Symbol:
C4bpa
Name:
complement component 4 binding protein, alpha
RGD ID:
2235
Description:
Predicted to enable complement binding activity. Predicted to be involved in several processes, including negative regulation of complement activation, classical pathway; regulation of opsonization; and response to symbiotic bacterium. Predicted to act upstream of or within binding activity of sperm to zona pellucida. Predicted to be located in acrosomal matrix; cell body; and outer acrosomal membrane. Predicted to be part of zona pellucida receptor complex. Predicted to be active in extracellular space and plasma membrane. Human ortholog(s) of this gene implicated in COVID-19. Orthologous to human C4BPA (complement component 4 binding protein alpha); PARTICIPATES IN coagulation cascade pathway; complement system pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
C4b-binding protein alpha chain; C4BP; MGC108761
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 44,627,959 - 44,663,552 (-) NCBI GRCr8 mRatBN7.2 13 42,075,715 - 42,111,205 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 42,075,717 - 42,111,205 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 44,682,730 - 44,717,817 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 45,970,875 - 46,005,959 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 43,215,123 - 43,250,642 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 47,342,090 - 47,377,580 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 47,342,079 - 47,377,703 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 52,430,754 - 52,466,244 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 43,552,947 - 43,588,565 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 43,567,082 - 43,598,278 (-) NCBI Celera 13 42,426,949 - 42,461,963 (-) NCBI Celera RH 3.4 Map 13 109.8 RGD Cytogenetic Map 13 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
C4bpa Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of C4BPA mRNA CTD PMID:30723492 C4bpa Rat 17beta-estradiol decreases expression ISO C4BPA (Homo sapiens) 6480464 Estradiol results in decreased expression of C4BPA mRNA CTD PMID:20106945 C4bpa Rat 17beta-estradiol increases expression ISO C4BPA (Homo sapiens) 6480464 Estradiol results in increased expression of C4BPA mRNA CTD PMID:18191855 C4bpa Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO C4BPA (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 C4bpa Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO C4BPA (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of C4BPA mRNA CTD PMID:20106945 C4bpa Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of C4BPA mRNA CTD PMID:21215274 C4bpa Rat 2,4,6-tribromophenol increases expression ISO C4BPA (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 C4bpa Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of C4BPA mRNA CTD PMID:21346803 C4bpa Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of C4BPA mRNA CTD PMID:21346803 C4bpa Rat 2-acetamidofluorene decreases expression EXP 6480464 2-Acetylaminofluorene results in decreased expression of C4BPA mRNA CTD PMID:16510358 C4bpa Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO C4BPA (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of C4BPA protein CTD PMID:31675489 C4bpa Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of C4BPA mRNA CTD PMID:19483382 C4bpa Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole decreases expression EXP 6480464 Omeprazole results in decreased expression of C4BPA mRNA CTD PMID:25626140 C4bpa Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of C4BPA mRNA CTD PMID:19483382 C4bpa Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of C4BPA mRNA CTD PMID:31881176 C4bpa Rat Actein increases expression EXP 6480464 actein results in increased expression of C4BPA mRNA CTD PMID:19527300 C4bpa Rat aflatoxin B1 affects expression ISO C4BPA (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of C4BPA protein CTD PMID:20106945 C4bpa Rat aflatoxin B1 decreases expression ISO C4BPA (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of C4BPA mRNA CTD PMID:22100608 and PMID:27153756 C4bpa Rat aflatoxin B1 decreases methylation ISO C4BPA (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of C4BPA gene CTD PMID:27153756 C4bpa Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of C4BPA mRNA CTD PMID:19483382 C4bpa Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of C4BPA mRNA CTD PMID:16483693 C4bpa Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of C4BPA mRNA CTD PMID:19483382 C4bpa Rat benzo[a]pyrene decreases expression ISO C4BPA (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of C4BPA mRNA CTD PMID:26238291 and PMID:32234424 C4bpa Rat benzo[a]pyrene affects methylation ISO C4BPA (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of C4BPA promoter CTD PMID:27901495 C4bpa Rat benzo[a]pyrene increases methylation ISO C4BPA (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of C4BPA 5' UTR CTD PMID:27901495 C4bpa Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of C4BPA mRNA CTD PMID:16648578 C4bpa Rat bis(2-ethylhexyl) phthalate multiple interactions ISO C4BPA (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of C4BPA mRNA CTD PMID:32949613 C4bpa Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of C4BPA mRNA and bisphenol A results in decreased expression of ZP3R mRNA CTD PMID:25181051 C4bpa Rat bisphenol A multiple interactions ISO Zp3r (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in increased expression of C4BPA protein CTD PMID:35999755 C4bpa Rat bisphenol A decreases expression ISO C4BPA (Homo sapiens) 6480464 bisphenol A results in decreased expression of C4BPA protein CTD PMID:31675489 C4bpa Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of C4BPA mRNA CTD PMID:30903817 C4bpa Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of C4BPA mRNA CTD PMID:30816183 more ... C4bpa Rat Butylbenzyl phthalate multiple interactions ISO C4BPA (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of C4BPA mRNA CTD PMID:32949613 C4bpa Rat cadmium atom affects binding ISO C4BPA (Homo sapiens) 6480464 C4BPA protein binds to Cadmium CTD PMID:23896426 C4bpa Rat carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of C4BPA mRNA CTD PMID:24911292 C4bpa Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of C4BPA mRNA CTD PMID:19483382 C4bpa Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of C4BPA mRNA CTD PMID:24386269 C4bpa Rat copper atom affects binding ISO C4BPA (Homo sapiens) 6480464 C4BPA protein binds to Copper CTD PMID:23896426 C4bpa Rat copper(0) affects binding ISO C4BPA (Homo sapiens) 6480464 C4BPA protein binds to Copper CTD PMID:23896426 C4bpa Rat corosolic acid increases expression ISO C4BPA (Homo sapiens) 6480464 corosolic acid results in increased expression of C4BPA mRNA CTD PMID:37939859 C4bpa Rat cyclosporin A decreases expression ISO C4BPA (Homo sapiens) 6480464 Cyclosporine results in decreased expression of C4BPA mRNA CTD PMID:20106945 more ... C4bpa Rat decabromodiphenyl ether increases expression ISO C4BPA (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of C4BPA protein CTD PMID:31675489 C4bpa Rat dextran sulfate multiple interactions ISO Zp3r (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in increased expression of C4BPA protein CTD PMID:35999755 C4bpa Rat dicrotophos decreases expression ISO C4BPA (Homo sapiens) 6480464 dicrotophos results in decreased expression of C4BPA mRNA CTD PMID:28302478 C4bpa Rat diisononyl phthalate multiple interactions ISO C4BPA (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of C4BPA mRNA CTD PMID:32949613 C4bpa Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of C4BPA mRNA CTD PMID:29391264 C4bpa Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of C4BPA mRNA CTD PMID:24136188 C4bpa Rat furan increases methylation EXP 6480464 furan results in increased methylation of C4BPA gene CTD PMID:22079235 C4bpa Rat furan decreases expression EXP 6480464 furan results in decreased expression of ZP3R mRNA CTD PMID:25539665 C4bpa Rat genistein decreases expression ISO Zp3r (Mus musculus) 6480464 Genistein results in decreased expression of ZP3R mRNA CTD PMID:32186404 C4bpa Rat graphite affects expression EXP 6480464 Graphite affects the expression of ZP3R mRNA CTD PMID:29933104 C4bpa Rat hexachlorobenzene increases expression EXP 6480464 Hexachlorobenzene results in increased expression of C4BPA mRNA CTD PMID:15159207 C4bpa Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of C4BPA mRNA CTD PMID:19483382 C4bpa Rat lansoprazole decreases expression EXP 6480464 Lansoprazole results in decreased expression of C4BPA mRNA CTD PMID:25626140 C4bpa Rat lead nitrate multiple interactions ISO C4BPA (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of C4BPA mRNA CTD PMID:32949613 C4bpa Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of C4BPA mRNA CTD PMID:28801915 C4bpa Rat mercury atom multiple interactions ISO C4BPA (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of C4BPA mRNA CTD PMID:32949613 C4bpa Rat mercury(0) multiple interactions ISO C4BPA (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of C4BPA mRNA CTD PMID:32949613 C4bpa Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of C4BPA mRNA CTD PMID:30467583 C4bpa Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of C4BPA mRNA CTD PMID:28801915 C4bpa Rat nickel atom affects binding ISO C4BPA (Homo sapiens) 6480464 C4BPA protein binds to Nickel CTD PMID:23896426 C4bpa Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of C4BPA mRNA CTD PMID:33484710 C4bpa Rat O-methyleugenol decreases expression ISO C4BPA (Homo sapiens) 6480464 methyleugenol results in decreased expression of C4BPA mRNA CTD PMID:32234424 C4bpa Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of C4BPA mRNA CTD PMID:19483382 C4bpa Rat omeprazole decreases expression EXP 6480464 Omeprazole results in decreased expression of C4BPA mRNA CTD PMID:25626140 C4bpa Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of C4BPA mRNA CTD PMID:16716893 C4bpa Rat pantoprazole decreases expression EXP 6480464 pantoprazole results in decreased expression of C4BPA mRNA CTD PMID:25626140 C4bpa Rat paracetamol decreases expression ISO C4BPA (Homo sapiens) 6480464 Acetaminophen results in decreased expression of C4BPA mRNA CTD PMID:29067470 C4bpa Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of C4BPA mRNA CTD PMID:19162173 C4bpa Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of C4BPA mRNA CTD PMID:19483382 C4bpa Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of C4BPA mRNA CTD PMID:19162173 C4bpa Rat potassium dichromate increases expression ISO Zp3r (Mus musculus) 6480464 Potassium Dichromate results in increased expression of ZP3R mRNA CTD PMID:23608068 C4bpa Rat propanal decreases expression ISO C4BPA (Homo sapiens) 6480464 propionaldehyde results in decreased expression of C4BPA mRNA CTD PMID:26079696 C4bpa Rat quartz increases expression EXP 6480464 Quartz results in increased expression of C4BPA mRNA CTD PMID:19836432 C4bpa Rat quercetin decreases expression ISO C4BPA (Homo sapiens) 6480464 Quercetin results in decreased expression of C4BPA mRNA CTD PMID:21632981 C4bpa Rat rabeprazole decreases expression EXP 6480464 Rabeprazole results in decreased expression of C4BPA mRNA CTD PMID:25626140 C4bpa Rat silicon dioxide decreases expression ISO C4BPA (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of C4BPA mRNA CTD PMID:25895662 C4bpa Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of C4BPA mRNA CTD PMID:22431001 C4bpa Rat sodium arsenite decreases expression ISO C4BPA (Homo sapiens) 6480464 sodium arsenite results in decreased expression of C4BPA mRNA CTD PMID:29301061 C4bpa Rat sodium fluoride increases expression ISO Zp3r (Mus musculus) 6480464 Sodium Fluoride results in increased expression of ZP3R protein CTD PMID:28918527 C4bpa Rat sulforaphane decreases expression ISO C4BPA (Homo sapiens) 6480464 sulforaphane results in decreased expression of C4BPA mRNA CTD PMID:31838189 C4bpa Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of C4BPA mRNA CTD PMID:31150632 C4bpa Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of C4BPA mRNA CTD PMID:19483382 C4bpa Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of C4BPA mRNA CTD PMID:34492290 C4bpa Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of C4BPA mRNA CTD PMID:30012374 C4bpa Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of C4BPA mRNA CTD PMID:33387578 C4bpa Rat ursodeoxycholic acid affects expression ISO C4BPA (Homo sapiens) 6480464 Ursodeoxycholic Acid affects the expression of C4BPA mRNA CTD PMID:18422935 C4bpa Rat valproic acid decreases methylation ISO C4BPA (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of C4BPA gene CTD PMID:29154799 C4bpa Rat zinc atom affects binding ISO C4BPA (Homo sapiens) 6480464 C4BPA protein binds to Zinc CTD PMID:23896426 C4bpa Rat zinc(0) affects binding ISO C4BPA (Homo sapiens) 6480464 C4BPA protein binds to Zinc CTD PMID:23896426 C4bpa Rat zoledronic acid increases expression ISO C4BPA (Homo sapiens) 6480464 zoledronic acid results in increased expression of C4BPA mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-acetamidofluorene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) Actein (EXP) aflatoxin B1 (ISO) amiodarone (EXP) ammonium chloride (EXP) benzbromarone (EXP) benzo[a]pyrene (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) carbon nanotube (EXP) clofibrate (EXP) cobalt dichloride (EXP) copper atom (ISO) copper(0) (ISO) corosolic acid (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dextran sulfate (ISO) dicrotophos (ISO) diisononyl phthalate (ISO) endosulfan (EXP) flutamide (EXP) furan (EXP) genistein (ISO) graphite (EXP) hexachlorobenzene (EXP) L-ethionine (EXP) lansoprazole (EXP) lead nitrate (ISO) manganese(II) chloride (EXP) mercury atom (ISO) mercury(0) (ISO) methapyrilene (EXP) N-methyl-4-phenylpyridinium (EXP) nickel atom (ISO) nitrofen (EXP) O-methyleugenol (ISO) omeprazole (EXP) ozone (EXP) pantoprazole (EXP) paracetamol (ISO) perfluorooctanoic acid (EXP) pirinixic acid (EXP) potassium dichromate (ISO) propanal (ISO) quartz (EXP) quercetin (ISO) rabeprazole (EXP) silicon dioxide (EXP,ISO) sodium arsenite (ISO) sodium fluoride (ISO) sulforaphane (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (EXP) trichloroethene (EXP) ursodeoxycholic acid (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
1.
Plasma proteomic analysis may identify new markers for radiation-induced lung toxicity in patients with non-small-cell lung cancer.
Cai XW, etal., Int J Radiat Oncol Biol Phys. 2010 Jul 1;77(3):867-76.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
5.
Decline in the expression of C4 binding protein alpha-chain gene during ageing of the rat liver.
Lavery LW and Goyns MH, Biogerontology 2002;3(4):207-11.
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
Immune complement and coagulation dysfunction in adverse outcomes of SARS-CoV-2 infection.
Ramlall V, etal., Nat Med. 2020 Aug 3. pii: 10.1038/s41591-020-1021-2. doi: 10.1038/s41591-020-1021-2.
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
C4bpa Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 44,627,959 - 44,663,552 (-) NCBI GRCr8 mRatBN7.2 13 42,075,715 - 42,111,205 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 42,075,717 - 42,111,205 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 44,682,730 - 44,717,817 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 45,970,875 - 46,005,959 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 43,215,123 - 43,250,642 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 47,342,090 - 47,377,580 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 47,342,079 - 47,377,703 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 52,430,754 - 52,466,244 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 43,552,947 - 43,588,565 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 43,567,082 - 43,598,278 (-) NCBI Celera 13 42,426,949 - 42,461,963 (-) NCBI Celera RH 3.4 Map 13 109.8 RGD Cytogenetic Map 13 q13 NCBI
C4BPA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 207,104,233 - 207,144,972 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 207,104,233 - 207,144,972 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 207,277,578 - 207,318,317 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 205,344,230 - 205,384,940 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 203,666,001 - 203,706,701 NCBI Celera 1 180,529,170 - 180,570,903 (+) NCBI Celera Cytogenetic Map 1 q32.2 NCBI HuRef 1 177,975,014 - 178,014,972 (+) NCBI HuRef CHM1_1 1 208,550,269 - 208,591,017 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 206,369,472 - 206,410,221 (+) NCBI T2T-CHM13v2.0
Zp3r Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 130,474,847 - 130,557,371 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 130,504,450 - 130,557,358 (-) Ensembl GRCm39 Ensembl GRCm38 1 130,547,110 - 130,629,634 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 130,576,713 - 130,629,621 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 132,473,283 - 132,526,183 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 132,404,259 - 132,457,141 (-) NCBI MGSCv36 mm8 Celera 1 133,204,292 - 133,253,007 (-) NCBI Celera Cytogenetic Map 1 E4 NCBI cM Map 1 56.89 NCBI
C4bpa Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 42,613,607 - 42,641,670 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 42,613,659 - 42,641,918 (+) NCBI ChiLan1.0 ChiLan1.0
LOC100984709 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 42,225,348 - 42,261,919 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 42,191,856 - 42,232,559 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 182,707,221 - 182,747,878 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 186,985,220 - 187,025,898 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 186,985,264 - 187,025,898 (+) Ensembl panpan1.1 panPan2
C4BPA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 6,239,036 - 6,268,934 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 6,241,102 - 6,268,910 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 5,802,297 - 5,832,192 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 5,927,762 - 5,957,518 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 5,929,843 - 5,957,511 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 5,861,425 - 5,891,162 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 5,962,886 - 5,992,819 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 6,003,175 - 6,033,127 (+) NCBI UU_Cfam_GSD_1.0
C4BPA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 67,731,179 - 67,776,115 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 67,726,159 - 67,774,369 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 74,106,142 - 74,154,500 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
C4BPA
.
Predicted Target Of
Count of predictions: 26 Count of miRNA genes: 19 Interacting mature miRNAs: 24 Transcripts: ENSRNOT00000005461 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 9589141 Insul28 Insulin level QTL 28 10.82 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 13 9313465 54313465 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 1300163 Cardf1 Cardiac cell morphology QTL 1 4.18 aorta morphology trait (VT:0000272) artery lesion measurement (CMO:0000975) 13 11929449 45417941 Rat 2317040 Aia21 Adjuvant induced arthritis QTL 21 2.75 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 631645 Bp121 Blood pressure QTL 121 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 14915655 59915655 Rat 2317046 Aia8 Adjuvant induced arthritis QTL 8 3.9700000286102295 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 61339 Bp24 Blood pressure QTL 24 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 5994668 44807491 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 2303032 Bp328 Blood pressure QTL 328 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 41184022 45417941 Rat 1331784 Bp222 Blood pressure QTL 222 2.944 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 17694436 53050594 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 2302275 Gluco37 Glucose level QTL 37 3.8 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 13 11929449 46193066 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 2301962 Cm72 Cardiac mass QTL 72 4.12 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 13 31241331 58363171 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 9589164 Gluco66 Glucose level QTL 66 6.67 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 13 15158722 60158722 Rat 738036 Lnnr4 Liver neoplastic nodule remodeling QTL 4 3.64 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 1 42356786 Rat 7411662 Foco29 Food consumption QTL 29 20.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 13 9313465 54313465 Rat
RH94833
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 42,075,847 - 42,075,959 (+) MAPPER mRatBN7.2 Rnor_6.0 13 47,342,223 - 47,342,334 NCBI Rnor6.0 Rnor_5.0 13 52,430,887 - 52,430,998 UniSTS Rnor5.0 RGSC_v3.4 13 43,553,080 - 43,553,191 UniSTS RGSC3.4 Celera 13 42,427,082 - 42,427,193 UniSTS RH 3.4 Map 13 109.8 UniSTS Cytogenetic Map 13 q13 UniSTS
RH94834
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 42,075,852 - 42,075,947 (+) MAPPER mRatBN7.2 Rnor_6.0 13 47,342,228 - 47,342,322 NCBI Rnor6.0 Rnor_5.0 13 52,430,892 - 52,430,986 UniSTS Rnor5.0 RGSC_v3.4 13 43,553,085 - 43,553,179 UniSTS RGSC3.4 Celera 13 42,427,087 - 42,427,181 UniSTS Cytogenetic Map 13 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
4
9
19
72
88
90
59
21
59
6
170
60
53
39
51
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005461 ⟹ ENSRNOP00000005461
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 42,075,717 - 42,111,205 (-) Ensembl Rnor_6.0 Ensembl 13 47,342,079 - 47,377,703 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113710 ⟹ ENSRNOP00000081096
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 42,075,717 - 42,111,205 (-) Ensembl
RefSeq Acc Id:
NM_012516 ⟹ NP_036648
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 44,627,980 - 44,663,471 (-) NCBI mRatBN7.2 13 42,075,715 - 42,111,205 (-) NCBI Rnor_6.0 13 47,342,090 - 47,377,580 (-) NCBI Rnor_5.0 13 52,430,754 - 52,466,244 (-) NCBI RGSC_v3.4 13 43,552,947 - 43,588,565 (-) RGD Celera 13 42,426,949 - 42,461,963 (-) RGD
Sequence:
CGGAATGCAAGGATCACCTGCGCGTGGGTCGACTCCAGGAACTTTTTGATAGAGCAATTACTGGCCAGTTTTAGGATAATGTGATCAACTCTCATCTTGGGAGAAACTAGTACAGGAGAGATCCAGTC
hide sequence
RefSeq Acc Id:
XM_039090318 ⟹ XP_038946246
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 44,627,959 - 44,651,634 (-) NCBI mRatBN7.2 13 42,075,796 - 42,099,373 (-) NCBI
RefSeq Acc Id:
XM_063272018 ⟹ XP_063128088
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 44,647,722 - 44,663,552 (-) NCBI
RefSeq Acc Id:
NP_036648 ⟸ NM_012516
- UniProtKB:
Q5M891 (UniProtKB/TrEMBL), A6IBY8 (UniProtKB/TrEMBL)
- Sequence:
MWTKQHQALRPTRAAHGKLHRNRDAVAWPLSTFCRASGPTLFQMSLTAALWVAVFGKCGPPPDLPYALPASEMNQTDFESHTTLRYNCRPGYSRASSSQSLYCKPLGKWQINIACVKKSCRNPGDLQN
hide sequence
Ensembl Acc Id:
ENSRNOP00000005461 ⟸ ENSRNOT00000005461
RefSeq Acc Id:
XP_038946246 ⟸ XM_039090318
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000081096 ⟸ ENSRNOT00000113710
RefSeq Acc Id:
XP_063128088 ⟸ XM_063272018
- Peptide Label:
isoform X2
RGD ID: 13698784 Promoter ID: EPDNEW_R9309 Type: initiation region Name: C4bpa_1 Description: complement component 4 binding protein, alpha SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 47,377,591 - 47,377,651 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
C4bpa
Complement component 4 binding protein, alpha
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_process
key regulatory protein of the complement system and involved in immune function
634674
gene_regulation
expression in liver is reduced with ageing
1299828
