Symbol:
Ccnk
Name:
cyclin K
RGD ID:
1595690
Description:
Predicted to enable cyclin-dependent protein serine/threonine kinase activator activity; protein kinase binding activity; and protein serine/threonine kinase activity. Predicted to be involved in several processes, including negative regulation by host of viral genome replication; positive regulation of transcription elongation by RNA polymerase II; and transcription by RNA polymerase II. Predicted to act upstream of or within DNA damage response; in utero embryonic development; and negative regulation of stem cell differentiation. Predicted to be located in nucleoplasm. Predicted to be part of cyclin K-CDK12 complex; cyclin K-CDK13 complex; and cyclin/CDK positive transcription elongation factor complex. Predicted to be active in nucleus. Orthologous to human CCNK (cyclin K); PARTICIPATES IN RNA polymerase II transcription elongation pathway; INTERACTS WITH (+)-schisandrin B; acrylamide; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cyclin-K; LOC314427; LOC500715; similar to cyclin K
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CCNK (cyclin K) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Ccnk (cyclin K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ccnk (cyclin K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CCNK (cyclin K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CCNK (cyclin K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ccnk (cyclin K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CCNK (cyclin K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CCNK (cyclin K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ccnk (cyclin K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CCNK (cyclin K)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ccnk (cyclin K)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ccnk (cyclin K)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CycK
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
ccnk-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
BUR2
Alliance
DIOPT (Hieranoid|PANTHER)
Xenopus tropicalis (tropical clawed frog):
ccnk
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 132,854,428 - 132,877,604 (+) NCBI GRCr8 mRatBN7.2 6 127,090,115 - 127,113,195 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 127,090,569 - 127,113,191 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 127,214,939 - 127,237,557 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 127,509,983 - 127,532,601 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 126,868,198 - 126,890,820 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 132,090,235 - 132,113,560 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 132,090,218 - 132,113,557 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 141,260,560 - 141,283,940 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 132,547,058 - 132,569,679 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 6 124,649,851 - 124,672,436 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
(+)-schisandrin B (EXP) (S)-amphetamine (ISO) 1,2-dimethylhydrazine (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) acrylamide (EXP,ISO) actinomycin D (ISO) aflatoxin B1 (ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) butanal (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumarin (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) diethyl maleate (ISO) disulfiram (ISO) endosulfan (EXP) ethyl methanesulfonate (ISO) flutamide (EXP) formaldehyde (ISO) FR900359 (ISO) geldanamycin (ISO) genistein (EXP) gentamycin (EXP) hexane (EXP) methyl methanesulfonate (ISO) nickel subsulfide (ISO) nitrates (ISO) NS-398 (ISO) Nutlin-3 (ISO) resveratrol (ISO) sodium arsenite (ISO) sodium dichromate (ISO) Soman (EXP) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trimellitic anhydride (ISO) tungsten (ISO) valproic acid (ISO) vorinostat (ISO)
Ccnk Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 132,854,428 - 132,877,604 (+) NCBI GRCr8 mRatBN7.2 6 127,090,115 - 127,113,195 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 127,090,569 - 127,113,191 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 127,214,939 - 127,237,557 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 127,509,983 - 127,532,601 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 126,868,198 - 126,890,820 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 132,090,235 - 132,113,560 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 132,090,218 - 132,113,557 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 141,260,560 - 141,283,940 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 132,547,058 - 132,569,679 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 6 124,649,851 - 124,672,436 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
CCNK Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 99,481,409 - 99,512,440 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 99,481,169 - 99,535,044 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 99,947,746 - 99,978,777 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 99,017,492 - 99,047,605 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 99,017,491 - 99,047,604 NCBI Celera 14 80,002,624 - 80,032,734 (+) NCBI Celera Cytogenetic Map 14 q32.2 NCBI HuRef 14 80,131,153 - 80,161,252 (+) NCBI HuRef CHM1_1 14 99,885,503 - 99,915,610 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 93,712,952 - 93,744,005 (+) NCBI T2T-CHM13v2.0
Ccnk Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 108,145,543 - 108,170,252 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 108,145,838 - 108,169,618 (+) Ensembl GRCm39 Ensembl GRCm38 12 108,179,308 - 108,203,359 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 108,179,579 - 108,203,359 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 109,417,948 - 109,441,569 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 108,627,650 - 108,651,164 (+) NCBI MGSCv36 mm8 Celera 12 109,416,780 - 109,443,587 (+) NCBI Celera Cytogenetic Map 12 F1 NCBI cM Map 12 59.23 NCBI
Ccnk Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955438 20,835,825 - 20,849,999 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955438 20,826,818 - 20,850,496 (+) NCBI ChiLan1.0 ChiLan1.0
CCNK Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 100,635,564 - 100,666,123 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 99,852,060 - 99,882,619 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 80,105,372 - 80,136,511 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 99,427,200 - 99,457,678 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 99,438,814 - 99,480,842 (+) Ensembl panpan1.1 panPan2
CCNK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 67,910,772 - 67,927,216 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 67,901,426 - 67,945,214 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 67,424,492 - 67,450,284 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 68,188,098 - 68,213,958 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 68,188,164 - 68,231,870 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 67,849,135 - 67,874,925 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 67,915,647 - 67,941,422 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 68,312,735 - 68,338,539 (+) NCBI UU_Cfam_GSD_1.0
Ccnk Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 6,765,952 - 6,798,802 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936604 3,283,715 - 3,319,572 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936604 3,283,996 - 3,316,516 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CCNK Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 120,487,206 - 120,514,014 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 120,487,140 - 120,514,223 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 128,108,566 - 128,124,064 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CCNK Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 77,436,569 - 77,466,703 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 77,436,479 - 77,467,322 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 64,572,606 - 64,605,678 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ccnk
.
Predicted Target Of
Count of predictions: 328 Count of miRNA genes: 204 Interacting mature miRNAs: 236 Transcripts: ENSRNOT00000057171 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 61329 Eae9 Experimental allergic encephalomyelitis QTL 9 3.7 body mass (VT:0001259) change in body weight (CMO:0002045) 6 122549046 140994061 Rat 2312560 Pur20 Proteinuria QTL 20 2.1 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 125628133 137801795 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1641917 Colcr5 Colorectal carcinoma resistance QTL 5 3.18 0.0009 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 6 122549046 137801795 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 1298087 Iddm18 Insulin dependent diabetes mellitus QTL 18 0.0001 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 6 116506292 130245370 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat 2293085 Iddm29 Insulin dependent diabetes mellitus QTL 29 7.66 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 6 122549046 140286318 Rat
RH128080
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 127,112,720 - 127,112,913 (+) MAPPER mRatBN7.2 Rnor_6.0 6 132,113,087 - 132,113,279 NCBI Rnor6.0 Rnor_5.0 6 141,283,467 - 141,283,659 UniSTS Rnor5.0 RGSC_v3.4 6 132,569,208 - 132,569,400 UniSTS RGSC3.4 Celera 6 124,671,965 - 124,672,157 UniSTS RH 3.4 Map 6 791.5 UniSTS Cytogenetic Map 6 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000057171 ⟹ ENSRNOP00000053998
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 127,090,569 - 127,113,191 (+) Ensembl Rnor_6.0 Ensembl 6 132,090,633 - 132,113,557 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000083208 ⟹ ENSRNOP00000074580
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 127,090,569 - 127,113,191 (+) Ensembl Rnor_6.0 Ensembl 6 132,090,218 - 132,113,118 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104095 ⟹ ENSRNOP00000096713
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 127,090,569 - 127,113,191 (+) Ensembl
RefSeq Acc Id:
NM_001109672 ⟹ NP_001103142
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 132,854,982 - 132,877,603 (+) NCBI mRatBN7.2 6 127,090,569 - 127,113,192 (+) NCBI Rnor_6.0 6 132,090,633 - 132,113,558 (+) NCBI Rnor_5.0 6 141,260,560 - 141,283,940 (+) NCBI RGSC_v3.4 6 132,547,058 - 132,569,679 (+) RGD Celera 6 124,649,851 - 124,672,436 (+) RGD
Sequence:
CGTCGCTAAGGGTTTTGCCTGAGGCGAGGGGTTGATGTTGGCCTGAAAAAGATCTTCAGAGGATTATAGCATTCTAGAGACCCATTGGGGAAGAACAAGTCTACGTCAATAAATGAAGGAGAACAAAG
hide sequence
RefSeq Acc Id:
XM_006240549 ⟹ XP_006240611
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 132,854,428 - 132,877,604 (+) NCBI mRatBN7.2 6 127,090,115 - 127,113,195 (+) NCBI Rnor_6.0 6 132,090,235 - 132,113,560 (+) NCBI Rnor_5.0 6 141,260,560 - 141,283,940 (+) NCBI
Sequence:
GACCATATTCGAGGATTCGATTGGTTAGATCTCGCCCACGATGAAGCTGTGATTGAACGACGGGGCTTTGGCCCCGCCTCCAGGCCGAAGTTCCGTTAACAGCTTTACTCTCTTCTAATTGGTTGACA
hide sequence
RefSeq Acc Id:
XM_006240551 ⟹ XP_006240613
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 132,854,697 - 132,877,604 (+) NCBI mRatBN7.2 6 127,090,296 - 127,113,195 (+) NCBI Rnor_6.0 6 132,090,362 - 132,113,560 (+) NCBI Rnor_5.0 6 141,260,560 - 141,283,940 (+) NCBI
Sequence:
CGCCAATGGGGCGGGGCGGCTAGGAGGGTGTGTGCGAGCGTTTCCCCTCCCACTACGGACGTCTGTCCACAGGACCGCCGGGTGGGCGGAGAAGTGACTGTAGACTTGTTACTCTTTTTTTTTTTTTT
hide sequence
RefSeq Acc Id:
XM_039112762 ⟹ XP_038968690
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 132,854,684 - 132,877,604 (+) NCBI mRatBN7.2 6 127,090,296 - 127,113,195 (+) NCBI
RefSeq Acc Id:
XM_063262339 ⟹ XP_063118409
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 132,854,529 - 132,877,604 (+) NCBI
RefSeq Acc Id:
XM_063262340 ⟹ XP_063118410
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 132,854,678 - 132,877,604 (+) NCBI
RefSeq Acc Id:
XM_063262341 ⟹ XP_063118411
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 132,854,681 - 132,877,604 (+) NCBI
RefSeq Acc Id:
NP_001103142 ⟸ NM_001109672
- UniProtKB:
A1L1L5 (UniProtKB/TrEMBL), F7EZL5 (UniProtKB/TrEMBL)
- Sequence:
MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQ
hide sequence
RefSeq Acc Id:
XP_006240611 ⟸ XM_006240549
- Peptide Label:
isoform X1
- UniProtKB:
A1L1L5 (UniProtKB/TrEMBL), F7EZL5 (UniProtKB/TrEMBL)
- Sequence:
MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQ
hide sequence
RefSeq Acc Id:
XP_006240613 ⟸ XM_006240551
- Peptide Label:
isoform X1
- UniProtKB:
A1L1L5 (UniProtKB/TrEMBL), F7EZL5 (UniProtKB/TrEMBL)
- Sequence:
MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000053998 ⟸ ENSRNOT00000057171
Ensembl Acc Id:
ENSRNOP00000074580 ⟸ ENSRNOT00000083208
RefSeq Acc Id:
XP_038968690 ⟸ XM_039112762
- Peptide Label:
isoform X1
- UniProtKB:
A1L1L5 (UniProtKB/TrEMBL), F7EZL5 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000096713 ⟸ ENSRNOT00000104095
RefSeq Acc Id:
XP_063118409 ⟸ XM_063262339
- Peptide Label:
isoform X1
- UniProtKB:
A1L1L5 (UniProtKB/TrEMBL), F7EZL5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118410 ⟸ XM_063262340
- Peptide Label:
isoform X1
- UniProtKB:
A1L1L5 (UniProtKB/TrEMBL), F7EZL5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118411 ⟸ XM_063262341
- Peptide Label:
isoform X1
- UniProtKB:
A1L1L5 (UniProtKB/TrEMBL), F7EZL5 (UniProtKB/TrEMBL)
RGD ID: 13694819 Promoter ID: EPDNEW_R5342 Type: multiple initiation site Name: Ccnk_1 Description: cyclin K SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 132,090,602 - 132,090,662 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2009-06-15
Ccnk
cyclin K
Ccnk_predicted
cyclin K (predicted)
Data merged from RGD:1308018
1643240 APPROVED
2008-03-05
Ccnk
cyclin K
LOC500715
similar to cyclin K
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-20
LOC500715
similar to cyclin K
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-12
Ccnk_predicted
cyclin K (predicted)
Symbol and Name status set to approved
70820 APPROVED
