RGD:1550043	1624291	PMID:15466892	RGD	PMID:15466892
Gjd4	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gjd4	Rat	plasma membrane	located_in	IEA	UniProtKB:Q8BSD4\|ensembl:ENSMUSP00000035472	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gjd4	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gjd4	Rat	gap junction channel activity	enables	IBA	MGI:1339969\|MGI:2153060\|MGI:2384150\|MGI:95713\|MGI:95716\|MGI:95718\|MGI:95720\|MGI:95722\|PANTHER:PTN008334405\|RGD:1308942\|RGD:2690\|RGD:2692\|RGD:61926\|RGD:621820\|RGD:628889\|RGD:728891\|UniProtKB:O95452\|UniProtKB:P17302\|UniProtKB:P29033\|UniProtKB:P36382\|UniProtKB:P48165\|UniProtKB:Q5T442\|UniProtKB:Q6PEY0\|UniProtKB:Q9Y6H8\|ZFIN:ZDB-GENE-010607-3\|ZFIN:ZDB-GENE-030911-1\|ZFIN:ZDB-GENE-031217-3\|ZFIN:ZDB-GENE-040406-1\|ZFIN:ZDB-GENE-040407-3\|ZFIN:ZDB-GENE-050320-121\|ZFIN:ZDB-GENE-050616-10\|ZFIN:ZDB-GENE-050616-11\|ZFIN:ZDB-GENE-050616-5\|ZFIN:ZDB-GENE-991105-4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	The novel mouse connexin39 gene is expressed in developing striated muscle fibers.	von Maltzahn J, etal., J Cell Sci 2004 Oct 15;117(Pt 22):5381-92. Epub 2004 Oct 5.

PMID:16194882	PMID:19129462	PMID:21272575

Gjd4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	62,043,770 - 62,047,527 (-)	NCBI		GRCr8
mRatBN7.2	17	57,348,844 - 57,352,601 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	57,349,877 - 57,352,446 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	60,513,557 - 60,516,116 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	64,516,574 - 64,519,133 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	58,670,719 - 58,673,284 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	62,297,086 - 62,299,655 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	62,297,086 - 62,299,655 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	64,070,841 - 64,073,410 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	66,004,119 - 66,006,688 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	66,015,269 - 66,015,903 (-)	NCBI
Celera	17	58,630,370 - 58,632,939 (-)	NCBI		Celera
Cytogenetic Map	17	q12.1	NCBI

GJD4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	35,605,341 - 35,608,935 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	35,605,341 - 35,608,935 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	35,894,269 - 35,897,863 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	35,934,344 - 35,937,869 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	10	35,659,067 - 35,662,598 (+)	NCBI		Celera
Cytogenetic Map	10	p11.21	NCBI
HuRef	10	35,611,976 - 35,615,507 (+)	NCBI		HuRef
CHM1_1	10	35,894,286 - 35,897,810 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	35,633,783 - 35,637,383 (+)	NCBI		T2T-CHM13v2.0

Gjd4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	9,278,124 - 9,289,808 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	9,278,607 - 9,282,809 (-)	Ensembl		GRCm39 Ensembl
GRCm38	18	9,278,124 - 9,289,808 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	9,278,607 - 9,282,809 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	9,278,605 - 9,282,807 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	9,278,605 - 9,282,807 (-)	NCBI		MGSCv36	mm8
Celera	18	9,314,430 - 9,318,631 (-)	NCBI		Celera
Cytogenetic Map	18	A1	NCBI
cM Map	18	4.91	NCBI

Gjd4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955462	5,892,482 - 5,897,482 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955462	5,893,296 - 5,901,976 (-)	NCBI	ChiLan1.0	ChiLan1.0

GJD4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	48,250,864 - 48,257,148 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	48,256,194 - 48,262,476 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	35,698,294 - 35,735,764 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	36,305,964 - 36,322,448 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	36,306,919 - 36,322,448 (+)	Ensembl	panpan1.1		panPan2

GJD4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	1,360,697 - 1,365,411 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	1,449,108 - 1,452,111 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	1,642,709 - 1,645,734 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	1,641,937 - 1,645,530 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	1,414,394 - 1,417,412 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	1,457,243 - 1,460,245 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	1,578,446 - 1,581,436 (-)	NCBI		UU_Cfam_GSD_1.0

Gjd4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	14,378,618 - 14,382,226 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936574	3,878,383 - 3,881,718 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936574	3,878,436 - 3,881,704 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GJD4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	10	58,069,679 - 58,076,738 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	63,675,003 - 63,681,354 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GJD4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	34,856,892 - 34,886,231 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	34,883,069 - 34,886,136 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666056	44,048,057 - 44,053,996 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gjd4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624805	10,006,616 - 10,009,618 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624805	10,006,548 - 10,009,592 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Gjd4
33 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	37
Count of miRNA genes:	33
Interacting mature miRNAs:	37
Transcripts:	ENSRNOT00000024855
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
7411575	Bw140	Body weight QTL 140	30.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
1354654	Spl7	Serum phospholipid level QTL 7	5.5		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	17	50890908	60781592	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
1354629	Scl31	Serum cholesterol level QTL 31	4.1		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	17	50890908	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1600398	Edcs5	Endometrial carcinoma susceptibility QTL 5	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	17	57246723	70852846	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24184890	79524188	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
61466	Niddm12	Non-insulin dependent diabetes mellitus QTL 12	3.2	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	54029929	60463637	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	42073160	69599340	Rat
8694181	Bw151	Body weight QTL 151	4.36	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			23930421	79524188	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat
2302365	Gluco40	Glucose level QTL 40	4.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	57246843	82046127	Rat
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	41354651	60463643	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	7e-07	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
70210	Cm15	Cardiac mass QTL 15	6.5		heart right ventricle mass (VT:0007033)	heart right ventricle wet weight (CMO:0000072)	17	57246723	70156904	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	53498828	82479847	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	49920154	86533673	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
2317053	Aia25	Adjuvant induced arthritis QTL 25	2.69		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	50909196	60781426	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
7394837	Memor18	Memory QTL 18			exploratory behavior trait (VT:0010471)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	17	56396477	63640182	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	50909099	86022412	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
2303580	Gluco49	Glucose level QTL 49	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	50040271	86533673	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
1	2	29	69	27	26	14	8	14	2	77	42	62	18	41	12


RefSeq Transcripts	NM_001100487	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF536558	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY834200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474080	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024855 ⟹ ENSRNOP00000024855

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	57,349,877 - 57,352,446 (-)	Ensembl
Rnor_6.0 Ensembl	17	62,297,086 - 62,299,655 (-)	Ensembl

RefSeq Acc Id:

NM_001100487 ⟹ NP_001093957

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	62,043,770 - 62,047,527 (-)	NCBI
mRatBN7.2	17	57,348,844 - 57,352,601 (-)	NCBI
Rnor_6.0	17	62,297,086 - 62,299,655 (-)	NCBI
Rnor_5.0	17	64,070,841 - 64,073,410 (-)	NCBI
RGSC_v3.4	17	66,004,119 - 66,006,688 (-)	RGD
Celera	17	58,630,370 - 58,632,939 (-)	RGD

Sequence:

show sequence

ATGGAGAACTTGAACTTGTTGGGATTCCTCTTCATCACCTTAAACTGTAATGTGACCATCATGGGCATGCTCTGGCTGATCGTGGCAGTCTTGCTAAGAATGCTGGTGGTGGTCTTGGCAGGGTCACC
TATCTATGAGGATGAACAAGAGAGATTTATTTGCAACACATTGCAACCAGGATGTGCCAACGTTTGCTACGACCTCTTTTCCCCAGTGTCACCGCTGCGGTTCTGGCTGGTGCAGAGTCTGGCCTTGC
TTCTGCCATCGGTGGTCTTTGGCACCTACACCCTGCACCGCAGCACGAAGCTGGCTGCAGCGGCAGCCTGCAGGCCCCAGGTGCCCGACCTGTCGTCTGCCTACCTGGTGCACCTACTGCTTCGCATG
CTGCTGGAGGCGGGGCTAGCTTTCCTGCACTACTTTCTCTTTGGCTTTTCGGTGCCCGCCCACGTGTCTTGCTCACGTGTGCCCTGCTCAGGAGCTGTAGACTGCTACGTGTCGCGACCCACGGAGAA
GTCCCTCCTGATGCTATTCTTTTGGGCAGTGAGTGCACTGTCCTTCCTGCTCAGCTTGGTTGACCTGCTTTGCAGCCTGCCGAAGAGGACACTGAGGACCACGCAGTGGGTGAAGGGAGAGGCCAGAG
CAGGCTGTGAAGTCCCTGCACCTTCCCCTTGCCTCTTACAAGACCCTCAGGGCTATCATAGCCAGGGACAGGTAGACCAGGAGGCCAGACAGGAGGAGCAGGTTGTGCCTGAGTTCTCCGTGTGGACA
GCGGGGCAGGGCGGCAACAGCAAGGCTGGTCAGGTCAGTGCGTCAGGGTTGCTGGAGCATTCAGACCAAGATGTTAGTGAGGTCACTTCCTCAGCAGGTGACAGGCTGGCAGTGGCTCAAACACCGCA
TGAATTTAGATCCTACAGAGAGACTTCACCAGACCTGGGGAGCAAAAACACCCGATCAGATGCGCTTTCCTTGGCTACCCAGAGTCACCTGGCCAGACACTGTTCAGCCAGCCAGCCTCAAGCTCCAG
GTCGGCTGACCACCTCAGGCAGTGCCCCCCATCTGAGAACCAAAAAGTCTGAGTGGGTATGA

hide sequence


Protein RefSeqs	NP_001093957	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAN17801	(Get FASTA)	NCBI Sequence Viewer
	AAW38939	(Get FASTA)	NCBI Sequence Viewer
	EDL83777	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024855
	ENSRNOP00000024855.1

RefSeq Acc Id:

NP_001093957 ⟸ NM_001100487

- UniProtKB:

G3V8D7 (UniProtKB/TrEMBL), A6KPN1 (UniProtKB/TrEMBL), A6KPN2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MENLNLLGFLFITLNCNVTIMGMLWLIVAVLLRMLVVVLAGSPIYEDEQERFICNTLQPGCANVCYDLFSPVSPLRFWLVQSLALLLPSVVFGTYTLHRSTKLAAAAACRPQVPDLSSAYLVHLLLRM
LLEAGLAFLHYFLFGFSVPAHVSCSRVPCSGAVDCYVSRPTEKSLLMLFFWAVSALSFLLSLVDLLCSLPKRTLRTTQWVKGEARAGCEVPAPSPCLLQDPQGYHSQGQVDQEARQEEQVVPEFSVWT
AGQGGNSKAGQVSASGLLEHSDQDVSEVTSSAGDRLAVAQTPHEFRSYRETSPDLGSKNTRSDALSLATQSHLARHCSASQPQAPGRLTTSGSAPHLRTKKSEWV

hide sequence

Ensembl Acc Id:

ENSRNOP00000024855 ⟸ ENSRNOT00000024855

Protein Domains

Connexin N-terminal Gap junction protein cysteine-rich

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V8D7-F1-model_v2	AlphaFold	G3V8D7	1-361	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-8949	BioCyc
Ensembl Genes	ENSRNOG00000018407	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024855	ENTREZGENE
	ENSRNOT00000024855.3	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1440.80	UniProtKB/TrEMBL
InterPro	Connexin	UniProtKB/TrEMBL
	Connexin_CCC	UniProtKB/TrEMBL
	Connexin_CS	UniProtKB/TrEMBL
	Connexin_N	UniProtKB/TrEMBL
	Connexin_N_sf	UniProtKB/TrEMBL
KEGG Report	rno:266707	UniProtKB/TrEMBL
NCBI Gene	266707	ENTREZGENE
PANTHER	Connexin	UniProtKB/TrEMBL
	GAP JUNCTION DELTA-4 PROTEIN	UniProtKB/TrEMBL
Pfam	Connexin	UniProtKB/TrEMBL
PhenoGen	Gjd4	PhenoGen
PRINTS	CONNEXIN	UniProtKB/TrEMBL
PROSITE	CONNEXINS_1	UniProtKB/TrEMBL
	CONNEXINS_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018407	RatGTEx
SMART	CNX	UniProtKB/TrEMBL
	Connexin_CCC	UniProtKB/TrEMBL
UniProt	A6KPN1	ENTREZGENE, UniProtKB/TrEMBL
	A6KPN2	ENTREZGENE, UniProtKB/TrEMBL
	G3V8D7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-25	Gjd4	gap junction protein, delta 4	Cx39	connexin 39	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Cx39	connexin 39			Symbol and Name status set to approved	1299863	APPROVED
2003-02-27	Cx39	connexin 39			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message